[ { "title": "Rb1 loss modifies but does not initiate alveolar rhabdomyosarcoma.", "journal": "Skeletal muscle", "date": "2013", "authors": "Kikuchi K, Taniguchi E, Chen HH, Svalina MN, Abraham J, Huang ET, Nishijo K, Davis S, Louden C, Zarzabal LA, Recht O, Bajwa A, Berlow N, Suelves M, Perkins SL, Meltzer PS, Mansoor A, Michalek JE, Chen Y, Rubin BP, Keller C", "reference": { "type": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.24274149", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Integrity of the LXXLL motif in Stat6 is required for the inhibition of breast cancer cell growth and enhancement of differentiation in the context of progesterone.", "journal": "BMC cancer", "date": "2014-01-08", "authors": "Wei Min, He Qi, Yang Zhongyin, Wang Zhiwei, Zhang Qing, Liu Bingya, Gu Qinlong, Su Liping, Yu Yingyan, Zhu Zhenggang, Zhang Guofeng", "reference": { "type": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.24401087", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Downregulation of PAX6 by shRNA inhibits proliferation and cell cycle progression of human non-small cell lung cancer cell lines.", "journal": "PloS one", "date": "2014", "authors": "Zhao X, Yue W, Zhang L, Ma L, Jia W, Qian Z, Zhang C, Wang Y", "reference": { "type": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.24454925", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Silencing of protein kinase D2 induces glioma cell senescence via p53-dependent and -independent pathways.", "journal": "Neuro-oncology", "date": "2014", "authors": "Bernhart E, Damm S, Heffeter P, Wintersperger A, Asslaber M, Frank S, Hammer A, Strohmaier H, DeVaney T, Mrfka M, Eder H, Windpassinger C, Ireson CR, Mischel PS, Berger W, Sattler W", "reference": { "type": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 160, "end_pos": 160, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CAK and CCRK", "evidence": [ { "database": "UniProtKB", "id": "P24941", "url": "https://www.uniprot.org/uniprotkb/P24941" }, { "database": "iPTMnet", "id": "P24941", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24941" }, { "database": "PubMed", "id": "14597612", "url": "https://pubmed.ncbi.nlm.nih.gov/14597612" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18767875", "url": "https://pubmed.ncbi.nlm.nih.gov/18767875" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "12359725", "url": "https://pubmed.ncbi.nlm.nih.gov/12359725" }, { "database": "PubMed", "id": "10085115", "url": "https://pubmed.ncbi.nlm.nih.gov/10085115" }, { "database": "PubMed", "id": "10611320", "url": "https://pubmed.ncbi.nlm.nih.gov/10611320" }, { "database": "PubMed", "id": "10665655", "url": "https://pubmed.ncbi.nlm.nih.gov/10665655" }, { "database": "PubMed", "id": "11029468", "url": "https://pubmed.ncbi.nlm.nih.gov/11029468" }, { "database": "PubMed", "id": "11532001", "url": "https://pubmed.ncbi.nlm.nih.gov/11532001" }, { "database": "PubMed", "id": "12081504", "url": "https://pubmed.ncbi.nlm.nih.gov/12081504" }, { "database": "PubMed", "id": "12417722", "url": "https://pubmed.ncbi.nlm.nih.gov/12417722" }, { "database": "PubMed", "id": "12475985", "url": "https://pubmed.ncbi.nlm.nih.gov/12475985" }, { "database": "PubMed", "id": "12485874", "url": "https://pubmed.ncbi.nlm.nih.gov/12485874" }, { "database": "PubMed", "id": "1396589", "url": "https://pubmed.ncbi.nlm.nih.gov/1396589" }, { "database": "PubMed", "id": "14979923", "url": "https://pubmed.ncbi.nlm.nih.gov/14979923" }, { "database": "PubMed", "id": "15355984", "url": "https://pubmed.ncbi.nlm.nih.gov/15355984" }, { "database": "PubMed", "id": "15671017", "url": "https://pubmed.ncbi.nlm.nih.gov/15671017" }, { "database": "PubMed", "id": "15824106", "url": "https://pubmed.ncbi.nlm.nih.gov/15824106" }, { "database": "PubMed", "id": "16191191", "url": "https://pubmed.ncbi.nlm.nih.gov/16191191" }, { "database": "PubMed", "id": "16292742", "url": "https://pubmed.ncbi.nlm.nih.gov/16292742" }, { "database": "PubMed", "id": "16322252", "url": "https://pubmed.ncbi.nlm.nih.gov/16322252" }, { "database": "PubMed", "id": "16458085", "url": "https://pubmed.ncbi.nlm.nih.gov/16458085" }, { "database": "PubMed", "id": "17361108", "url": "https://pubmed.ncbi.nlm.nih.gov/17361108" }, { "database": "PubMed", "id": "18276582", "url": "https://pubmed.ncbi.nlm.nih.gov/18276582" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18396144", "url": "https://pubmed.ncbi.nlm.nih.gov/18396144" }, { "database": "PubMed", "id": "19233286", "url": "https://pubmed.ncbi.nlm.nih.gov/19233286" }, { "database": "PubMed", "id": "19320493", "url": "https://pubmed.ncbi.nlm.nih.gov/19320493" }, { "database": "PubMed", "id": "20017906", "url": "https://pubmed.ncbi.nlm.nih.gov/20017906" }, { "database": "PubMed", "id": "21275261", "url": "https://pubmed.ncbi.nlm.nih.gov/21275261" }, { "database": "PubMed", "id": "21750715", "url": "https://pubmed.ncbi.nlm.nih.gov/21750715" }, { "database": "PubMed", "id": "21834972", "url": "https://pubmed.ncbi.nlm.nih.gov/21834972" }, { "database": "PubMed", "id": "22253097", "url": "https://pubmed.ncbi.nlm.nih.gov/22253097" }, { "database": "PubMed", "id": "22415970", "url": "https://pubmed.ncbi.nlm.nih.gov/22415970" }, { "database": "PubMed", "id": "23028939", "url": "https://pubmed.ncbi.nlm.nih.gov/23028939" }, { "database": "PubMed", "id": "23437375", "url": "https://pubmed.ncbi.nlm.nih.gov/23437375" }, { "database": "PubMed", "id": "23737759", "url": "https://pubmed.ncbi.nlm.nih.gov/23737759" }, { "database": "PubMed", "id": "23781148", "url": "https://pubmed.ncbi.nlm.nih.gov/23781148" }, { "database": "PubMed", "id": "24444383", "url": "https://pubmed.ncbi.nlm.nih.gov/24444383" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24759790", "url": "https://pubmed.ncbi.nlm.nih.gov/24759790" }, { "database": "PubMed", "id": "24884804", "url": "https://pubmed.ncbi.nlm.nih.gov/24884804" }, { "database": "PubMed", "id": "25265915", "url": "https://pubmed.ncbi.nlm.nih.gov/25265915" }, { "database": "PubMed", "id": "25271736", "url": "https://pubmed.ncbi.nlm.nih.gov/25271736" }, { "database": "PubMed", "id": "25586224", "url": "https://pubmed.ncbi.nlm.nih.gov/25586224" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26830321", "url": "https://pubmed.ncbi.nlm.nih.gov/26830321" }, { "database": "PubMed", "id": "26876672", "url": "https://pubmed.ncbi.nlm.nih.gov/26876672" }, { "database": "PubMed", "id": "26917047", "url": "https://pubmed.ncbi.nlm.nih.gov/26917047" }, { "database": "PubMed", "id": "27965460", "url": "https://pubmed.ncbi.nlm.nih.gov/27965460" }, { "database": "PubMed", "id": "28521470", "url": "https://pubmed.ncbi.nlm.nih.gov/28521470" }, { "database": "PubMed", "id": "28575166", "url": "https://pubmed.ncbi.nlm.nih.gov/28575166" }, { "database": "PubMed", "id": "28835716", "url": "https://pubmed.ncbi.nlm.nih.gov/28835716" }, { "database": "PubMed", "id": "29253178", "url": "https://pubmed.ncbi.nlm.nih.gov/29253178" }, { "database": "PubMed", "id": "32393270", "url": "https://pubmed.ncbi.nlm.nih.gov/32393270" }, { "database": "PubMed", "id": "32992673", "url": "https://pubmed.ncbi.nlm.nih.gov/32992673" }, { "database": "PubMed", "id": "33352782", "url": "https://pubmed.ncbi.nlm.nih.gov/33352782" }, { "database": "PubMed", "id": "36001682", "url": "https://pubmed.ncbi.nlm.nih.gov/36001682" }, { "database": "PubMed", "id": "7569954", "url": "https://pubmed.ncbi.nlm.nih.gov/7569954" }, { "database": "PubMed", "id": "7641182", "url": "https://pubmed.ncbi.nlm.nih.gov/7641182" }, { "database": "PubMed", "id": "7954429", "url": "https://pubmed.ncbi.nlm.nih.gov/7954429" }, { "database": "PubMed", "id": "8443411", "url": "https://pubmed.ncbi.nlm.nih.gov/8443411" }, { "database": "PubMed", "id": "8560263", "url": "https://pubmed.ncbi.nlm.nih.gov/8560263" }, { "database": "PubMed", "id": "8891334", "url": "https://pubmed.ncbi.nlm.nih.gov/8891334" }, { "database": "PubMed", "id": "9038181", "url": "https://pubmed.ncbi.nlm.nih.gov/9038181" }, { "database": "PubMed", "id": "9251027", "url": "https://pubmed.ncbi.nlm.nih.gov/9251027" }, { "database": "PubMed", "id": "9401001", "url": "https://pubmed.ncbi.nlm.nih.gov/9401001" }, { "database": "PubMed", "id": "16325401", "url": "https://pubmed.ncbi.nlm.nih.gov/16325401" }, { "database": "PubMed", "id": "17095507", "url": "https://pubmed.ncbi.nlm.nih.gov/17095507" }, { "database": "PubMed", "id": "17570665", "url": "https://pubmed.ncbi.nlm.nih.gov/17570665" }, { "database": "PubMed", "id": "20147522", "url": "https://pubmed.ncbi.nlm.nih.gov/20147522" }, { "database": "PubMed", "id": "20360007", "url": "https://pubmed.ncbi.nlm.nih.gov/20360007" }, { "database": "PubMed", "id": "21565702", "url": "https://pubmed.ncbi.nlm.nih.gov/21565702" }, { "database": "PubMed", "id": "28666995", "url": "https://pubmed.ncbi.nlm.nih.gov/28666995" } ], "site_lbl": "Thr160", "uniprot_canonical_ac": "P24941-1" } ], "record_id": "pubmed.24463355", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct and site-specific phosphorylation of the retinoblastoma protein at serine 612 in differentiated cells.", "journal": "PloS one", "date": "2014", "authors": "Hattori T, Uchida C, Takahashi H, Yamamoto N, Naito M, Taya Y", "reference": { "type": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "IntAct", "id": "P06400", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06400*" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "17380128", "url": "https://pubmed.ncbi.nlm.nih.gov/17380128" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "26265441", "url": "https://pubmed.ncbi.nlm.nih.gov/26265441" } ], "site_lbl": "Thr356", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 612, "end_pos": 612, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CHEK2 and CHEK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "IntAct", "id": "P06400", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06400*" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "17380128", "url": "https://pubmed.ncbi.nlm.nih.gov/17380128" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "22322860", "url": "https://pubmed.ncbi.nlm.nih.gov/22322860" }, { "database": "PubMed", "id": "23437375", "url": "https://pubmed.ncbi.nlm.nih.gov/23437375" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "29468543", "url": "https://pubmed.ncbi.nlm.nih.gov/29468543" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" } ], "site_lbl": "Ser612", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.24466208", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic characterization of the role of the Cip/Kip family of proteins as cyclin-dependent kinase inhibitors and assembly factors.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Cerqueira A, Martin A, Symonds CE, Odajima J, Dubus P, Barbacid M, Santamaria D", "reference": { "type": "PubMed", "id": "24515438", "url": "https://pubmed.ncbi.nlm.nih.gov/24515438" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24515438", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mig-6 participates in the regulation of cell senescence and retinoblastoma protein phosphorylation.", "journal": "Cellular signalling", "date": "2014", "authors": "Milewska M, Kolch W", "reference": { "type": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "IEDB", "id": "P06400", "url": "https://www.iedb.org/epitope/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "27869121", "url": "https://pubmed.ncbi.nlm.nih.gov/27869121" }, { "database": "PubMed", "id": "31848261", "url": "https://pubmed.ncbi.nlm.nih.gov/31848261" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "29468545", "url": "https://pubmed.ncbi.nlm.nih.gov/29468545" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr252", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.24815188", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclin D activates the Rb tumor suppressor by mono-phosphorylation.", "journal": "eLife", "date": "2014", "authors": "Narasimha AM, Kaulich M, Shapiro GS, Choi YJ, Sicinski P, Dowdy SF", "reference": { "type": "PubMed", "id": "24876129", "url": "https://pubmed.ncbi.nlm.nih.gov/24876129" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24876129", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AG1478 inhibits the migration and invasion of cisplatin-resistant human lung adenocarcinoma cells via the cell cycle regulation by matrix metalloproteinase-9.", "journal": "Oncology letters", "date": "2014-08", "authors": "Ma Li, Yan Huiqin, Zhou Qinhua", "reference": { "type": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.25009665", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Suppression of BRCA1 sensitizes cells to proteasome inhibitors.", "journal": "Cell death & disease", "date": "2014", "authors": "Gu Y, Bouwman P, Greco D, Saarela J, Yadav B, Jonkers J, Kuznetsov SG", "reference": { "type": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.25522274", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for a CDK4-dependent checkpoint in a conditional model of cellular senescence.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2015", "authors": "Brookes S, Gagrica S, Sanij E, Rowe J, Gregory FJ, Hara E, Peters G", "reference": { "type": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 826, "end_pos": 826, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK4", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "23737759", "url": "https://pubmed.ncbi.nlm.nih.gov/23737759" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "16360038", "url": "https://pubmed.ncbi.nlm.nih.gov/16360038" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr826", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.25695870", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "VHL negatively regulates SARS coronavirus replication by modulating nsp16 ubiquitination and stability.", "journal": "Biochemical and biophysical research communications", "date": "2015", "authors": "Yu X, Chen S, Hou P, Wang M, Chen Y, Guo D", "reference": { "type": "PubMed", "id": "25732088", "url": "https://pubmed.ncbi.nlm.nih.gov/25732088" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17844-1", "protein_name": "Probable ATP-dependent RNA helicase DDX5", "gene_name": "DDX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40337-1", "protein_name": "von Hippel-Lindau disease tumor suppressor", "gene_name": "VHL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TBF4-1", "protein_name": "Zinc finger CCHC-type and RNA-binding motif-containing protein 1", "gene_name": "ZCRB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25732088", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Flavonoid 4'-O-Methylkuwanon E from Morus alba Induces the Differentiation of THP-1 Human Leukemia Cells.", "journal": "Evidence-based complementary and alternative medicine : eCAM", "date": "2015", "authors": "Kollar P, Barta T, Keltosova S, Trnova P, Muller Zavalova V, Smejkal K, Hosek J, Fedr R, Soucek K, Hampl A", "reference": { "type": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.25737734", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oncogenic point mutations in the human retinoblastoma gene: their application to genetic counseling.", "journal": "The New England journal of medicine", "date": "1989", "authors": "Yandell DW, Campbell TA, Dayton SH, Petersen R, Walton D, Little JB, McConkie-Rosell A, Buckley EG, Dryja TP", "reference": { "type": "PubMed", "id": "2594029", "url": "https://pubmed.ncbi.nlm.nih.gov/2594029" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2594029", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Increased phosphorylation on residue S795 of the retinoblastoma protein in esophageal adenocarcinoma.", "journal": "International journal of oncology", "date": "2015-08", "authors": "Davelaar Akueni L, Straub Danielle, Parikh Kaushal B, Lau Liana, Fockens Paul, Krishnadath Kausilia K", "reference": { "type": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.26058606", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Haploinsufficiency for BRCA1 leads to cell-type-specific genomic instability and premature senescence.", "journal": "Nature communications", "date": "2015", "authors": "Sedic M, Skibinski A, Brown N, Gallardo M, Mulligan P, Martinez P, Keller PJ, Glover E, Richardson AL, Cowan J, Toland AE, Ravichandran K, Riethman H, Naber SP, Naar AM, Blasco MA, Hinds PW, Kuperwasser C", "reference": { "type": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK5, PRPK, AMPK, NUAK1 and ATM", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10864201", "url": "https://pubmed.ncbi.nlm.nih.gov/10864201" }, { "database": "PubMed", "id": "15580310", "url": "https://pubmed.ncbi.nlm.nih.gov/15580310" }, { "database": "IntAct", "id": "P04637", "url": "https://www.ebi.ac.uk/intact/interactors/id:P04637*" }, { "database": "PubMed", "id": "19883646", "url": "https://pubmed.ncbi.nlm.nih.gov/19883646" }, { "database": "PubMed", "id": "15381073", "url": "https://pubmed.ncbi.nlm.nih.gov/15381073" }, { "database": "PubMed", "id": "15866171", "url": "https://pubmed.ncbi.nlm.nih.gov/15866171" }, { "database": "PubMed", "id": "17591690", "url": "https://pubmed.ncbi.nlm.nih.gov/17591690" }, { "database": "PubMed", "id": "19828454", "url": "https://pubmed.ncbi.nlm.nih.gov/19828454" }, { "database": "PubMed", "id": "9363941", "url": "https://pubmed.ncbi.nlm.nih.gov/9363941" }, { "database": "PubMed", "id": "9925639", "url": "https://pubmed.ncbi.nlm.nih.gov/9925639" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "10202145", "url": "https://pubmed.ncbi.nlm.nih.gov/10202145" }, { "database": "PubMed", "id": "10606744", "url": "https://pubmed.ncbi.nlm.nih.gov/10606744" }, { "database": "PubMed", "id": "14712210", "url": "https://pubmed.ncbi.nlm.nih.gov/14712210" }, { "database": "PubMed", "id": "15642743", "url": "https://pubmed.ncbi.nlm.nih.gov/15642743" }, { "database": "PubMed", "id": "21317932", "url": "https://pubmed.ncbi.nlm.nih.gov/21317932" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "10082548", "url": "https://pubmed.ncbi.nlm.nih.gov/10082548" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10425208", "url": "https://pubmed.ncbi.nlm.nih.gov/10425208" }, { "database": "PubMed", "id": "10435622", "url": "https://pubmed.ncbi.nlm.nih.gov/10435622" }, { "database": "PubMed", "id": "10485486", "url": "https://pubmed.ncbi.nlm.nih.gov/10485486" }, { "database": "PubMed", "id": "10500142", "url": "https://pubmed.ncbi.nlm.nih.gov/10500142" }, { "database": "PubMed", "id": "10535931", "url": "https://pubmed.ncbi.nlm.nih.gov/10535931" }, { "database": "PubMed", "id": "10544021", "url": "https://pubmed.ncbi.nlm.nih.gov/10544021" }, { "database": "PubMed", "id": "10570149", "url": "https://pubmed.ncbi.nlm.nih.gov/10570149" }, { "database": "PubMed", "id": "10601022", "url": "https://pubmed.ncbi.nlm.nih.gov/10601022" }, { "database": "PubMed", "id": "10656682", "url": "https://pubmed.ncbi.nlm.nih.gov/10656682" }, { "database": "PubMed", "id": "10713094", "url": "https://pubmed.ncbi.nlm.nih.gov/10713094" }, { "database": "PubMed", "id": "10723129", "url": "https://pubmed.ncbi.nlm.nih.gov/10723129" }, { "database": "PubMed", "id": "10734067", "url": "https://pubmed.ncbi.nlm.nih.gov/10734067" }, { "database": "PubMed", "id": "10734308", "url": "https://pubmed.ncbi.nlm.nih.gov/10734308" }, { "database": "PubMed", "id": "10749144", "url": "https://pubmed.ncbi.nlm.nih.gov/10749144" }, { "database": "PubMed", "id": "10779327", "url": "https://pubmed.ncbi.nlm.nih.gov/10779327" }, { "database": "PubMed", "id": "10860736", "url": "https://pubmed.ncbi.nlm.nih.gov/10860736" }, { "database": "PubMed", "id": "10930428", "url": "https://pubmed.ncbi.nlm.nih.gov/10930428" }, { "database": "PubMed", "id": "11042698", "url": "https://pubmed.ncbi.nlm.nih.gov/11042698" }, { "database": "PubMed", "id": "11080808", "url": "https://pubmed.ncbi.nlm.nih.gov/11080808" }, { "database": "PubMed", "id": "11096068", "url": "https://pubmed.ncbi.nlm.nih.gov/11096068" }, { "database": "PubMed", "id": "11099484", "url": "https://pubmed.ncbi.nlm.nih.gov/11099484" }, { "database": "PubMed", "id": "11103796", "url": "https://pubmed.ncbi.nlm.nih.gov/11103796" }, { "database": "PubMed", "id": "11121242", "url": "https://pubmed.ncbi.nlm.nih.gov/11121242" }, { "database": "PubMed", "id": "11149936", "url": "https://pubmed.ncbi.nlm.nih.gov/11149936" }, { "database": "PubMed", "id": "11244509", "url": "https://pubmed.ncbi.nlm.nih.gov/11244509" }, { "database": "PubMed", "id": "11245472", "url": "https://pubmed.ncbi.nlm.nih.gov/11245472" }, { "database": "PubMed", "id": "11279192", "url": "https://pubmed.ncbi.nlm.nih.gov/11279192" }, { "database": "PubMed", "id": "11302731", "url": "https://pubmed.ncbi.nlm.nih.gov/11302731" }, { "database": "PubMed", "id": "11313957", "url": "https://pubmed.ncbi.nlm.nih.gov/11313957" }, { "database": "PubMed", "id": "11314044", "url": "https://pubmed.ncbi.nlm.nih.gov/11314044" }, { "database": "PubMed", "id": "11323395", "url": "https://pubmed.ncbi.nlm.nih.gov/11323395" }, { "database": "PubMed", "id": "11326311", "url": "https://pubmed.ncbi.nlm.nih.gov/11326311" }, { "database": "PubMed", "id": "11397945", "url": "https://pubmed.ncbi.nlm.nih.gov/11397945" }, { "database": "PubMed", "id": "11447225", "url": "https://pubmed.ncbi.nlm.nih.gov/11447225" }, { "database": "PubMed", "id": "11470744", "url": "https://pubmed.ncbi.nlm.nih.gov/11470744" }, { "database": "PubMed", "id": "11483158", "url": "https://pubmed.ncbi.nlm.nih.gov/11483158" }, { "database": "PubMed", "id": "11494044", "url": "https://pubmed.ncbi.nlm.nih.gov/11494044" }, { "database": "PubMed", "id": "11495913", "url": "https://pubmed.ncbi.nlm.nih.gov/11495913" }, { "database": "PubMed", "id": "11532197", "url": "https://pubmed.ncbi.nlm.nih.gov/11532197" }, { "database": "PubMed", "id": "11568365", "url": "https://pubmed.ncbi.nlm.nih.gov/11568365" }, { "database": "PubMed", "id": "11583595", "url": "https://pubmed.ncbi.nlm.nih.gov/11583595" }, { "database": "PubMed", "id": "11602639", "url": "https://pubmed.ncbi.nlm.nih.gov/11602639" }, { "database": "PubMed", "id": "11706017", "url": "https://pubmed.ncbi.nlm.nih.gov/11706017" }, { "database": "PubMed", "id": "11709713", "url": "https://pubmed.ncbi.nlm.nih.gov/11709713" }, { "database": "PubMed", "id": "11751391", "url": "https://pubmed.ncbi.nlm.nih.gov/11751391" }, { "database": "PubMed", "id": "11850826", "url": "https://pubmed.ncbi.nlm.nih.gov/11850826" }, { "database": "PubMed", "id": "11857452", "url": "https://pubmed.ncbi.nlm.nih.gov/11857452" }, { "database": "PubMed", "id": "11861384", "url": "https://pubmed.ncbi.nlm.nih.gov/11861384" }, { "database": "PubMed", "id": "11865061", "url": "https://pubmed.ncbi.nlm.nih.gov/11865061" }, { "database": "PubMed", "id": "11875057", "url": "https://pubmed.ncbi.nlm.nih.gov/11875057" }, { "database": "PubMed", "id": "11877452", "url": "https://pubmed.ncbi.nlm.nih.gov/11877452" }, { "database": "PubMed", "id": "11890931", "url": "https://pubmed.ncbi.nlm.nih.gov/11890931" }, { "database": "PubMed", "id": "11927575", "url": "https://pubmed.ncbi.nlm.nih.gov/11927575" }, { "database": "PubMed", "id": "11965244", "url": "https://pubmed.ncbi.nlm.nih.gov/11965244" }, { "database": "PubMed", "id": "11973611", "url": "https://pubmed.ncbi.nlm.nih.gov/11973611" }, { "database": "PubMed", "id": "12066222", "url": "https://pubmed.ncbi.nlm.nih.gov/12066222" }, { "database": "PubMed", "id": "12071847", "url": "https://pubmed.ncbi.nlm.nih.gov/12071847" }, { "database": "PubMed", "id": "12082025", "url": "https://pubmed.ncbi.nlm.nih.gov/12082025" }, { "database": "PubMed", "id": "12082529", "url": "https://pubmed.ncbi.nlm.nih.gov/12082529" }, { "database": "PubMed", "id": "12091386", "url": "https://pubmed.ncbi.nlm.nih.gov/12091386" }, { "database": "PubMed", "id": "12131363", "url": "https://pubmed.ncbi.nlm.nih.gov/12131363" }, { "database": "PubMed", "id": "12145207", "url": "https://pubmed.ncbi.nlm.nih.gov/12145207" }, { "database": "PubMed", "id": "12151394", "url": "https://pubmed.ncbi.nlm.nih.gov/12151394" }, { "database": "PubMed", "id": "12238331", "url": "https://pubmed.ncbi.nlm.nih.gov/12238331" }, { "database": "PubMed", "id": "12381304", "url": "https://pubmed.ncbi.nlm.nih.gov/12381304" }, { "database": "PubMed", "id": "12393500", "url": "https://pubmed.ncbi.nlm.nih.gov/12393500" }, { "database": "PubMed", "id": "12419181", "url": "https://pubmed.ncbi.nlm.nih.gov/12419181" }, { "database": "PubMed", "id": "12427754", "url": "https://pubmed.ncbi.nlm.nih.gov/12427754" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "12478472", "url": "https://pubmed.ncbi.nlm.nih.gov/12478472" }, { "database": "PubMed", "id": "12518062", "url": "https://pubmed.ncbi.nlm.nih.gov/12518062" }, { "database": "PubMed", "id": "12519780", "url": "https://pubmed.ncbi.nlm.nih.gov/12519780" }, { "database": "PubMed", "id": "12531896", "url": "https://pubmed.ncbi.nlm.nih.gov/12531896" }, { "database": "PubMed", "id": "12534344", "url": "https://pubmed.ncbi.nlm.nih.gov/12534344" }, { "database": "PubMed", "id": "12584171", "url": "https://pubmed.ncbi.nlm.nih.gov/12584171" }, { "database": "PubMed", "id": "12606123", "url": "https://pubmed.ncbi.nlm.nih.gov/12606123" }, { "database": "PubMed", "id": "12612087", "url": "https://pubmed.ncbi.nlm.nih.gov/12612087" }, { "database": "PubMed", "id": "12644594", "url": "https://pubmed.ncbi.nlm.nih.gov/12644594" }, { "database": "PubMed", "id": "12659830", "url": "https://pubmed.ncbi.nlm.nih.gov/12659830" }, { "database": "PubMed", "id": "12676607", "url": "https://pubmed.ncbi.nlm.nih.gov/12676607" }, { "database": "PubMed", "id": "12698201", "url": "https://pubmed.ncbi.nlm.nih.gov/12698201" }, { "database": "PubMed", "id": "12702572", "url": "https://pubmed.ncbi.nlm.nih.gov/12702572" }, { "database": "PubMed", "id": "12719724", "url": "https://pubmed.ncbi.nlm.nih.gov/12719724" }, { "database": "PubMed", "id": "12756247", "url": "https://pubmed.ncbi.nlm.nih.gov/12756247" }, { "database": "PubMed", "id": "12767922", "url": "https://pubmed.ncbi.nlm.nih.gov/12767922" }, { "database": "PubMed", "id": "12811820", "url": "https://pubmed.ncbi.nlm.nih.gov/12811820" }, { "database": "PubMed", "id": "12853888", "url": "https://pubmed.ncbi.nlm.nih.gov/12853888" }, { "database": "PubMed", "id": "12857758", "url": "https://pubmed.ncbi.nlm.nih.gov/12857758" }, { "database": "PubMed", "id": "12860987", "url": "https://pubmed.ncbi.nlm.nih.gov/12860987" }, { "database": "PubMed", "id": "12890678", "url": "https://pubmed.ncbi.nlm.nih.gov/12890678" }, { "database": "PubMed", "id": "12902982", "url": "https://pubmed.ncbi.nlm.nih.gov/12902982" }, { "database": "PubMed", "id": "12912974", "url": "https://pubmed.ncbi.nlm.nih.gov/12912974" }, { "database": "PubMed", "id": "12919932", "url": "https://pubmed.ncbi.nlm.nih.gov/12919932" }, { "database": "PubMed", "id": "12939400", "url": "https://pubmed.ncbi.nlm.nih.gov/12939400" }, { "database": "PubMed", "id": "12951835", "url": "https://pubmed.ncbi.nlm.nih.gov/12951835" }, { "database": "PubMed", "id": "12959929", "url": "https://pubmed.ncbi.nlm.nih.gov/12959929" }, { "database": "PubMed", "id": "12968928", "url": "https://pubmed.ncbi.nlm.nih.gov/12968928" }, { "database": "PubMed", "id": "13678348", "url": "https://pubmed.ncbi.nlm.nih.gov/13678348" }, { "database": "PubMed", "id": "1406679", "url": "https://pubmed.ncbi.nlm.nih.gov/1406679" }, { "database": "PubMed", "id": "14511359", "url": "https://pubmed.ncbi.nlm.nih.gov/14511359" }, { "database": "PubMed", "id": "14513366", "url": "https://pubmed.ncbi.nlm.nih.gov/14513366" }, { "database": "PubMed", "id": "14527925", "url": "https://pubmed.ncbi.nlm.nih.gov/14527925" }, { "database": "PubMed", "id": "14559802", "url": "https://pubmed.ncbi.nlm.nih.gov/14559802" }, { "database": "PubMed", "id": "14612532", "url": "https://pubmed.ncbi.nlm.nih.gov/14612532" }, { "database": "PubMed", "id": "14617104", "url": "https://pubmed.ncbi.nlm.nih.gov/14617104" }, { "database": "PubMed", "id": "14623946", "url": "https://pubmed.ncbi.nlm.nih.gov/14623946" }, { "database": "PubMed", "id": "14637186", "url": "https://pubmed.ncbi.nlm.nih.gov/14637186" }, { "database": "PubMed", "id": "14680293", "url": "https://pubmed.ncbi.nlm.nih.gov/14680293" }, { "database": "PubMed", "id": "14755247", "url": "https://pubmed.ncbi.nlm.nih.gov/14755247" }, { "database": "PubMed", "id": "14757188", "url": "https://pubmed.ncbi.nlm.nih.gov/14757188" }, { "database": "PubMed", "id": "14871840", "url": "https://pubmed.ncbi.nlm.nih.gov/14871840" }, { "database": "PubMed", "id": "14965474", "url": "https://pubmed.ncbi.nlm.nih.gov/14965474" }, { "database": "PubMed", "id": "14967811", "url": "https://pubmed.ncbi.nlm.nih.gov/14967811" }, { "database": "PubMed", "id": "14968111", "url": "https://pubmed.ncbi.nlm.nih.gov/14968111" }, { "database": "PubMed", "id": "14993250", "url": "https://pubmed.ncbi.nlm.nih.gov/14993250" }, { "database": "PubMed", "id": "15001399", "url": "https://pubmed.ncbi.nlm.nih.gov/15001399" }, { "database": "PubMed", "id": "15026814", "url": "https://pubmed.ncbi.nlm.nih.gov/15026814" }, { "database": "PubMed", "id": "15077171", "url": "https://pubmed.ncbi.nlm.nih.gov/15077171" }, { "database": "PubMed", "id": "15081425", "url": "https://pubmed.ncbi.nlm.nih.gov/15081425" }, { "database": "PubMed", "id": "15095398", "url": "https://pubmed.ncbi.nlm.nih.gov/15095398" }, { "database": "PubMed", "id": "15155458", "url": "https://pubmed.ncbi.nlm.nih.gov/15155458" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "15159417", "url": "https://pubmed.ncbi.nlm.nih.gov/15159417" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15178317", "url": "https://pubmed.ncbi.nlm.nih.gov/15178317" }, { "database": "PubMed", "id": "15178764", "url": "https://pubmed.ncbi.nlm.nih.gov/15178764" }, { "database": "PubMed", "id": "15181149", "url": "https://pubmed.ncbi.nlm.nih.gov/15181149" }, { "database": "PubMed", "id": "15188005", "url": "https://pubmed.ncbi.nlm.nih.gov/15188005" }, { "database": "PubMed", "id": "15199542", "url": "https://pubmed.ncbi.nlm.nih.gov/15199542" }, { "database": "PubMed", "id": "15226436", "url": "https://pubmed.ncbi.nlm.nih.gov/15226436" }, { "database": "PubMed", "id": "15252149", "url": "https://pubmed.ncbi.nlm.nih.gov/15252149" }, { "database": "PubMed", "id": "15254178", "url": "https://pubmed.ncbi.nlm.nih.gov/15254178" }, { "database": "PubMed", "id": "15289875", "url": "https://pubmed.ncbi.nlm.nih.gov/15289875" }, { "database": "PubMed", "id": "15310764", "url": "https://pubmed.ncbi.nlm.nih.gov/15310764" }, { "database": "PubMed", "id": "15322239", "url": "https://pubmed.ncbi.nlm.nih.gov/15322239" }, { "database": "PubMed", "id": "15355354", "url": "https://pubmed.ncbi.nlm.nih.gov/15355354" }, { "database": "PubMed", "id": "15381086", "url": "https://pubmed.ncbi.nlm.nih.gov/15381086" }, { "database": "PubMed", "id": "15456759", "url": "https://pubmed.ncbi.nlm.nih.gov/15456759" }, { "database": "PubMed", "id": "15464845", "url": "https://pubmed.ncbi.nlm.nih.gov/15464845" }, { "database": "PubMed", "id": "15471885", "url": "https://pubmed.ncbi.nlm.nih.gov/15471885" }, { "database": "PubMed", "id": "15474986", "url": "https://pubmed.ncbi.nlm.nih.gov/15474986" }, { "database": "PubMed", "id": "15489892", "url": "https://pubmed.ncbi.nlm.nih.gov/15489892" }, { "database": "PubMed", "id": "15492510", "url": "https://pubmed.ncbi.nlm.nih.gov/15492510" }, { "database": "PubMed", "id": "15492790", "url": "https://pubmed.ncbi.nlm.nih.gov/15492790" }, { "database": "PubMed", "id": "15533933", "url": "https://pubmed.ncbi.nlm.nih.gov/15533933" }, { "database": "PubMed", "id": "15539919", "url": "https://pubmed.ncbi.nlm.nih.gov/15539919" }, { "database": "PubMed", "id": "15542774", "url": "https://pubmed.ncbi.nlm.nih.gov/15542774" }, { "database": "PubMed", "id": "15557124", "url": "https://pubmed.ncbi.nlm.nih.gov/15557124" }, { "database": "PubMed", "id": "15613785", "url": "https://pubmed.ncbi.nlm.nih.gov/15613785" }, { "database": "PubMed", "id": "15650224", "url": "https://pubmed.ncbi.nlm.nih.gov/15650224" }, { "database": "PubMed", "id": "15657356", "url": "https://pubmed.ncbi.nlm.nih.gov/15657356" }, { "database": "PubMed", "id": "15710360", "url": "https://pubmed.ncbi.nlm.nih.gov/15710360" }, { "database": "PubMed", "id": "15713892", "url": "https://pubmed.ncbi.nlm.nih.gov/15713892" }, { "database": "PubMed", "id": "15720815", "url": "https://pubmed.ncbi.nlm.nih.gov/15720815" }, { "database": "PubMed", "id": "15735102", "url": "https://pubmed.ncbi.nlm.nih.gov/15735102" }, { "database": "PubMed", "id": "15752772", "url": "https://pubmed.ncbi.nlm.nih.gov/15752772" }, { "database": "PubMed", "id": "15782130", "url": "https://pubmed.ncbi.nlm.nih.gov/15782130" }, { "database": "PubMed", "id": "15794754", "url": "https://pubmed.ncbi.nlm.nih.gov/15794754" }, { "database": "PubMed", "id": "15795939", "url": "https://pubmed.ncbi.nlm.nih.gov/15795939" }, { "database": "PubMed", "id": "15837074", "url": "https://pubmed.ncbi.nlm.nih.gov/15837074" }, { "database": "PubMed", "id": "15845651", "url": "https://pubmed.ncbi.nlm.nih.gov/15845651" }, { "database": "PubMed", "id": "15867353", "url": "https://pubmed.ncbi.nlm.nih.gov/15867353" }, { "database": "PubMed", "id": "15888160", "url": "https://pubmed.ncbi.nlm.nih.gov/15888160" }, { "database": "PubMed", "id": "15908423", "url": "https://pubmed.ncbi.nlm.nih.gov/15908423" }, { "database": "PubMed", "id": "16024610", "url": "https://pubmed.ncbi.nlm.nih.gov/16024610" }, { "database": "PubMed", "id": "16024799", "url": "https://pubmed.ncbi.nlm.nih.gov/16024799" }, { "database": "PubMed", "id": "16043514", "url": "https://pubmed.ncbi.nlm.nih.gov/16043514" }, { "database": "PubMed", "id": "16082226", "url": "https://pubmed.ncbi.nlm.nih.gov/16082226" }, { "database": "PubMed", "id": "16096427", "url": "https://pubmed.ncbi.nlm.nih.gov/16096427" }, { "database": "PubMed", "id": "16103197", "url": "https://pubmed.ncbi.nlm.nih.gov/16103197" }, { "database": "PubMed", "id": "16140041", "url": "https://pubmed.ncbi.nlm.nih.gov/16140041" }, { "database": "PubMed", "id": "16177561", "url": "https://pubmed.ncbi.nlm.nih.gov/16177561" }, { "database": "PubMed", "id": "16179498", "url": "https://pubmed.ncbi.nlm.nih.gov/16179498" }, { "database": "PubMed", "id": "16180010", "url": "https://pubmed.ncbi.nlm.nih.gov/16180010" }, { "database": "PubMed", "id": "16227412", "url": "https://pubmed.ncbi.nlm.nih.gov/16227412" }, { "database": "PubMed", "id": "16229013", "url": "https://pubmed.ncbi.nlm.nih.gov/16229013" }, { "database": "PubMed", "id": "16302093", "url": "https://pubmed.ncbi.nlm.nih.gov/16302093" }, { "database": "PubMed", "id": "16313886", "url": "https://pubmed.ncbi.nlm.nih.gov/16313886" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16322229", "url": "https://pubmed.ncbi.nlm.nih.gov/16322229" }, { "database": "PubMed", "id": "16397295", "url": "https://pubmed.ncbi.nlm.nih.gov/16397295" }, { "database": "PubMed", "id": "16414131", "url": "https://pubmed.ncbi.nlm.nih.gov/16414131" }, { "database": "PubMed", "id": "16433685", "url": "https://pubmed.ncbi.nlm.nih.gov/16433685" }, { "database": "PubMed", "id": "16436515", "url": "https://pubmed.ncbi.nlm.nih.gov/16436515" }, { "database": "PubMed", "id": "16474133", "url": "https://pubmed.ncbi.nlm.nih.gov/16474133" }, { "database": "PubMed", "id": "16489034", "url": "https://pubmed.ncbi.nlm.nih.gov/16489034" }, { "database": "PubMed", "id": "16501611", "url": "https://pubmed.ncbi.nlm.nih.gov/16501611" }, { "database": "PubMed", "id": "16537920", "url": "https://pubmed.ncbi.nlm.nih.gov/16537920" }, { "database": "PubMed", "id": "16538517", "url": "https://pubmed.ncbi.nlm.nih.gov/16538517" }, { "database": "PubMed", "id": "16584535", "url": "https://pubmed.ncbi.nlm.nih.gov/16584535" }, { "database": "PubMed", "id": "16600182", "url": "https://pubmed.ncbi.nlm.nih.gov/16600182" }, { "database": "PubMed", "id": "16611888", "url": "https://pubmed.ncbi.nlm.nih.gov/16611888" }, { "database": "PubMed", "id": "16618811", "url": "https://pubmed.ncbi.nlm.nih.gov/16618811" }, { "database": "PubMed", "id": "16630142", "url": "https://pubmed.ncbi.nlm.nih.gov/16630142" }, { "database": "PubMed", "id": "16632641", "url": "https://pubmed.ncbi.nlm.nih.gov/16632641" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16705155", "url": "https://pubmed.ncbi.nlm.nih.gov/16705155" }, { "database": "PubMed", "id": "16714289", "url": "https://pubmed.ncbi.nlm.nih.gov/16714289" }, { "database": "PubMed", "id": "16715525", "url": "https://pubmed.ncbi.nlm.nih.gov/16715525" }, { "database": "PubMed", "id": "16731759", "url": "https://pubmed.ncbi.nlm.nih.gov/16731759" }, { "database": "PubMed", "id": "16751801", "url": "https://pubmed.ncbi.nlm.nih.gov/16751801" }, { "database": "PubMed", "id": "16753148", "url": "https://pubmed.ncbi.nlm.nih.gov/16753148" }, { "database": "PubMed", "id": "16777994", "url": "https://pubmed.ncbi.nlm.nih.gov/16777994" }, { "database": "PubMed", "id": "16778146", "url": "https://pubmed.ncbi.nlm.nih.gov/16778146" }, { "database": "PubMed", "id": "16801388", "url": "https://pubmed.ncbi.nlm.nih.gov/16801388" }, { "database": "PubMed", "id": "16814113", "url": "https://pubmed.ncbi.nlm.nih.gov/16814113" }, { "database": "PubMed", "id": "16815295", "url": "https://pubmed.ncbi.nlm.nih.gov/16815295" }, { "database": "PubMed", "id": "16818520", "url": "https://pubmed.ncbi.nlm.nih.gov/16818520" }, { "database": "PubMed", "id": "16827804", "url": "https://pubmed.ncbi.nlm.nih.gov/16827804" }, { "database": "PubMed", "id": "16891474", "url": "https://pubmed.ncbi.nlm.nih.gov/16891474" }, { "database": "PubMed", "id": "16912307", "url": "https://pubmed.ncbi.nlm.nih.gov/16912307" }, { "database": "PubMed", "id": "16928824", "url": "https://pubmed.ncbi.nlm.nih.gov/16928824" }, { "database": "PubMed", "id": "16966622", "url": "https://pubmed.ncbi.nlm.nih.gov/16966622" }, { "database": "PubMed", "id": "16970927", "url": "https://pubmed.ncbi.nlm.nih.gov/16970927" }, { "database": "PubMed", "id": "16971507", "url": "https://pubmed.ncbi.nlm.nih.gov/16971507" }, { "database": "PubMed", "id": "17105820", "url": "https://pubmed.ncbi.nlm.nih.gov/17105820" }, { "database": "PubMed", "id": "17106255", "url": "https://pubmed.ncbi.nlm.nih.gov/17106255" }, { "database": "PubMed", "id": "17108107", "url": "https://pubmed.ncbi.nlm.nih.gov/17108107" }, { "database": "PubMed", "id": "17113036", "url": "https://pubmed.ncbi.nlm.nih.gov/17113036" }, { "database": "PubMed", "id": "17126818", "url": "https://pubmed.ncbi.nlm.nih.gov/17126818" }, { "database": "PubMed", "id": "17172431", "url": "https://pubmed.ncbi.nlm.nih.gov/17172431" }, { "database": "PubMed", "id": "17174366", "url": "https://pubmed.ncbi.nlm.nih.gov/17174366" }, { "database": "PubMed", "id": "17230520", "url": "https://pubmed.ncbi.nlm.nih.gov/17230520" }, { "database": "PubMed", "id": "17241873", "url": "https://pubmed.ncbi.nlm.nih.gov/17241873" }, { "database": "PubMed", "id": "17257432", "url": "https://pubmed.ncbi.nlm.nih.gov/17257432" }, { "database": "PubMed", "id": "17292432", "url": "https://pubmed.ncbi.nlm.nih.gov/17292432" }, { "database": "PubMed", "id": "17297446", "url": "https://pubmed.ncbi.nlm.nih.gov/17297446" }, { "database": "PubMed", "id": "17301063", "url": "https://pubmed.ncbi.nlm.nih.gov/17301063" }, { "database": "PubMed", "id": "17332930", "url": "https://pubmed.ncbi.nlm.nih.gov/17332930" }, { "database": "PubMed", "id": "17334779", "url": "https://pubmed.ncbi.nlm.nih.gov/17334779" }, { "database": "PubMed", "id": "17456577", "url": "https://pubmed.ncbi.nlm.nih.gov/17456577" }, { "database": "PubMed", "id": "17509529", "url": "https://pubmed.ncbi.nlm.nih.gov/17509529" }, { "database": "PubMed", "id": "17510082", "url": "https://pubmed.ncbi.nlm.nih.gov/17510082" }, { "database": "PubMed", "id": "17511890", "url": "https://pubmed.ncbi.nlm.nih.gov/17511890" }, { "database": "PubMed", "id": "17512204", "url": "https://pubmed.ncbi.nlm.nih.gov/17512204" }, { "database": "PubMed", "id": "17517898", "url": "https://pubmed.ncbi.nlm.nih.gov/17517898" }, { "database": "PubMed", "id": "17524349", "url": "https://pubmed.ncbi.nlm.nih.gov/17524349" }, { "database": "PubMed", "id": "17535811", "url": "https://pubmed.ncbi.nlm.nih.gov/17535811" }, { "database": "PubMed", "id": "17575952", "url": "https://pubmed.ncbi.nlm.nih.gov/17575952" }, { "database": "PubMed", "id": "17582679", "url": "https://pubmed.ncbi.nlm.nih.gov/17582679" }, { "database": "PubMed", "id": "17596534", "url": "https://pubmed.ncbi.nlm.nih.gov/17596534" }, { "database": "PubMed", "id": "17610031", "url": "https://pubmed.ncbi.nlm.nih.gov/17610031" }, { "database": "PubMed", "id": "17612589", "url": "https://pubmed.ncbi.nlm.nih.gov/17612589" }, { "database": "PubMed", "id": "17616578", "url": "https://pubmed.ncbi.nlm.nih.gov/17616578" }, { "database": "PubMed", "id": "17668048", "url": "https://pubmed.ncbi.nlm.nih.gov/17668048" }, { "database": "PubMed", "id": "17707793", "url": "https://pubmed.ncbi.nlm.nih.gov/17707793" }, { "database": "PubMed", "id": "17712528", "url": "https://pubmed.ncbi.nlm.nih.gov/17712528" }, { "database": "PubMed", "id": "17727682", "url": "https://pubmed.ncbi.nlm.nih.gov/17727682" }, { "database": "PubMed", "id": "17803907", "url": "https://pubmed.ncbi.nlm.nih.gov/17803907" }, { "database": "PubMed", "id": "17854787", "url": "https://pubmed.ncbi.nlm.nih.gov/17854787" }, { "database": "PubMed", "id": "17855337", "url": "https://pubmed.ncbi.nlm.nih.gov/17855337" }, { "database": "PubMed", "id": "17894897", "url": "https://pubmed.ncbi.nlm.nih.gov/17894897" }, { "database": "PubMed", "id": "17903248", "url": "https://pubmed.ncbi.nlm.nih.gov/17903248" }, { "database": "PubMed", "id": "17918180", "url": "https://pubmed.ncbi.nlm.nih.gov/17918180" }, { "database": "PubMed", "id": "17919456", "url": "https://pubmed.ncbi.nlm.nih.gov/17919456" }, { "database": "PubMed", "id": "17932621", "url": "https://pubmed.ncbi.nlm.nih.gov/17932621" }, { "database": "PubMed", "id": "17932951", "url": "https://pubmed.ncbi.nlm.nih.gov/17932951" }, { "database": "PubMed", "id": "17940507", "url": "https://pubmed.ncbi.nlm.nih.gov/17940507" }, { "database": "PubMed", "id": "17967874", "url": "https://pubmed.ncbi.nlm.nih.gov/17967874" }, { "database": "PubMed", "id": "17971768", "url": "https://pubmed.ncbi.nlm.nih.gov/17971768" }, { "database": "PubMed", "id": "17977830", "url": "https://pubmed.ncbi.nlm.nih.gov/17977830" }, { "database": "PubMed", "id": "18032786", "url": "https://pubmed.ncbi.nlm.nih.gov/18032786" }, { "database": "PubMed", "id": "18048073", "url": "https://pubmed.ncbi.nlm.nih.gov/18048073" }, { "database": "PubMed", "id": "18082226", "url": "https://pubmed.ncbi.nlm.nih.gov/18082226" }, { "database": "PubMed", "id": "18085531", "url": "https://pubmed.ncbi.nlm.nih.gov/18085531" }, { "database": "PubMed", "id": "18187512", "url": "https://pubmed.ncbi.nlm.nih.gov/18187512" }, { "database": "PubMed", "id": "18191923", "url": "https://pubmed.ncbi.nlm.nih.gov/18191923" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18272544", "url": "https://pubmed.ncbi.nlm.nih.gov/18272544" }, { "database": "PubMed", "id": "18289623", "url": "https://pubmed.ncbi.nlm.nih.gov/18289623" }, { "database": "PubMed", "id": "18294283", "url": "https://pubmed.ncbi.nlm.nih.gov/18294283" }, { "database": "PubMed", "id": "18311036", "url": "https://pubmed.ncbi.nlm.nih.gov/18311036" }, { "database": "PubMed", "id": "18339864", "url": "https://pubmed.ncbi.nlm.nih.gov/18339864" }, { "database": "PubMed", "id": "18344606", "url": "https://pubmed.ncbi.nlm.nih.gov/18344606" }, { "database": "PubMed", "id": "18348731", "url": "https://pubmed.ncbi.nlm.nih.gov/18348731" }, { "database": "PubMed", "id": "18366759", "url": "https://pubmed.ncbi.nlm.nih.gov/18366759" }, { "database": "PubMed", "id": "18381438", "url": "https://pubmed.ncbi.nlm.nih.gov/18381438" }, { "database": "PubMed", "id": "18406507", "url": "https://pubmed.ncbi.nlm.nih.gov/18406507" }, { "database": "PubMed", "id": "18440733", "url": "https://pubmed.ncbi.nlm.nih.gov/18440733" }, { "database": "PubMed", "id": "18446786", "url": "https://pubmed.ncbi.nlm.nih.gov/18446786" }, { "database": "PubMed", "id": "18455128", "url": "https://pubmed.ncbi.nlm.nih.gov/18455128" }, { "database": "PubMed", "id": "18479896", "url": "https://pubmed.ncbi.nlm.nih.gov/18479896" }, { "database": "PubMed", "id": "18497347", "url": "https://pubmed.ncbi.nlm.nih.gov/18497347" }, { "database": "PubMed", "id": "18504176", "url": "https://pubmed.ncbi.nlm.nih.gov/18504176" }, { "database": "PubMed", "id": "18511169", "url": "https://pubmed.ncbi.nlm.nih.gov/18511169" }, { "database": "PubMed", "id": "18519674", "url": "https://pubmed.ncbi.nlm.nih.gov/18519674" }, { "database": "PubMed", "id": "18523653", "url": "https://pubmed.ncbi.nlm.nih.gov/18523653" }, { "database": "PubMed", "id": "18540044", "url": "https://pubmed.ncbi.nlm.nih.gov/18540044" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18585854", "url": "https://pubmed.ncbi.nlm.nih.gov/18585854" }, { "database": "PubMed", "id": "18589416", "url": "https://pubmed.ncbi.nlm.nih.gov/18589416" }, { "database": "PubMed", "id": "18596987", "url": "https://pubmed.ncbi.nlm.nih.gov/18596987" }, { "database": "PubMed", "id": "18604166", "url": "https://pubmed.ncbi.nlm.nih.gov/18604166" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18642443", "url": "https://pubmed.ncbi.nlm.nih.gov/18642443" }, { "database": "PubMed", "id": "18660513", "url": "https://pubmed.ncbi.nlm.nih.gov/18660513" }, { "database": "PubMed", "id": "18661100", "url": "https://pubmed.ncbi.nlm.nih.gov/18661100" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "18760266", "url": "https://pubmed.ncbi.nlm.nih.gov/18760266" }, { "database": "PubMed", "id": "18778462", "url": "https://pubmed.ncbi.nlm.nih.gov/18778462" }, { "database": "PubMed", "id": "18785202", "url": "https://pubmed.ncbi.nlm.nih.gov/18785202" }, { "database": "PubMed", "id": "18791269", "url": "https://pubmed.ncbi.nlm.nih.gov/18791269" }, { "database": "PubMed", "id": "18802408", "url": "https://pubmed.ncbi.nlm.nih.gov/18802408" }, { "database": "PubMed", "id": "18847491", "url": "https://pubmed.ncbi.nlm.nih.gov/18847491" }, { "database": "PubMed", "id": "18852884", "url": "https://pubmed.ncbi.nlm.nih.gov/18852884" }, { "database": "PubMed", "id": "18947885", "url": "https://pubmed.ncbi.nlm.nih.gov/18947885" }, { "database": "PubMed", "id": "19064630", "url": "https://pubmed.ncbi.nlm.nih.gov/19064630" }, { "database": "PubMed", "id": "19067706", "url": "https://pubmed.ncbi.nlm.nih.gov/19067706" }, { "database": "PubMed", "id": "19095450", "url": "https://pubmed.ncbi.nlm.nih.gov/19095450" }, { "database": "PubMed", "id": "19112505", "url": "https://pubmed.ncbi.nlm.nih.gov/19112505" }, { "database": "PubMed", "id": "19139065", "url": "https://pubmed.ncbi.nlm.nih.gov/19139065" }, { "database": "PubMed", "id": "19148495", "url": "https://pubmed.ncbi.nlm.nih.gov/19148495" }, { "database": "PubMed", "id": "19148510", "url": "https://pubmed.ncbi.nlm.nih.gov/19148510" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19166313", "url": "https://pubmed.ncbi.nlm.nih.gov/19166313" }, { "database": "PubMed", "id": "19221002", "url": "https://pubmed.ncbi.nlm.nih.gov/19221002" }, { "database": "PubMed", "id": "19225536", "url": "https://pubmed.ncbi.nlm.nih.gov/19225536" }, { "database": "PubMed", "id": "19295133", "url": "https://pubmed.ncbi.nlm.nih.gov/19295133" }, { "database": "PubMed", "id": "19303885", "url": "https://pubmed.ncbi.nlm.nih.gov/19303885" }, { "database": "PubMed", "id": "19357962", "url": "https://pubmed.ncbi.nlm.nih.gov/19357962" }, { "database": "PubMed", "id": "19363523", "url": "https://pubmed.ncbi.nlm.nih.gov/19363523" }, { "database": "PubMed", "id": "19373864", "url": "https://pubmed.ncbi.nlm.nih.gov/19373864" }, { "database": "PubMed", "id": "19397953", "url": "https://pubmed.ncbi.nlm.nih.gov/19397953" }, { "database": "PubMed", "id": "19398950", "url": "https://pubmed.ncbi.nlm.nih.gov/19398950" }, { "database": "PubMed", "id": "19426797", "url": "https://pubmed.ncbi.nlm.nih.gov/19426797" }, { "database": "PubMed", "id": "19454177", "url": "https://pubmed.ncbi.nlm.nih.gov/19454177" }, { "database": "PubMed", "id": "19459175", "url": "https://pubmed.ncbi.nlm.nih.gov/19459175" }, { "database": "PubMed", "id": "19525231", "url": "https://pubmed.ncbi.nlm.nih.gov/19525231" }, { "database": "PubMed", "id": "19536869", "url": "https://pubmed.ncbi.nlm.nih.gov/19536869" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19648965", "url": "https://pubmed.ncbi.nlm.nih.gov/19648965" }, { "database": "PubMed", "id": "19649319", "url": "https://pubmed.ncbi.nlm.nih.gov/19649319" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19660097", "url": "https://pubmed.ncbi.nlm.nih.gov/19660097" }, { "database": "PubMed", "id": "19674456", "url": "https://pubmed.ncbi.nlm.nih.gov/19674456" }, { "database": "PubMed", "id": "19705844", "url": "https://pubmed.ncbi.nlm.nih.gov/19705844" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19821510", "url": "https://pubmed.ncbi.nlm.nih.gov/19821510" }, { "database": "PubMed", "id": "19882354", "url": "https://pubmed.ncbi.nlm.nih.gov/19882354" }, { "database": "PubMed", "id": "19934315", "url": "https://pubmed.ncbi.nlm.nih.gov/19934315" }, { "database": "PubMed", "id": "19952118", "url": "https://pubmed.ncbi.nlm.nih.gov/19952118" }, { "database": "PubMed", "id": "19960411", "url": "https://pubmed.ncbi.nlm.nih.gov/19960411" }, { "database": "PubMed", "id": "20005456", "url": "https://pubmed.ncbi.nlm.nih.gov/20005456" }, { "database": "PubMed", "id": "20005840", "url": "https://pubmed.ncbi.nlm.nih.gov/20005840" }, { "database": "PubMed", "id": "20016737", "url": "https://pubmed.ncbi.nlm.nih.gov/20016737" }, { "database": "PubMed", "id": "20024960", "url": "https://pubmed.ncbi.nlm.nih.gov/20024960" }, { "database": "PubMed", "id": "20060030", "url": "https://pubmed.ncbi.nlm.nih.gov/20060030" }, { "database": "PubMed", "id": "20085646", "url": "https://pubmed.ncbi.nlm.nih.gov/20085646" }, { "database": "PubMed", "id": "20092938", "url": "https://pubmed.ncbi.nlm.nih.gov/20092938" }, { "database": "PubMed", "id": "20097305", "url": "https://pubmed.ncbi.nlm.nih.gov/20097305" }, { "database": "PubMed", "id": "20123963", "url": "https://pubmed.ncbi.nlm.nih.gov/20123963" }, { "database": "PubMed", "id": "20187950", "url": "https://pubmed.ncbi.nlm.nih.gov/20187950" }, { "database": "PubMed", "id": "20219657", "url": "https://pubmed.ncbi.nlm.nih.gov/20219657" }, { "database": "PubMed", "id": "20226587", "url": "https://pubmed.ncbi.nlm.nih.gov/20226587" }, { "database": "PubMed", "id": "20308316", "url": "https://pubmed.ncbi.nlm.nih.gov/20308316" }, { "database": "PubMed", "id": "20353948", "url": "https://pubmed.ncbi.nlm.nih.gov/20353948" }, { "database": "PubMed", "id": "20354524", "url": "https://pubmed.ncbi.nlm.nih.gov/20354524" }, { "database": "PubMed", "id": "20413215", "url": "https://pubmed.ncbi.nlm.nih.gov/20413215" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20432447", "url": "https://pubmed.ncbi.nlm.nih.gov/20432447" }, { "database": "PubMed", "id": "20456495", "url": "https://pubmed.ncbi.nlm.nih.gov/20456495" }, { "database": "PubMed", "id": "20484174", "url": "https://pubmed.ncbi.nlm.nih.gov/20484174" }, { "database": "PubMed", "id": "20499882", "url": "https://pubmed.ncbi.nlm.nih.gov/20499882" }, { "database": "PubMed", "id": "20540768", "url": "https://pubmed.ncbi.nlm.nih.gov/20540768" }, { "database": "PubMed", "id": "20543986", "url": "https://pubmed.ncbi.nlm.nih.gov/20543986" }, { "database": "PubMed", "id": "20549306", "url": "https://pubmed.ncbi.nlm.nih.gov/20549306" }, { "database": "PubMed", "id": "20566882", "url": "https://pubmed.ncbi.nlm.nih.gov/20566882" }, { "database": "PubMed", "id": "20622265", "url": "https://pubmed.ncbi.nlm.nih.gov/20622265" }, { "database": "PubMed", "id": "20663147", "url": "https://pubmed.ncbi.nlm.nih.gov/20663147" }, { "database": "PubMed", "id": "20693977", "url": "https://pubmed.ncbi.nlm.nih.gov/20693977" }, { "database": "PubMed", "id": "20708607", "url": "https://pubmed.ncbi.nlm.nih.gov/20708607" }, { "database": "PubMed", "id": "20717878", "url": "https://pubmed.ncbi.nlm.nih.gov/20717878" }, { "database": "PubMed", "id": "20809980", "url": "https://pubmed.ncbi.nlm.nih.gov/20809980" }, { "database": "PubMed", "id": "20840867", "url": "https://pubmed.ncbi.nlm.nih.gov/20840867" }, { "database": "PubMed", "id": "20886098", "url": "https://pubmed.ncbi.nlm.nih.gov/20886098" }, { "database": "PubMed", "id": "20931131", "url": "https://pubmed.ncbi.nlm.nih.gov/20931131" }, { "database": "PubMed", "id": "20948430", "url": "https://pubmed.ncbi.nlm.nih.gov/20948430" }, { "database": "PubMed", "id": "20974518", "url": "https://pubmed.ncbi.nlm.nih.gov/20974518" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "21045015", "url": "https://pubmed.ncbi.nlm.nih.gov/21045015" }, { "database": "PubMed", "id": "21078665", "url": "https://pubmed.ncbi.nlm.nih.gov/21078665" }, { "database": "PubMed", "id": "21114963", "url": "https://pubmed.ncbi.nlm.nih.gov/21114963" }, { "database": "PubMed", "id": "21118815", "url": "https://pubmed.ncbi.nlm.nih.gov/21118815" }, { "database": "PubMed", "id": "21163364", "url": "https://pubmed.ncbi.nlm.nih.gov/21163364" }, { "database": "PubMed", "id": "21167122", "url": "https://pubmed.ncbi.nlm.nih.gov/21167122" }, { "database": "PubMed", "id": "21225623", "url": "https://pubmed.ncbi.nlm.nih.gov/21225623" }, { "database": "PubMed", "id": "21261644", "url": "https://pubmed.ncbi.nlm.nih.gov/21261644" }, { "database": "PubMed", "id": "21317459", "url": "https://pubmed.ncbi.nlm.nih.gov/21317459" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21361779", "url": "https://pubmed.ncbi.nlm.nih.gov/21361779" }, { "database": "PubMed", "id": "21368894", "url": "https://pubmed.ncbi.nlm.nih.gov/21368894" }, { "database": "PubMed", "id": "21376392", "url": "https://pubmed.ncbi.nlm.nih.gov/21376392" }, { "database": "PubMed", "id": "21383020", "url": "https://pubmed.ncbi.nlm.nih.gov/21383020" }, { "database": "PubMed", "id": "21383696", "url": "https://pubmed.ncbi.nlm.nih.gov/21383696" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21394211", "url": "https://pubmed.ncbi.nlm.nih.gov/21394211" }, { "database": "PubMed", "id": "21432907", "url": "https://pubmed.ncbi.nlm.nih.gov/21432907" }, { "database": "PubMed", "id": "21451571", "url": "https://pubmed.ncbi.nlm.nih.gov/21451571" }, { "database": "PubMed", "id": "21465263", "url": "https://pubmed.ncbi.nlm.nih.gov/21465263" }, { "database": "PubMed", "id": "21499441", "url": "https://pubmed.ncbi.nlm.nih.gov/21499441" }, { "database": "PubMed", "id": "21532991", "url": "https://pubmed.ncbi.nlm.nih.gov/21532991" }, { "database": "PubMed", "id": "21549095", "url": "https://pubmed.ncbi.nlm.nih.gov/21549095" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21576488", "url": "https://pubmed.ncbi.nlm.nih.gov/21576488" }, { "database": "PubMed", "id": "21593792", "url": "https://pubmed.ncbi.nlm.nih.gov/21593792" }, { "database": "PubMed", "id": "21631964", "url": "https://pubmed.ncbi.nlm.nih.gov/21631964" }, { "database": "PubMed", "id": "21653549", "url": "https://pubmed.ncbi.nlm.nih.gov/21653549" }, { "database": "PubMed", "id": "21663643", "url": "https://pubmed.ncbi.nlm.nih.gov/21663643" }, { "database": "PubMed", "id": "21687937", "url": "https://pubmed.ncbi.nlm.nih.gov/21687937" }, { "database": "PubMed", "id": "21725357", "url": "https://pubmed.ncbi.nlm.nih.gov/21725357" }, { "database": "PubMed", "id": "21783897", "url": "https://pubmed.ncbi.nlm.nih.gov/21783897" }, { "database": "PubMed", "id": "21797208", "url": "https://pubmed.ncbi.nlm.nih.gov/21797208" }, { "database": "PubMed", "id": "21809388", "url": "https://pubmed.ncbi.nlm.nih.gov/21809388" }, { "database": "PubMed", "id": "21840268", "url": "https://pubmed.ncbi.nlm.nih.gov/21840268" }, { "database": "PubMed", "id": "21857991", "url": "https://pubmed.ncbi.nlm.nih.gov/21857991" }, { "database": "PubMed", "id": "21866568", "url": "https://pubmed.ncbi.nlm.nih.gov/21866568" }, { "database": "PubMed", "id": "21887275", "url": "https://pubmed.ncbi.nlm.nih.gov/21887275" }, { "database": "PubMed", "id": "21909130", "url": "https://pubmed.ncbi.nlm.nih.gov/21909130" }, { "database": "PubMed", "id": "21918620", "url": "https://pubmed.ncbi.nlm.nih.gov/21918620" }, { "database": "PubMed", "id": "21945951", "url": "https://pubmed.ncbi.nlm.nih.gov/21945951" }, { "database": "PubMed", "id": "21960246", "url": "https://pubmed.ncbi.nlm.nih.gov/21960246" }, { "database": "PubMed", "id": "21965754", "url": "https://pubmed.ncbi.nlm.nih.gov/21965754" }, { "database": "PubMed", "id": "21983885", "url": "https://pubmed.ncbi.nlm.nih.gov/21983885" }, { "database": "PubMed", "id": "21997969", "url": "https://pubmed.ncbi.nlm.nih.gov/21997969" }, { "database": "PubMed", "id": "22002314", "url": "https://pubmed.ncbi.nlm.nih.gov/22002314" }, { "database": "PubMed", "id": "22030623", "url": "https://pubmed.ncbi.nlm.nih.gov/22030623" }, { "database": "PubMed", "id": "22114676", "url": "https://pubmed.ncbi.nlm.nih.gov/22114676" }, { "database": "PubMed", "id": "22142405", "url": "https://pubmed.ncbi.nlm.nih.gov/22142405" }, { "database": "PubMed", "id": "22174788", "url": "https://pubmed.ncbi.nlm.nih.gov/22174788" }, { "database": "PubMed", "id": "22190353", "url": "https://pubmed.ncbi.nlm.nih.gov/22190353" }, { "database": "PubMed", "id": "22198295", "url": "https://pubmed.ncbi.nlm.nih.gov/22198295" }, { "database": "PubMed", "id": "22266868", "url": "https://pubmed.ncbi.nlm.nih.gov/22266868" }, { "database": "PubMed", "id": "22288499", "url": "https://pubmed.ncbi.nlm.nih.gov/22288499" }, { "database": "PubMed", "id": "22290291", "url": "https://pubmed.ncbi.nlm.nih.gov/22290291" }, { "database": "PubMed", "id": "22312557", "url": "https://pubmed.ncbi.nlm.nih.gov/22312557" }, { "database": "PubMed", "id": "22331558", "url": "https://pubmed.ncbi.nlm.nih.gov/22331558" }, { "database": "PubMed", "id": "22414726", "url": "https://pubmed.ncbi.nlm.nih.gov/22414726" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22435726", "url": "https://pubmed.ncbi.nlm.nih.gov/22435726" }, { "database": "PubMed", "id": "22447336", "url": "https://pubmed.ncbi.nlm.nih.gov/22447336" }, { "database": "PubMed", "id": "22514710", "url": "https://pubmed.ncbi.nlm.nih.gov/22514710" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22555805", "url": "https://pubmed.ncbi.nlm.nih.gov/22555805" }, { "database": "PubMed", "id": "22564437", "url": "https://pubmed.ncbi.nlm.nih.gov/22564437" }, { "database": "PubMed", "id": "22574148", "url": "https://pubmed.ncbi.nlm.nih.gov/22574148" }, { "database": "PubMed", "id": "22615843", "url": "https://pubmed.ncbi.nlm.nih.gov/22615843" }, { "database": "PubMed", "id": "22622028", "url": "https://pubmed.ncbi.nlm.nih.gov/22622028" }, { "database": "PubMed", "id": "22627294", "url": "https://pubmed.ncbi.nlm.nih.gov/22627294" }, { "database": "PubMed", "id": "22642109", "url": "https://pubmed.ncbi.nlm.nih.gov/22642109" }, { "database": "PubMed", "id": "22662266", "url": "https://pubmed.ncbi.nlm.nih.gov/22662266" }, { "database": "PubMed", "id": "22722496", "url": "https://pubmed.ncbi.nlm.nih.gov/22722496" }, { "database": "PubMed", "id": "22767080", "url": "https://pubmed.ncbi.nlm.nih.gov/22767080" }, { "database": "PubMed", "id": "22768036", "url": "https://pubmed.ncbi.nlm.nih.gov/22768036" }, { "database": "PubMed", "id": "22797063", "url": "https://pubmed.ncbi.nlm.nih.gov/22797063" }, { "database": "PubMed", "id": "22807682", "url": "https://pubmed.ncbi.nlm.nih.gov/22807682" }, { "database": "PubMed", "id": "22815158", "url": "https://pubmed.ncbi.nlm.nih.gov/22815158" }, { "database": "PubMed", "id": "22848370", "url": "https://pubmed.ncbi.nlm.nih.gov/22848370" }, { "database": "PubMed", "id": "22859938", "url": "https://pubmed.ncbi.nlm.nih.gov/22859938" }, { "database": "PubMed", "id": "22888789", "url": "https://pubmed.ncbi.nlm.nih.gov/22888789" }, { "database": "PubMed", "id": "22911714", "url": "https://pubmed.ncbi.nlm.nih.gov/22911714" }, { "database": "PubMed", "id": "22947118", "url": "https://pubmed.ncbi.nlm.nih.gov/22947118" }, { "database": "PubMed", "id": "22954457", "url": "https://pubmed.ncbi.nlm.nih.gov/22954457" }, { "database": "PubMed", "id": "22962590", "url": "https://pubmed.ncbi.nlm.nih.gov/22962590" }, { "database": "PubMed", "id": "22983795", "url": "https://pubmed.ncbi.nlm.nih.gov/22983795" }, { "database": "PubMed", "id": "22996738", "url": "https://pubmed.ncbi.nlm.nih.gov/22996738" }, { "database": "PubMed", "id": "23027622", "url": "https://pubmed.ncbi.nlm.nih.gov/23027622" }, { "database": "PubMed", "id": "23028738", "url": "https://pubmed.ncbi.nlm.nih.gov/23028738" }, { "database": "PubMed", "id": "23034333", "url": "https://pubmed.ncbi.nlm.nih.gov/23034333" }, { "database": "PubMed", "id": "23050037", "url": "https://pubmed.ncbi.nlm.nih.gov/23050037" }, { "database": "PubMed", "id": "23091651", "url": "https://pubmed.ncbi.nlm.nih.gov/23091651" }, { "database": "PubMed", "id": "23108402", "url": "https://pubmed.ncbi.nlm.nih.gov/23108402" }, { "database": "PubMed", "id": "23124353", "url": "https://pubmed.ncbi.nlm.nih.gov/23124353" }, { "database": "PubMed", "id": "23128467", "url": "https://pubmed.ncbi.nlm.nih.gov/23128467" }, { "database": "PubMed", "id": "23139272", "url": "https://pubmed.ncbi.nlm.nih.gov/23139272" }, { "database": "PubMed", "id": "23194110", "url": "https://pubmed.ncbi.nlm.nih.gov/23194110" }, { "database": "PubMed", "id": "23238993", "url": "https://pubmed.ncbi.nlm.nih.gov/23238993" }, { "database": "PubMed", "id": "23263852", "url": "https://pubmed.ncbi.nlm.nih.gov/23263852" }, { "database": "PubMed", "id": "23300887", "url": "https://pubmed.ncbi.nlm.nih.gov/23300887" }, { "database": "PubMed", "id": "23318437", "url": "https://pubmed.ncbi.nlm.nih.gov/23318437" }, { "database": "PubMed", "id": "23319600", "url": "https://pubmed.ncbi.nlm.nih.gov/23319600" }, { "database": "PubMed", "id": "23340843", "url": "https://pubmed.ncbi.nlm.nih.gov/23340843" }, { "database": "PubMed", "id": "23342042", "url": "https://pubmed.ncbi.nlm.nih.gov/23342042" }, { "database": "PubMed", "id": "23351152", "url": "https://pubmed.ncbi.nlm.nih.gov/23351152" }, { "database": "PubMed", "id": "23359208", "url": "https://pubmed.ncbi.nlm.nih.gov/23359208" }, { "database": "PubMed", "id": "23425510", "url": "https://pubmed.ncbi.nlm.nih.gov/23425510" }, { "database": "PubMed", "id": "23434831", "url": "https://pubmed.ncbi.nlm.nih.gov/23434831" }, { "database": "PubMed", "id": "23451179", "url": "https://pubmed.ncbi.nlm.nih.gov/23451179" }, { "database": "PubMed", "id": "23483203", "url": "https://pubmed.ncbi.nlm.nih.gov/23483203" }, { "database": "PubMed", "id": "23495037", "url": "https://pubmed.ncbi.nlm.nih.gov/23495037" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23555634", "url": "https://pubmed.ncbi.nlm.nih.gov/23555634" }, { "database": "PubMed", "id": "23555949", "url": "https://pubmed.ncbi.nlm.nih.gov/23555949" }, { "database": "PubMed", "id": "23557329", "url": "https://pubmed.ncbi.nlm.nih.gov/23557329" }, { "database": "PubMed", "id": "23566959", "url": "https://pubmed.ncbi.nlm.nih.gov/23566959" }, { "database": "PubMed", "id": "23589839", "url": "https://pubmed.ncbi.nlm.nih.gov/23589839" }, { "database": "PubMed", "id": "23599430", "url": "https://pubmed.ncbi.nlm.nih.gov/23599430" }, { "database": "PubMed", "id": "23610071", "url": "https://pubmed.ncbi.nlm.nih.gov/23610071" }, { "database": "PubMed", "id": "23612976", "url": "https://pubmed.ncbi.nlm.nih.gov/23612976" }, { "database": "PubMed", "id": "23618908", "url": "https://pubmed.ncbi.nlm.nih.gov/23618908" }, { "database": "PubMed", "id": "23640457", "url": "https://pubmed.ncbi.nlm.nih.gov/23640457" }, { "database": "PubMed", "id": "23646139", "url": "https://pubmed.ncbi.nlm.nih.gov/23646139" }, { "database": "PubMed", "id": "23652278", "url": "https://pubmed.ncbi.nlm.nih.gov/23652278" }, { "database": "PubMed", "id": "23662114", "url": "https://pubmed.ncbi.nlm.nih.gov/23662114" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23666755", "url": "https://pubmed.ncbi.nlm.nih.gov/23666755" }, { "database": "PubMed", "id": "23676219", "url": "https://pubmed.ncbi.nlm.nih.gov/23676219" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23737838", "url": "https://pubmed.ncbi.nlm.nih.gov/23737838" }, { "database": "PubMed", "id": "23741479", "url": "https://pubmed.ncbi.nlm.nih.gov/23741479" }, { "database": "PubMed", "id": "23759592", "url": "https://pubmed.ncbi.nlm.nih.gov/23759592" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23800953", "url": "https://pubmed.ncbi.nlm.nih.gov/23800953" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23852422", "url": "https://pubmed.ncbi.nlm.nih.gov/23852422" }, { "database": "PubMed", "id": "23874235", "url": "https://pubmed.ncbi.nlm.nih.gov/23874235" }, { "database": "PubMed", "id": "23883471", "url": "https://pubmed.ncbi.nlm.nih.gov/23883471" }, { "database": "PubMed", "id": "23887628", "url": "https://pubmed.ncbi.nlm.nih.gov/23887628" }, { "database": "PubMed", "id": "23915323", "url": "https://pubmed.ncbi.nlm.nih.gov/23915323" }, { "database": "PubMed", "id": "23949216", "url": "https://pubmed.ncbi.nlm.nih.gov/23949216" }, { "database": "PubMed", "id": "24019961", "url": "https://pubmed.ncbi.nlm.nih.gov/24019961" }, { "database": "PubMed", "id": "24024154", "url": "https://pubmed.ncbi.nlm.nih.gov/24024154" }, { "database": "PubMed", "id": "24037342", "url": "https://pubmed.ncbi.nlm.nih.gov/24037342" }, { "database": "PubMed", "id": "24040083", "url": "https://pubmed.ncbi.nlm.nih.gov/24040083" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24086708", "url": "https://pubmed.ncbi.nlm.nih.gov/24086708" }, { "database": "PubMed", "id": "24089038", "url": "https://pubmed.ncbi.nlm.nih.gov/24089038" }, { "database": "PubMed", "id": "24096875", "url": "https://pubmed.ncbi.nlm.nih.gov/24096875" }, { "database": "PubMed", "id": "24129246", "url": "https://pubmed.ncbi.nlm.nih.gov/24129246" }, { "database": "PubMed", "id": "24156017", "url": "https://pubmed.ncbi.nlm.nih.gov/24156017" }, { "database": "PubMed", "id": "24157877", "url": "https://pubmed.ncbi.nlm.nih.gov/24157877" }, { "database": "PubMed", "id": "24194914", "url": "https://pubmed.ncbi.nlm.nih.gov/24194914" }, { "database": "PubMed", "id": "24194938", "url": "https://pubmed.ncbi.nlm.nih.gov/24194938" }, { "database": "PubMed", "id": "24205157", "url": "https://pubmed.ncbi.nlm.nih.gov/24205157" }, { "database": "PubMed", "id": "24223226", "url": "https://pubmed.ncbi.nlm.nih.gov/24223226" }, { "database": "PubMed", "id": "24244715", "url": "https://pubmed.ncbi.nlm.nih.gov/24244715" }, { "database": "PubMed", "id": "24248600", "url": "https://pubmed.ncbi.nlm.nih.gov/24248600" }, { "database": "PubMed", "id": "24264057", "url": "https://pubmed.ncbi.nlm.nih.gov/24264057" }, { "database": "PubMed", "id": "24283650", "url": "https://pubmed.ncbi.nlm.nih.gov/24283650" }, { "database": "PubMed", "id": "24313628", "url": "https://pubmed.ncbi.nlm.nih.gov/24313628" }, { "database": "PubMed", "id": "24376853", "url": "https://pubmed.ncbi.nlm.nih.gov/24376853" }, { "database": "PubMed", "id": "24379680", "url": "https://pubmed.ncbi.nlm.nih.gov/24379680" }, { "database": "PubMed", "id": "24380814", "url": "https://pubmed.ncbi.nlm.nih.gov/24380814" }, { "database": "PubMed", "id": "24391984", "url": "https://pubmed.ncbi.nlm.nih.gov/24391984" }, { "database": "PubMed", "id": "24403123", "url": "https://pubmed.ncbi.nlm.nih.gov/24403123" }, { "database": "PubMed", "id": "24413150", "url": "https://pubmed.ncbi.nlm.nih.gov/24413150" }, { "database": "PubMed", "id": "24445528", "url": "https://pubmed.ncbi.nlm.nih.gov/24445528" }, { "database": "PubMed", "id": "24447148", "url": "https://pubmed.ncbi.nlm.nih.gov/24447148" }, { "database": "PubMed", "id": "24456610", "url": "https://pubmed.ncbi.nlm.nih.gov/24456610" }, { "database": "PubMed", "id": "24465691", "url": "https://pubmed.ncbi.nlm.nih.gov/24465691" }, { "database": "PubMed", "id": "24480460", "url": "https://pubmed.ncbi.nlm.nih.gov/24480460" }, { "database": "PubMed", "id": "24553354", "url": "https://pubmed.ncbi.nlm.nih.gov/24553354" }, { "database": "PubMed", "id": "24555657", "url": "https://pubmed.ncbi.nlm.nih.gov/24555657" }, { "database": "PubMed", "id": "24556689", "url": "https://pubmed.ncbi.nlm.nih.gov/24556689" }, { "database": "PubMed", "id": "24587255", "url": "https://pubmed.ncbi.nlm.nih.gov/24587255" }, { "database": "PubMed", "id": "24603648", "url": "https://pubmed.ncbi.nlm.nih.gov/24603648" }, { "database": "PubMed", "id": "24608431", "url": "https://pubmed.ncbi.nlm.nih.gov/24608431" }, { "database": "PubMed", "id": "24613410", "url": "https://pubmed.ncbi.nlm.nih.gov/24613410" }, { "database": "PubMed", "id": "24619359", "url": "https://pubmed.ncbi.nlm.nih.gov/24619359" }, { "database": "PubMed", "id": "24657168", "url": "https://pubmed.ncbi.nlm.nih.gov/24657168" }, { "database": "PubMed", "id": "24682933", "url": "https://pubmed.ncbi.nlm.nih.gov/24682933" }, { "database": "PubMed", "id": "24691657", "url": "https://pubmed.ncbi.nlm.nih.gov/24691657" }, { "database": "PubMed", "id": "24717393", "url": "https://pubmed.ncbi.nlm.nih.gov/24717393" }, { "database": "PubMed", "id": "24722580", "url": "https://pubmed.ncbi.nlm.nih.gov/24722580" }, { "database": "PubMed", "id": "24759730", "url": "https://pubmed.ncbi.nlm.nih.gov/24759730" }, { "database": "PubMed", "id": "24796485", "url": "https://pubmed.ncbi.nlm.nih.gov/24796485" }, { "database": "PubMed", "id": "24797517", "url": "https://pubmed.ncbi.nlm.nih.gov/24797517" }, { "database": "PubMed", "id": "24801380", "url": "https://pubmed.ncbi.nlm.nih.gov/24801380" }, { "database": "PubMed", "id": "24810057", "url": "https://pubmed.ncbi.nlm.nih.gov/24810057" }, { "database": "PubMed", "id": "24831807", "url": "https://pubmed.ncbi.nlm.nih.gov/24831807" }, { "database": "PubMed", "id": "24867336", "url": "https://pubmed.ncbi.nlm.nih.gov/24867336" }, { "database": "PubMed", "id": "24885082", "url": "https://pubmed.ncbi.nlm.nih.gov/24885082" }, { "database": "PubMed", "id": "24886358", "url": "https://pubmed.ncbi.nlm.nih.gov/24886358" }, { "database": "PubMed", "id": "24905183", "url": "https://pubmed.ncbi.nlm.nih.gov/24905183" }, { "database": "PubMed", "id": "24926985", "url": "https://pubmed.ncbi.nlm.nih.gov/24926985" }, { "database": "PubMed", "id": "24928858", "url": "https://pubmed.ncbi.nlm.nih.gov/24928858" }, { "database": "PubMed", "id": "24932684", "url": "https://pubmed.ncbi.nlm.nih.gov/24932684" }, { "database": "PubMed", "id": "24934860", "url": "https://pubmed.ncbi.nlm.nih.gov/24934860" }, { "database": "PubMed", "id": "24956278", "url": "https://pubmed.ncbi.nlm.nih.gov/24956278" }, { "database": "PubMed", "id": "24962518", "url": "https://pubmed.ncbi.nlm.nih.gov/24962518" }, { "database": "PubMed", "id": "24971451", "url": "https://pubmed.ncbi.nlm.nih.gov/24971451" }, { "database": "PubMed", "id": "25051404", "url": "https://pubmed.ncbi.nlm.nih.gov/25051404" }, { "database": "PubMed", "id": "25078064", "url": "https://pubmed.ncbi.nlm.nih.gov/25078064" }, { "database": "PubMed", "id": "25112877", "url": "https://pubmed.ncbi.nlm.nih.gov/25112877" }, { "database": "PubMed", "id": "25143403", "url": "https://pubmed.ncbi.nlm.nih.gov/25143403" }, { "database": "PubMed", "id": "25198662", "url": "https://pubmed.ncbi.nlm.nih.gov/25198662" }, { "database": "PubMed", "id": "25221641", "url": "https://pubmed.ncbi.nlm.nih.gov/25221641" }, { "database": "PubMed", "id": "25227113", "url": "https://pubmed.ncbi.nlm.nih.gov/25227113" }, { "database": "PubMed", "id": "25275589", "url": "https://pubmed.ncbi.nlm.nih.gov/25275589" }, { "database": "PubMed", "id": "25277183", "url": "https://pubmed.ncbi.nlm.nih.gov/25277183" }, { "database": "PubMed", "id": "25277184", "url": "https://pubmed.ncbi.nlm.nih.gov/25277184" }, { "database": "PubMed", "id": "25294809", "url": "https://pubmed.ncbi.nlm.nih.gov/25294809" }, { "database": "PubMed", "id": "25311384", "url": "https://pubmed.ncbi.nlm.nih.gov/25311384" }, { "database": "PubMed", "id": "25319447", "url": "https://pubmed.ncbi.nlm.nih.gov/25319447" }, { "database": "PubMed", "id": "25331851", "url": "https://pubmed.ncbi.nlm.nih.gov/25331851" }, { "database": "PubMed", "id": "25341038", "url": "https://pubmed.ncbi.nlm.nih.gov/25341038" }, { "database": "PubMed", "id": "25372714", "url": "https://pubmed.ncbi.nlm.nih.gov/25372714" }, { "database": "PubMed", "id": "25412311", "url": "https://pubmed.ncbi.nlm.nih.gov/25412311" }, { "database": "PubMed", "id": "25486198", "url": "https://pubmed.ncbi.nlm.nih.gov/25486198" }, { "database": "PubMed", "id": "25489053", "url": "https://pubmed.ncbi.nlm.nih.gov/25489053" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25524025", "url": "https://pubmed.ncbi.nlm.nih.gov/25524025" }, { "database": "PubMed", "id": "25603347", "url": "https://pubmed.ncbi.nlm.nih.gov/25603347" }, { "database": "PubMed", "id": "25605022", "url": "https://pubmed.ncbi.nlm.nih.gov/25605022" }, { "database": "PubMed", "id": "25617667", "url": "https://pubmed.ncbi.nlm.nih.gov/25617667" }, { "database": "PubMed", "id": "25637534", "url": "https://pubmed.ncbi.nlm.nih.gov/25637534" }, { "database": "PubMed", "id": "25639717", "url": "https://pubmed.ncbi.nlm.nih.gov/25639717" }, { "database": "PubMed", "id": "25650067", "url": "https://pubmed.ncbi.nlm.nih.gov/25650067" }, { "database": "PubMed", "id": "25658463", "url": "https://pubmed.ncbi.nlm.nih.gov/25658463" }, { "database": "PubMed", "id": "25659035", "url": "https://pubmed.ncbi.nlm.nih.gov/25659035" }, { "database": "PubMed", "id": "25674209", "url": "https://pubmed.ncbi.nlm.nih.gov/25674209" }, { "database": "PubMed", "id": "25742468", "url": "https://pubmed.ncbi.nlm.nih.gov/25742468" }, { "database": "PubMed", "id": "25761368", "url": "https://pubmed.ncbi.nlm.nih.gov/25761368" }, { "database": "PubMed", "id": "25769181", "url": "https://pubmed.ncbi.nlm.nih.gov/25769181" }, { "database": "PubMed", "id": "25807079", "url": "https://pubmed.ncbi.nlm.nih.gov/25807079" }, { "database": "PubMed", "id": "25840449", "url": "https://pubmed.ncbi.nlm.nih.gov/25840449" }, { "database": "PubMed", "id": "25852310", "url": "https://pubmed.ncbi.nlm.nih.gov/25852310" }, { "database": "PubMed", "id": "25860929", "url": "https://pubmed.ncbi.nlm.nih.gov/25860929" }, { "database": "PubMed", "id": "25867071", "url": "https://pubmed.ncbi.nlm.nih.gov/25867071" }, { "database": "PubMed", "id": "25883152", "url": "https://pubmed.ncbi.nlm.nih.gov/25883152" }, { "database": "PubMed", "id": "25888625", "url": "https://pubmed.ncbi.nlm.nih.gov/25888625" }, { "database": "PubMed", "id": "25916852", "url": "https://pubmed.ncbi.nlm.nih.gov/25916852" }, { "database": "PubMed", "id": "25929783", "url": "https://pubmed.ncbi.nlm.nih.gov/25929783" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "25980443", "url": "https://pubmed.ncbi.nlm.nih.gov/25980443" }, { "database": "PubMed", "id": "25993660", "url": "https://pubmed.ncbi.nlm.nih.gov/25993660" }, { "database": "PubMed", "id": "26006237", "url": "https://pubmed.ncbi.nlm.nih.gov/26006237" }, { "database": "PubMed", "id": "26024660", "url": "https://pubmed.ncbi.nlm.nih.gov/26024660" }, { "database": "PubMed", "id": "26041883", "url": "https://pubmed.ncbi.nlm.nih.gov/26041883" }, { "database": "PubMed", "id": "26042776", "url": "https://pubmed.ncbi.nlm.nih.gov/26042776" }, { "database": "PubMed", "id": "26059686", "url": "https://pubmed.ncbi.nlm.nih.gov/26059686" }, { "database": "PubMed", "id": "26062651", "url": "https://pubmed.ncbi.nlm.nih.gov/26062651" }, { "database": "PubMed", "id": "26070322", "url": "https://pubmed.ncbi.nlm.nih.gov/26070322" }, { "database": "PubMed", "id": "26091798", "url": "https://pubmed.ncbi.nlm.nih.gov/26091798" }, { "database": "PubMed", "id": "26095524", "url": "https://pubmed.ncbi.nlm.nih.gov/26095524" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26113041", "url": "https://pubmed.ncbi.nlm.nih.gov/26113041" }, { "database": "PubMed", "id": "26138448", "url": "https://pubmed.ncbi.nlm.nih.gov/26138448" }, { "database": "PubMed", "id": "26144554", "url": "https://pubmed.ncbi.nlm.nih.gov/26144554" }, { "database": "PubMed", "id": "26181367", "url": "https://pubmed.ncbi.nlm.nih.gov/26181367" }, { "database": "PubMed", "id": "26193055", "url": "https://pubmed.ncbi.nlm.nih.gov/26193055" }, { "database": "PubMed", "id": "26230405", "url": "https://pubmed.ncbi.nlm.nih.gov/26230405" }, { "database": "PubMed", "id": "26231043", "url": "https://pubmed.ncbi.nlm.nih.gov/26231043" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26261212", "url": "https://pubmed.ncbi.nlm.nih.gov/26261212" }, { "database": "PubMed", "id": "26297485", "url": "https://pubmed.ncbi.nlm.nih.gov/26297485" }, { "database": "PubMed", "id": "26327815", "url": "https://pubmed.ncbi.nlm.nih.gov/26327815" }, { "database": "PubMed", "id": "26333122", "url": "https://pubmed.ncbi.nlm.nih.gov/26333122" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "26391003", "url": "https://pubmed.ncbi.nlm.nih.gov/26391003" }, { "database": "PubMed", "id": "26400164", "url": "https://pubmed.ncbi.nlm.nih.gov/26400164" }, { "database": "PubMed", "id": "26408200", "url": "https://pubmed.ncbi.nlm.nih.gov/26408200" }, { "database": "PubMed", "id": "26415230", "url": "https://pubmed.ncbi.nlm.nih.gov/26415230" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26441204", "url": "https://pubmed.ncbi.nlm.nih.gov/26441204" }, { "database": "PubMed", "id": "26456774", "url": "https://pubmed.ncbi.nlm.nih.gov/26456774" }, { "database": "PubMed", "id": "26459859", "url": "https://pubmed.ncbi.nlm.nih.gov/26459859" }, { "database": "PubMed", "id": "26471002", "url": "https://pubmed.ncbi.nlm.nih.gov/26471002" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26510776", "url": "https://pubmed.ncbi.nlm.nih.gov/26510776" }, { "database": "PubMed", "id": "26522181", "url": "https://pubmed.ncbi.nlm.nih.gov/26522181" }, { "database": "PubMed", "id": "26540344", "url": "https://pubmed.ncbi.nlm.nih.gov/26540344" }, { "database": "PubMed", "id": "26571493", "url": "https://pubmed.ncbi.nlm.nih.gov/26571493" }, { "database": "PubMed", "id": "26598601", "url": "https://pubmed.ncbi.nlm.nih.gov/26598601" }, { "database": "PubMed", "id": "26673821", "url": "https://pubmed.ncbi.nlm.nih.gov/26673821" }, { "database": "PubMed", "id": "26687066", "url": "https://pubmed.ncbi.nlm.nih.gov/26687066" }, { "database": "PubMed", "id": "26699757", "url": "https://pubmed.ncbi.nlm.nih.gov/26699757" }, { "database": "PubMed", "id": "26714930", "url": "https://pubmed.ncbi.nlm.nih.gov/26714930" }, { "database": "PubMed", "id": "26716417", "url": "https://pubmed.ncbi.nlm.nih.gov/26716417" }, { "database": "PubMed", "id": "26734838", "url": "https://pubmed.ncbi.nlm.nih.gov/26734838" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26832796", "url": "https://pubmed.ncbi.nlm.nih.gov/26832796" }, { "database": "PubMed", "id": "26832959", "url": "https://pubmed.ncbi.nlm.nih.gov/26832959" }, { "database": "PubMed", "id": "26876197", "url": "https://pubmed.ncbi.nlm.nih.gov/26876197" }, { "database": "PubMed", "id": "26883108", "url": "https://pubmed.ncbi.nlm.nih.gov/26883108" }, { "database": "PubMed", "id": "26909609", "url": "https://pubmed.ncbi.nlm.nih.gov/26909609" }, { "database": "PubMed", "id": "26928575", "url": "https://pubmed.ncbi.nlm.nih.gov/26928575" }, { "database": "PubMed", "id": "26967060", "url": "https://pubmed.ncbi.nlm.nih.gov/26967060" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26982737", "url": "https://pubmed.ncbi.nlm.nih.gov/26982737" }, { "database": "PubMed", "id": "26984736", "url": "https://pubmed.ncbi.nlm.nih.gov/26984736" }, { "database": "PubMed", "id": "26988910", "url": "https://pubmed.ncbi.nlm.nih.gov/26988910" }, { "database": "PubMed", "id": "27030982", "url": "https://pubmed.ncbi.nlm.nih.gov/27030982" }, { "database": "PubMed", "id": "27031960", "url": "https://pubmed.ncbi.nlm.nih.gov/27031960" }, { "database": "PubMed", "id": "27054339", "url": "https://pubmed.ncbi.nlm.nih.gov/27054339" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27119009", "url": "https://pubmed.ncbi.nlm.nih.gov/27119009" }, { "database": "PubMed", "id": "27127932", "url": "https://pubmed.ncbi.nlm.nih.gov/27127932" }, { "database": "PubMed", "id": "27176768", "url": "https://pubmed.ncbi.nlm.nih.gov/27176768" }, { "database": "PubMed", "id": "27183917", "url": "https://pubmed.ncbi.nlm.nih.gov/27183917" }, { "database": "PubMed", "id": "27195669", "url": "https://pubmed.ncbi.nlm.nih.gov/27195669" }, { "database": "PubMed", "id": "27221050", "url": "https://pubmed.ncbi.nlm.nih.gov/27221050" }, { "database": "PubMed", "id": "27223263", "url": "https://pubmed.ncbi.nlm.nih.gov/27223263" }, { "database": "PubMed", "id": "27270209", "url": "https://pubmed.ncbi.nlm.nih.gov/27270209" }, { "database": "PubMed", "id": "27270636", "url": "https://pubmed.ncbi.nlm.nih.gov/27270636" }, { "database": "PubMed", "id": "27283986", "url": "https://pubmed.ncbi.nlm.nih.gov/27283986" }, { "database": "PubMed", "id": "27285985", "url": "https://pubmed.ncbi.nlm.nih.gov/27285985" }, { "database": "PubMed", "id": "27314341", "url": "https://pubmed.ncbi.nlm.nih.gov/27314341" }, { "database": "PubMed", "id": "27323823", "url": "https://pubmed.ncbi.nlm.nih.gov/27323823" }, { "database": "PubMed", "id": "27344169", "url": "https://pubmed.ncbi.nlm.nih.gov/27344169" }, { "database": "PubMed", "id": "27346849", "url": "https://pubmed.ncbi.nlm.nih.gov/27346849" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27399772", "url": "https://pubmed.ncbi.nlm.nih.gov/27399772" }, { "database": "PubMed", "id": "27402273", "url": "https://pubmed.ncbi.nlm.nih.gov/27402273" }, { "database": "PubMed", "id": "27462916", "url": "https://pubmed.ncbi.nlm.nih.gov/27462916" }, { "database": "PubMed", "id": "27511909", "url": "https://pubmed.ncbi.nlm.nih.gov/27511909" }, { "database": "PubMed", "id": "27517620", "url": "https://pubmed.ncbi.nlm.nih.gov/27517620" }, { "database": "PubMed", "id": "27542238", "url": "https://pubmed.ncbi.nlm.nih.gov/27542238" }, { "database": "PubMed", "id": "27545311", "url": "https://pubmed.ncbi.nlm.nih.gov/27545311" }, { "database": "PubMed", "id": "27551445", "url": "https://pubmed.ncbi.nlm.nih.gov/27551445" }, { "database": "PubMed", "id": "27556362", "url": "https://pubmed.ncbi.nlm.nih.gov/27556362" }, { "database": "PubMed", "id": "27556514", "url": "https://pubmed.ncbi.nlm.nih.gov/27556514" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27611229", "url": "https://pubmed.ncbi.nlm.nih.gov/27611229" }, { "database": "PubMed", "id": "27626308", "url": "https://pubmed.ncbi.nlm.nih.gov/27626308" }, { "database": "PubMed", "id": "27644130", "url": "https://pubmed.ncbi.nlm.nih.gov/27644130" }, { "database": "PubMed", "id": "27656146", "url": "https://pubmed.ncbi.nlm.nih.gov/27656146" }, { "database": "PubMed", "id": "27659536", "url": "https://pubmed.ncbi.nlm.nih.gov/27659536" }, { "database": "PubMed", "id": "27698449", "url": "https://pubmed.ncbi.nlm.nih.gov/27698449" }, { "database": "PubMed", "id": "27721412", "url": "https://pubmed.ncbi.nlm.nih.gov/27721412" }, { "database": "PubMed", "id": "27742673", "url": "https://pubmed.ncbi.nlm.nih.gov/27742673" }, { "database": "PubMed", "id": "27763560", "url": "https://pubmed.ncbi.nlm.nih.gov/27763560" }, { "database": "PubMed", "id": "27769050", "url": "https://pubmed.ncbi.nlm.nih.gov/27769050" }, { "database": "PubMed", "id": "27810895", "url": "https://pubmed.ncbi.nlm.nih.gov/27810895" }, { "database": "PubMed", "id": "27863490", "url": "https://pubmed.ncbi.nlm.nih.gov/27863490" }, { "database": "PubMed", "id": "27902328", "url": "https://pubmed.ncbi.nlm.nih.gov/27902328" }, { "database": "PubMed", "id": "27906186", "url": "https://pubmed.ncbi.nlm.nih.gov/27906186" }, { "database": "PubMed", "id": "27991505", "url": "https://pubmed.ncbi.nlm.nih.gov/27991505" }, { "database": "PubMed", "id": "28031409", "url": "https://pubmed.ncbi.nlm.nih.gov/28031409" }, { "database": "PubMed", "id": "28038466", "url": "https://pubmed.ncbi.nlm.nih.gov/28038466" }, { "database": "PubMed", "id": "28102346", "url": "https://pubmed.ncbi.nlm.nih.gov/28102346" }, { "database": "PubMed", "id": "28118604", "url": "https://pubmed.ncbi.nlm.nih.gov/28118604" }, { "database": "PubMed", "id": "28131798", "url": "https://pubmed.ncbi.nlm.nih.gov/28131798" }, { "database": "PubMed", "id": "28177473", "url": "https://pubmed.ncbi.nlm.nih.gov/28177473" }, { "database": "PubMed", "id": "28182004", "url": "https://pubmed.ncbi.nlm.nih.gov/28182004" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28187444", "url": "https://pubmed.ncbi.nlm.nih.gov/28187444" }, { "database": "PubMed", "id": "28208611", "url": "https://pubmed.ncbi.nlm.nih.gov/28208611" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28259974", "url": "https://pubmed.ncbi.nlm.nih.gov/28259974" }, { "database": "PubMed", "id": "28284059", "url": "https://pubmed.ncbi.nlm.nih.gov/28284059" }, { "database": "PubMed", "id": "28349922", "url": "https://pubmed.ncbi.nlm.nih.gov/28349922" }, { "database": "PubMed", "id": "28369097", "url": "https://pubmed.ncbi.nlm.nih.gov/28369097" }, { "database": "PubMed", "id": "28381880", "url": "https://pubmed.ncbi.nlm.nih.gov/28381880" }, { "database": "PubMed", "id": "28455491", "url": "https://pubmed.ncbi.nlm.nih.gov/28455491" }, { "database": "PubMed", "id": "28466226", "url": "https://pubmed.ncbi.nlm.nih.gov/28466226" }, { "database": "PubMed", "id": "28468838", "url": "https://pubmed.ncbi.nlm.nih.gov/28468838" }, { "database": "PubMed", "id": "28475405", "url": "https://pubmed.ncbi.nlm.nih.gov/28475405" }, { "database": "PubMed", "id": "28535155", "url": "https://pubmed.ncbi.nlm.nih.gov/28535155" }, { "database": "PubMed", "id": "28605833", "url": "https://pubmed.ncbi.nlm.nih.gov/28605833" }, { "database": "PubMed", "id": "28656213", "url": "https://pubmed.ncbi.nlm.nih.gov/28656213" }, { "database": "PubMed", "id": "28667090", "url": "https://pubmed.ncbi.nlm.nih.gov/28667090" }, { "database": "PubMed", "id": "28714848", "url": "https://pubmed.ncbi.nlm.nih.gov/28714848" }, { "database": "PubMed", "id": "28715492", "url": "https://pubmed.ncbi.nlm.nih.gov/28715492" }, { "database": "PubMed", "id": "28726723", "url": "https://pubmed.ncbi.nlm.nih.gov/28726723" }, { "database": "PubMed", "id": "28759712", "url": "https://pubmed.ncbi.nlm.nih.gov/28759712" }, { "database": "PubMed", "id": "28790359", "url": "https://pubmed.ncbi.nlm.nih.gov/28790359" }, { "database": "PubMed", "id": "28794470", "url": "https://pubmed.ncbi.nlm.nih.gov/28794470" }, { "database": "PubMed", "id": "28797070", "url": "https://pubmed.ncbi.nlm.nih.gov/28797070" }, { "database": "PubMed", "id": "28801242", "url": "https://pubmed.ncbi.nlm.nih.gov/28801242" }, { "database": "PubMed", "id": "28837154", "url": "https://pubmed.ncbi.nlm.nih.gov/28837154" }, { "database": "PubMed", "id": "28842590", "url": "https://pubmed.ncbi.nlm.nih.gov/28842590" }, { "database": "PubMed", "id": "28843398", "url": "https://pubmed.ncbi.nlm.nih.gov/28843398" }, { "database": "PubMed", "id": "28888100", "url": "https://pubmed.ncbi.nlm.nih.gov/28888100" }, { "database": "PubMed", "id": "28904350", "url": "https://pubmed.ncbi.nlm.nih.gov/28904350" }, { "database": "PubMed", "id": "28915553", "url": "https://pubmed.ncbi.nlm.nih.gov/28915553" }, { "database": "PubMed", "id": "28915564", "url": "https://pubmed.ncbi.nlm.nih.gov/28915564" }, { "database": "PubMed", "id": "28926586", "url": "https://pubmed.ncbi.nlm.nih.gov/28926586" }, { "database": "PubMed", "id": "28930974", "url": "https://pubmed.ncbi.nlm.nih.gov/28930974" }, { "database": "PubMed", "id": "28968425", "url": "https://pubmed.ncbi.nlm.nih.gov/28968425" }, { "database": "PubMed", "id": "28971953", "url": "https://pubmed.ncbi.nlm.nih.gov/28971953" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "28973015", "url": "https://pubmed.ncbi.nlm.nih.gov/28973015" }, { "database": "PubMed", "id": "28979163", "url": "https://pubmed.ncbi.nlm.nih.gov/28979163" }, { "database": "PubMed", "id": "28981110", "url": "https://pubmed.ncbi.nlm.nih.gov/28981110" }, { "database": "PubMed", "id": "28985345", "url": "https://pubmed.ncbi.nlm.nih.gov/28985345" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29030986", "url": "https://pubmed.ncbi.nlm.nih.gov/29030986" }, { "database": "PubMed", "id": "29033852", "url": "https://pubmed.ncbi.nlm.nih.gov/29033852" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29069457", "url": "https://pubmed.ncbi.nlm.nih.gov/29069457" }, { "database": "PubMed", "id": "29081404", "url": "https://pubmed.ncbi.nlm.nih.gov/29081404" }, { "database": "PubMed", "id": "29096294", "url": "https://pubmed.ncbi.nlm.nih.gov/29096294" }, { "database": "PubMed", "id": "29127423", "url": "https://pubmed.ncbi.nlm.nih.gov/29127423" }, { "database": "PubMed", "id": "29133857", "url": "https://pubmed.ncbi.nlm.nih.gov/29133857" }, { "database": "PubMed", "id": "29156743", "url": "https://pubmed.ncbi.nlm.nih.gov/29156743" }, { "database": "PubMed", "id": "29170254", "url": "https://pubmed.ncbi.nlm.nih.gov/29170254" }, { "database": "PubMed", "id": "29170437", "url": "https://pubmed.ncbi.nlm.nih.gov/29170437" }, { "database": "PubMed", "id": "29212215", "url": "https://pubmed.ncbi.nlm.nih.gov/29212215" }, { "database": "PubMed", "id": "29213352", "url": "https://pubmed.ncbi.nlm.nih.gov/29213352" }, { "database": "PubMed", "id": "29221109", "url": "https://pubmed.ncbi.nlm.nih.gov/29221109" }, { "database": "PubMed", "id": "29233996", "url": "https://pubmed.ncbi.nlm.nih.gov/29233996" }, { "database": "PubMed", "id": "29235570", "url": "https://pubmed.ncbi.nlm.nih.gov/29235570" }, { "database": "PubMed", "id": "29242151", "url": "https://pubmed.ncbi.nlm.nih.gov/29242151" }, { "database": "PubMed", "id": "29262653", "url": "https://pubmed.ncbi.nlm.nih.gov/29262653" }, { "database": "PubMed", "id": "29282022", "url": "https://pubmed.ncbi.nlm.nih.gov/29282022" }, { "database": "PubMed", "id": "29298131", "url": "https://pubmed.ncbi.nlm.nih.gov/29298131" }, { "database": "PubMed", "id": "29311824", "url": "https://pubmed.ncbi.nlm.nih.gov/29311824" }, { "database": "PubMed", "id": "29317830", "url": "https://pubmed.ncbi.nlm.nih.gov/29317830" }, { "database": "PubMed", "id": "29368980", "url": "https://pubmed.ncbi.nlm.nih.gov/29368980" }, { "database": "PubMed", "id": "29383186", "url": "https://pubmed.ncbi.nlm.nih.gov/29383186" }, { "database": "PubMed", "id": "29391428", "url": "https://pubmed.ncbi.nlm.nih.gov/29391428" }, { "database": "PubMed", "id": "29444163", "url": "https://pubmed.ncbi.nlm.nih.gov/29444163" }, { "database": "PubMed", "id": "29445107", "url": "https://pubmed.ncbi.nlm.nih.gov/29445107" }, { "database": "PubMed", "id": "29467390", "url": "https://pubmed.ncbi.nlm.nih.gov/29467390" }, { "database": "PubMed", "id": "29555944", "url": "https://pubmed.ncbi.nlm.nih.gov/29555944" }, { "database": "PubMed", "id": "29568955", "url": "https://pubmed.ncbi.nlm.nih.gov/29568955" }, { "database": "PubMed", "id": "29622681", "url": "https://pubmed.ncbi.nlm.nih.gov/29622681" }, { "database": "PubMed", "id": "29675670", "url": "https://pubmed.ncbi.nlm.nih.gov/29675670" }, { "database": "PubMed", "id": "29705090", "url": "https://pubmed.ncbi.nlm.nih.gov/29705090" }, { "database": "PubMed", "id": "29774100", "url": "https://pubmed.ncbi.nlm.nih.gov/29774100" }, { "database": "PubMed", "id": "29849909", "url": "https://pubmed.ncbi.nlm.nih.gov/29849909" }, { "database": "PubMed", "id": "29879550", "url": "https://pubmed.ncbi.nlm.nih.gov/29879550" }, { "database": "PubMed", "id": "29890668", "url": "https://pubmed.ncbi.nlm.nih.gov/29890668" }, { "database": "PubMed", "id": "29899847", "url": "https://pubmed.ncbi.nlm.nih.gov/29899847" }, { "database": "PubMed", "id": "29937996", "url": "https://pubmed.ncbi.nlm.nih.gov/29937996" }, { "database": "PubMed", "id": "29963241", "url": "https://pubmed.ncbi.nlm.nih.gov/29963241" }, { "database": "PubMed", "id": "30003648", "url": "https://pubmed.ncbi.nlm.nih.gov/30003648" }, { "database": "PubMed", "id": "30018737", "url": "https://pubmed.ncbi.nlm.nih.gov/30018737" }, { "database": "PubMed", "id": "30045945", "url": "https://pubmed.ncbi.nlm.nih.gov/30045945" }, { "database": "PubMed", "id": "30049386", "url": "https://pubmed.ncbi.nlm.nih.gov/30049386" }, { "database": "PubMed", "id": "30057418", "url": "https://pubmed.ncbi.nlm.nih.gov/30057418" }, { "database": "PubMed", "id": "30067985", "url": "https://pubmed.ncbi.nlm.nih.gov/30067985" }, { "database": "PubMed", "id": "30093397", "url": "https://pubmed.ncbi.nlm.nih.gov/30093397" }, { "database": "PubMed", "id": "30108207", "url": "https://pubmed.ncbi.nlm.nih.gov/30108207" }, { "database": "PubMed", "id": "30142917", "url": "https://pubmed.ncbi.nlm.nih.gov/30142917" }, { "database": "PubMed", "id": "30166519", "url": "https://pubmed.ncbi.nlm.nih.gov/30166519" }, { "database": "PubMed", "id": "30177839", "url": "https://pubmed.ncbi.nlm.nih.gov/30177839" }, { "database": "PubMed", "id": "30193098", "url": "https://pubmed.ncbi.nlm.nih.gov/30193098" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30252118", "url": "https://pubmed.ncbi.nlm.nih.gov/30252118" }, { "database": "PubMed", "id": "30254375", "url": "https://pubmed.ncbi.nlm.nih.gov/30254375" }, { "database": "PubMed", "id": "30261716", "url": "https://pubmed.ncbi.nlm.nih.gov/30261716" }, { "database": "PubMed", "id": "30272263", "url": "https://pubmed.ncbi.nlm.nih.gov/30272263" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30375398", "url": "https://pubmed.ncbi.nlm.nih.gov/30375398" }, { "database": "PubMed", "id": "30380295", "url": "https://pubmed.ncbi.nlm.nih.gov/30380295" }, { "database": "PubMed", "id": "30388705", "url": "https://pubmed.ncbi.nlm.nih.gov/30388705" }, { "database": "PubMed", "id": "30400903", "url": "https://pubmed.ncbi.nlm.nih.gov/30400903" }, { "database": "PubMed", "id": "30424508", "url": "https://pubmed.ncbi.nlm.nih.gov/30424508" }, { "database": "PubMed", "id": "30476192", "url": "https://pubmed.ncbi.nlm.nih.gov/30476192" }, { "database": "PubMed", "id": "30478303", "url": "https://pubmed.ncbi.nlm.nih.gov/30478303" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30520728", "url": "https://pubmed.ncbi.nlm.nih.gov/30520728" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30538965", "url": "https://pubmed.ncbi.nlm.nih.gov/30538965" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30585287", "url": "https://pubmed.ncbi.nlm.nih.gov/30585287" }, { "database": "PubMed", "id": "30587121", "url": "https://pubmed.ncbi.nlm.nih.gov/30587121" }, { "database": "PubMed", "id": "30665195", "url": "https://pubmed.ncbi.nlm.nih.gov/30665195" }, { "database": "PubMed", "id": "30666155", "url": "https://pubmed.ncbi.nlm.nih.gov/30666155" }, { "database": "PubMed", "id": "30717309", "url": "https://pubmed.ncbi.nlm.nih.gov/30717309" }, { "database": "PubMed", "id": "30728460", "url": "https://pubmed.ncbi.nlm.nih.gov/30728460" }, { "database": "PubMed", "id": "30733851", "url": "https://pubmed.ncbi.nlm.nih.gov/30733851" }, { "database": "PubMed", "id": "30808373", "url": "https://pubmed.ncbi.nlm.nih.gov/30808373" }, { "database": "PubMed", "id": "30813936", "url": "https://pubmed.ncbi.nlm.nih.gov/30813936" }, { "database": "PubMed", "id": "30854784", "url": "https://pubmed.ncbi.nlm.nih.gov/30854784" }, { "database": "PubMed", "id": "30868056", "url": "https://pubmed.ncbi.nlm.nih.gov/30868056" }, { "database": "PubMed", "id": "30881947", "url": "https://pubmed.ncbi.nlm.nih.gov/30881947" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30932278", "url": "https://pubmed.ncbi.nlm.nih.gov/30932278" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30966857", "url": "https://pubmed.ncbi.nlm.nih.gov/30966857" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30982228", "url": "https://pubmed.ncbi.nlm.nih.gov/30982228" }, { "database": "PubMed", "id": "31039479", "url": "https://pubmed.ncbi.nlm.nih.gov/31039479" }, { "database": "PubMed", "id": "31051014", "url": "https://pubmed.ncbi.nlm.nih.gov/31051014" }, { "database": "PubMed", "id": "31111215", "url": "https://pubmed.ncbi.nlm.nih.gov/31111215" }, { "database": "PubMed", "id": "31120902", "url": "https://pubmed.ncbi.nlm.nih.gov/31120902" }, { "database": "PubMed", "id": "31138113", "url": "https://pubmed.ncbi.nlm.nih.gov/31138113" }, { "database": "PubMed", "id": "31150435", "url": "https://pubmed.ncbi.nlm.nih.gov/31150435" }, { "database": "PubMed", "id": "31217894", "url": "https://pubmed.ncbi.nlm.nih.gov/31217894" }, { "database": "PubMed", "id": "31231694", "url": "https://pubmed.ncbi.nlm.nih.gov/31231694" }, { "database": "PubMed", "id": "31336690", "url": "https://pubmed.ncbi.nlm.nih.gov/31336690" }, { "database": "PubMed", "id": "31360122", "url": "https://pubmed.ncbi.nlm.nih.gov/31360122" }, { "database": "PubMed", "id": "31366902", "url": "https://pubmed.ncbi.nlm.nih.gov/31366902" }, { "database": "PubMed", "id": "31379409", "url": "https://pubmed.ncbi.nlm.nih.gov/31379409" }, { "database": "PubMed", "id": "31388677", "url": "https://pubmed.ncbi.nlm.nih.gov/31388677" }, { "database": "PubMed", "id": "31421458", "url": "https://pubmed.ncbi.nlm.nih.gov/31421458" }, { "database": "PubMed", "id": "31462218", "url": "https://pubmed.ncbi.nlm.nih.gov/31462218" }, { "database": "PubMed", "id": "31551768", "url": "https://pubmed.ncbi.nlm.nih.gov/31551768" }, { "database": "PubMed", "id": "31594538", "url": "https://pubmed.ncbi.nlm.nih.gov/31594538" }, { "database": "PubMed", "id": "31596196", "url": "https://pubmed.ncbi.nlm.nih.gov/31596196" }, { "database": "PubMed", "id": "31615975", "url": "https://pubmed.ncbi.nlm.nih.gov/31615975" }, { "database": "PubMed", "id": "31699974", "url": "https://pubmed.ncbi.nlm.nih.gov/31699974" }, { "database": "PubMed", "id": "31804459", "url": "https://pubmed.ncbi.nlm.nih.gov/31804459" }, { "database": "PubMed", "id": "31821701", "url": "https://pubmed.ncbi.nlm.nih.gov/31821701" }, { "database": "PubMed", "id": "31844686", "url": "https://pubmed.ncbi.nlm.nih.gov/31844686" }, { "database": "PubMed", "id": "31847237", "url": "https://pubmed.ncbi.nlm.nih.gov/31847237" }, { "database": "PubMed", "id": "31861721", "url": "https://pubmed.ncbi.nlm.nih.gov/31861721" }, { "database": "PubMed", "id": "31979361", "url": "https://pubmed.ncbi.nlm.nih.gov/31979361" }, { "database": "PubMed", "id": "32001678", "url": "https://pubmed.ncbi.nlm.nih.gov/32001678" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32054925", "url": "https://pubmed.ncbi.nlm.nih.gov/32054925" }, { "database": "PubMed", "id": "32083004", "url": "https://pubmed.ncbi.nlm.nih.gov/32083004" }, { "database": "PubMed", "id": "32168910", "url": "https://pubmed.ncbi.nlm.nih.gov/32168910" }, { "database": "PubMed", "id": "32213959", "url": "https://pubmed.ncbi.nlm.nih.gov/32213959" }, { "database": "PubMed", "id": "32260204", "url": "https://pubmed.ncbi.nlm.nih.gov/32260204" }, { "database": "PubMed", "id": "32332845", "url": "https://pubmed.ncbi.nlm.nih.gov/32332845" }, { "database": "PubMed", "id": "32427887", "url": "https://pubmed.ncbi.nlm.nih.gov/32427887" }, { "database": "PubMed", "id": "32432260", "url": "https://pubmed.ncbi.nlm.nih.gov/32432260" }, { "database": "PubMed", "id": "32492656", "url": "https://pubmed.ncbi.nlm.nih.gov/32492656" }, { "database": "PubMed", "id": "32560563", "url": "https://pubmed.ncbi.nlm.nih.gov/32560563" }, { "database": "PubMed", "id": "32605139", "url": "https://pubmed.ncbi.nlm.nih.gov/32605139" }, { "database": "PubMed", "id": "32617134", "url": "https://pubmed.ncbi.nlm.nih.gov/32617134" }, { "database": "PubMed", "id": "32674319", "url": "https://pubmed.ncbi.nlm.nih.gov/32674319" }, { "database": "PubMed", "id": "32724100", "url": "https://pubmed.ncbi.nlm.nih.gov/32724100" }, { "database": "PubMed", "id": "32733438", "url": "https://pubmed.ncbi.nlm.nih.gov/32733438" }, { "database": "PubMed", "id": "32735894", "url": "https://pubmed.ncbi.nlm.nih.gov/32735894" }, { "database": "PubMed", "id": "32813746", "url": "https://pubmed.ncbi.nlm.nih.gov/32813746" }, { "database": "PubMed", "id": "32863918", "url": "https://pubmed.ncbi.nlm.nih.gov/32863918" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32929340", "url": "https://pubmed.ncbi.nlm.nih.gov/32929340" }, { "database": "PubMed", "id": "32945487", "url": "https://pubmed.ncbi.nlm.nih.gov/32945487" }, { "database": "PubMed", "id": "32978372", "url": "https://pubmed.ncbi.nlm.nih.gov/32978372" }, { "database": "PubMed", "id": "33014050", "url": "https://pubmed.ncbi.nlm.nih.gov/33014050" }, { "database": "PubMed", "id": "33045019", "url": "https://pubmed.ncbi.nlm.nih.gov/33045019" }, { "database": "PubMed", "id": "33061640", "url": "https://pubmed.ncbi.nlm.nih.gov/33061640" }, { "database": "PubMed", "id": "33074128", "url": "https://pubmed.ncbi.nlm.nih.gov/33074128" }, { "database": "PubMed", "id": "33085644", "url": "https://pubmed.ncbi.nlm.nih.gov/33085644" }, { "database": "PubMed", "id": "33097607", "url": "https://pubmed.ncbi.nlm.nih.gov/33097607" }, { "database": "PubMed", "id": "33110364", "url": "https://pubmed.ncbi.nlm.nih.gov/33110364" }, { "database": "PubMed", "id": "33146634", "url": "https://pubmed.ncbi.nlm.nih.gov/33146634" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33245719", "url": "https://pubmed.ncbi.nlm.nih.gov/33245719" }, { "database": "PubMed", "id": "33251333", "url": "https://pubmed.ncbi.nlm.nih.gov/33251333" }, { "database": "PubMed", "id": "33297931", "url": "https://pubmed.ncbi.nlm.nih.gov/33297931" }, { "database": "PubMed", "id": "33303632", "url": "https://pubmed.ncbi.nlm.nih.gov/33303632" }, { "database": "PubMed", "id": "33391525", "url": "https://pubmed.ncbi.nlm.nih.gov/33391525" }, { "database": "PubMed", "id": "33396303", "url": "https://pubmed.ncbi.nlm.nih.gov/33396303" }, { "database": "PubMed", "id": "33411764", "url": "https://pubmed.ncbi.nlm.nih.gov/33411764" }, { "database": "PubMed", "id": "33431809", "url": "https://pubmed.ncbi.nlm.nih.gov/33431809" }, { "database": "PubMed", "id": "33503543", "url": "https://pubmed.ncbi.nlm.nih.gov/33503543" }, { "database": "PubMed", "id": "33536467", "url": "https://pubmed.ncbi.nlm.nih.gov/33536467" }, { "database": "PubMed", "id": "33585229", "url": "https://pubmed.ncbi.nlm.nih.gov/33585229" }, { "database": "PubMed", "id": "33669867", "url": "https://pubmed.ncbi.nlm.nih.gov/33669867" }, { "database": "PubMed", "id": "33745968", "url": "https://pubmed.ncbi.nlm.nih.gov/33745968" }, { "database": "PubMed", "id": "33761896", "url": "https://pubmed.ncbi.nlm.nih.gov/33761896" }, { "database": "PubMed", "id": "33804124", "url": "https://pubmed.ncbi.nlm.nih.gov/33804124" }, { "database": "PubMed", "id": "33808426", "url": "https://pubmed.ncbi.nlm.nih.gov/33808426" }, { "database": "PubMed", "id": "33850227", "url": "https://pubmed.ncbi.nlm.nih.gov/33850227" }, { "database": "PubMed", "id": "33898425", "url": "https://pubmed.ncbi.nlm.nih.gov/33898425" }, { "database": "PubMed", "id": "33899121", "url": "https://pubmed.ncbi.nlm.nih.gov/33899121" }, { "database": "PubMed", "id": "33982778", "url": "https://pubmed.ncbi.nlm.nih.gov/33982778" }, { "database": "PubMed", "id": "33982878", "url": "https://pubmed.ncbi.nlm.nih.gov/33982878" }, { "database": "PubMed", "id": "34103468", "url": "https://pubmed.ncbi.nlm.nih.gov/34103468" }, { "database": "PubMed", "id": "34930892", "url": "https://pubmed.ncbi.nlm.nih.gov/34930892" }, { "database": "PubMed", "id": "35143532", "url": "https://pubmed.ncbi.nlm.nih.gov/35143532" }, { "database": "PubMed", "id": "35312310", "url": "https://pubmed.ncbi.nlm.nih.gov/35312310" }, { "database": "PubMed", "id": "35752942", "url": "https://pubmed.ncbi.nlm.nih.gov/35752942" }, { "database": "PubMed", "id": "35792512", "url": "https://pubmed.ncbi.nlm.nih.gov/35792512" }, { "database": "PubMed", "id": "35829882", "url": "https://pubmed.ncbi.nlm.nih.gov/35829882" }, { "database": "PubMed", "id": "35834822", "url": "https://pubmed.ncbi.nlm.nih.gov/35834822" }, { "database": "PubMed", "id": "35881289", "url": "https://pubmed.ncbi.nlm.nih.gov/35881289" }, { "database": "PubMed", "id": "36094323", "url": "https://pubmed.ncbi.nlm.nih.gov/36094323" }, { "database": "PubMed", "id": "36293376", "url": "https://pubmed.ncbi.nlm.nih.gov/36293376" }, { "database": "PubMed", "id": "36300938", "url": "https://pubmed.ncbi.nlm.nih.gov/36300938" }, { "database": "PubMed", "id": "8327466", "url": "https://pubmed.ncbi.nlm.nih.gov/8327466" }, { "database": "PubMed", "id": "8502477", "url": "https://pubmed.ncbi.nlm.nih.gov/8502477" }, { "database": "PubMed", "id": "9407038", "url": "https://pubmed.ncbi.nlm.nih.gov/9407038" }, { "database": "PubMed", "id": "9658074", "url": "https://pubmed.ncbi.nlm.nih.gov/9658074" }, { "database": "PubMed", "id": "9733514", "url": "https://pubmed.ncbi.nlm.nih.gov/9733514" }, { "database": "PubMed", "id": "9733515", "url": "https://pubmed.ncbi.nlm.nih.gov/9733515" }, { "database": "PubMed", "id": "9830059", "url": "https://pubmed.ncbi.nlm.nih.gov/9830059" }, { "database": "PubMed", "id": "9843217", "url": "https://pubmed.ncbi.nlm.nih.gov/9843217" }, { "database": "PubMed", "id": "11554766", "url": "https://pubmed.ncbi.nlm.nih.gov/11554766" } ], "site_lbl": "Ser15", "uniprot_canonical_ac": "P04637-1" } ], "record_id": "pubmed.26106036", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Resibufogenin Induces G1-Phase Arrest through the Proteasomal Degradation of Cyclin D1 in Human Malignant Tumor Cells.", "journal": "PloS one", "date": "2015", "authors": "Ichikawa M, Sowa Y, Iizumi Y, Aono Y, Sakai T", "reference": { "type": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 286, "end_pos": 286, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P24385", "url": "https://www.uniprot.org/uniprotkb/P24385" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "29279382", "url": "https://pubmed.ncbi.nlm.nih.gov/29279382" }, { "database": "PubMed", "id": "33854239", "url": "https://pubmed.ncbi.nlm.nih.gov/33854239" }, { "database": "PubMed", "id": "19412162", "url": "https://pubmed.ncbi.nlm.nih.gov/19412162" }, { "database": "PubMed", "id": "33854232", "url": "https://pubmed.ncbi.nlm.nih.gov/33854232" }, { "database": "PubMed", "id": "33854235", "url": "https://pubmed.ncbi.nlm.nih.gov/33854235" }, { "database": "PRO", "id": "P24385", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P24385" }, { "database": "iPTMnet", "id": "P24385", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P24385" }, { "database": "PubMed", "id": "10766840", "url": "https://pubmed.ncbi.nlm.nih.gov/10766840" }, { "database": "PubMed", "id": "10952989", "url": "https://pubmed.ncbi.nlm.nih.gov/10952989" }, { "database": "PubMed", "id": "11751903", "url": "https://pubmed.ncbi.nlm.nih.gov/11751903" }, { "database": "PubMed", "id": "14612495", "url": "https://pubmed.ncbi.nlm.nih.gov/14612495" }, { "database": "PubMed", "id": "15513923", "url": "https://pubmed.ncbi.nlm.nih.gov/15513923" }, { "database": "PubMed", "id": "15735756", "url": "https://pubmed.ncbi.nlm.nih.gov/15735756" }, { "database": "PubMed", "id": "16153639", "url": "https://pubmed.ncbi.nlm.nih.gov/16153639" }, { "database": "PubMed", "id": "16504004", "url": "https://pubmed.ncbi.nlm.nih.gov/16504004" }, { "database": "PubMed", "id": "16732330", "url": "https://pubmed.ncbi.nlm.nih.gov/16732330" }, { "database": "PubMed", "id": "16942622", "url": "https://pubmed.ncbi.nlm.nih.gov/16942622" }, { "database": "PubMed", "id": "17046823", "url": "https://pubmed.ncbi.nlm.nih.gov/17046823" }, { "database": "PubMed", "id": "17081987", "url": "https://pubmed.ncbi.nlm.nih.gov/17081987" }, { "database": "PubMed", "id": "17205132", "url": "https://pubmed.ncbi.nlm.nih.gov/17205132" }, { "database": "PubMed", "id": "17359980", "url": "https://pubmed.ncbi.nlm.nih.gov/17359980" }, { "database": "PubMed", "id": "18063576", "url": "https://pubmed.ncbi.nlm.nih.gov/18063576" }, { "database": "PubMed", "id": "18328826", "url": "https://pubmed.ncbi.nlm.nih.gov/18328826" }, { "database": "PubMed", "id": "18606783", "url": "https://pubmed.ncbi.nlm.nih.gov/18606783" }, { "database": "PubMed", "id": "18769147", "url": "https://pubmed.ncbi.nlm.nih.gov/18769147" }, { "database": "PubMed", "id": "18818515", "url": "https://pubmed.ncbi.nlm.nih.gov/18818515" }, { "database": "PubMed", "id": "18838555", "url": "https://pubmed.ncbi.nlm.nih.gov/18838555" }, { "database": "PubMed", "id": "19071090", "url": "https://pubmed.ncbi.nlm.nih.gov/19071090" }, { "database": "PubMed", "id": "19374252", "url": "https://pubmed.ncbi.nlm.nih.gov/19374252" }, { "database": "PubMed", "id": "19767775", "url": "https://pubmed.ncbi.nlm.nih.gov/19767775" }, { "database": "PubMed", "id": "19903334", "url": "https://pubmed.ncbi.nlm.nih.gov/19903334" }, { "database": "PubMed", "id": "20394812", "url": "https://pubmed.ncbi.nlm.nih.gov/20394812" }, { "database": "PubMed", "id": "20655656", "url": "https://pubmed.ncbi.nlm.nih.gov/20655656" }, { "database": "PubMed", "id": "21241249", "url": "https://pubmed.ncbi.nlm.nih.gov/21241249" }, { "database": "PubMed", "id": "21347341", "url": "https://pubmed.ncbi.nlm.nih.gov/21347341" }, { "database": "PubMed", "id": "21411630", "url": "https://pubmed.ncbi.nlm.nih.gov/21411630" }, { "database": "PubMed", "id": "22069692", "url": "https://pubmed.ncbi.nlm.nih.gov/22069692" }, { "database": "PubMed", "id": "22266466", "url": "https://pubmed.ncbi.nlm.nih.gov/22266466" }, { "database": "PubMed", "id": "23162706", "url": "https://pubmed.ncbi.nlm.nih.gov/23162706" }, { "database": "PubMed", "id": "23733133", "url": "https://pubmed.ncbi.nlm.nih.gov/23733133" }, { "database": "PubMed", "id": "23949314", "url": "https://pubmed.ncbi.nlm.nih.gov/23949314" }, { "database": "PubMed", "id": "24280698", "url": "https://pubmed.ncbi.nlm.nih.gov/24280698" }, { "database": "PubMed", "id": "25142862", "url": "https://pubmed.ncbi.nlm.nih.gov/25142862" }, { "database": "PubMed", "id": "25479723", "url": "https://pubmed.ncbi.nlm.nih.gov/25479723" }, { "database": "PubMed", "id": "25603341", "url": "https://pubmed.ncbi.nlm.nih.gov/25603341" }, { "database": "PubMed", "id": "25615593", "url": "https://pubmed.ncbi.nlm.nih.gov/25615593" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "26157550", "url": "https://pubmed.ncbi.nlm.nih.gov/26157550" }, { "database": "PubMed", "id": "26926171", "url": "https://pubmed.ncbi.nlm.nih.gov/26926171" }, { "database": "PubMed", "id": "27424123", "url": "https://pubmed.ncbi.nlm.nih.gov/27424123" }, { "database": "PubMed", "id": "27670681", "url": "https://pubmed.ncbi.nlm.nih.gov/27670681" }, { "database": "PubMed", "id": "27713153", "url": "https://pubmed.ncbi.nlm.nih.gov/27713153" }, { "database": "PubMed", "id": "27854312", "url": "https://pubmed.ncbi.nlm.nih.gov/27854312" }, { "database": "PubMed", "id": "28035994", "url": "https://pubmed.ncbi.nlm.nih.gov/28035994" }, { "database": "PubMed", "id": "28870200", "url": "https://pubmed.ncbi.nlm.nih.gov/28870200" }, { "database": "PubMed", "id": "29039762", "url": "https://pubmed.ncbi.nlm.nih.gov/29039762" }, { "database": "PubMed", "id": "29298515", "url": "https://pubmed.ncbi.nlm.nih.gov/29298515" }, { "database": "PubMed", "id": "29328502", "url": "https://pubmed.ncbi.nlm.nih.gov/29328502" }, { "database": "PubMed", "id": "29442024", "url": "https://pubmed.ncbi.nlm.nih.gov/29442024" }, { "database": "PubMed", "id": "29554905", "url": "https://pubmed.ncbi.nlm.nih.gov/29554905" }, { "database": "PubMed", "id": "29969496", "url": "https://pubmed.ncbi.nlm.nih.gov/29969496" }, { "database": "PubMed", "id": "30157875", "url": "https://pubmed.ncbi.nlm.nih.gov/30157875" }, { "database": "PubMed", "id": "30224477", "url": "https://pubmed.ncbi.nlm.nih.gov/30224477" }, { "database": "PubMed", "id": "30736789", "url": "https://pubmed.ncbi.nlm.nih.gov/30736789" }, { "database": "PubMed", "id": "31262325", "url": "https://pubmed.ncbi.nlm.nih.gov/31262325" }, { "database": "PubMed", "id": "31484966", "url": "https://pubmed.ncbi.nlm.nih.gov/31484966" }, { "database": "PubMed", "id": "32700164", "url": "https://pubmed.ncbi.nlm.nih.gov/32700164" }, { "database": "PubMed", "id": "32944401", "url": "https://pubmed.ncbi.nlm.nih.gov/32944401" }, { "database": "PubMed", "id": "33046973", "url": "https://pubmed.ncbi.nlm.nih.gov/33046973" }, { "database": "PubMed", "id": "33139730", "url": "https://pubmed.ncbi.nlm.nih.gov/33139730" }, { "database": "PubMed", "id": "33521925", "url": "https://pubmed.ncbi.nlm.nih.gov/33521925" } ], "site_lbl": "Thr286", "uniprot_canonical_ac": "P24385-1" } ], "record_id": "pubmed.26121043", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Simultaneous measurement of passage through the restriction point and MCM loading in single cells.", "journal": "Nucleic acids research", "date": "2015", "authors": "Haland TW, Boye E, Stokke T, Grallert B, Syljuasen RG", "reference": { "type": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.26250117", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phospho-T356RB1 predicts survival in HPV-negative squamous cell carcinoma of the head and neck.", "journal": "Oncotarget", "date": "2015", "authors": "Beck TN, Kaczmar J, Handorf E, Nikonova A, Dubyk C, Peri S, Lango M, Ridge JA, Serebriiskii IG, Burtness B, Golemis EA, Mehra R", "reference": { "type": "PubMed", "id": "26265441", "url": "https://pubmed.ncbi.nlm.nih.gov/26265441" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "IntAct", "id": "P06400", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06400*" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "17380128", "url": "https://pubmed.ncbi.nlm.nih.gov/17380128" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "26265441", "url": "https://pubmed.ncbi.nlm.nih.gov/26265441" } ], "site_lbl": "Thr356", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.26265441", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BLCAP arrests G(1)/S checkpoint and induces apoptosis through downregulation of pRb1 in HeLa cells.", "journal": "Oncol. Rep.", "date": "2016", "authors": "Zhao M, Zhang L, Qiu X, Zeng F, Chen W, An Y, Hu B, Wu X, Wu X", "reference": { "type": "PubMed", "id": "26986503", "url": "https://pubmed.ncbi.nlm.nih.gov/26986503" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62952-1", "protein_name": "Apoptosis inducing factor BLCAP", "gene_name": "BLCAP", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 16, "end_pos": 19, "sequence_org": "PLNP", "sequence_mut": "ALNA", "comment": "No significant effect on activity.", "evidence": [ { "database": "UniProtKB", "id": "P62952", "url": "https://www.uniprot.org/uniprotkb/P62952" }, { "database": "PubMed", "id": "26986503", "url": "https://pubmed.ncbi.nlm.nih.gov/26986503" } ], "uniprot_canonical_ac": "P62952-1" }, { "start_pos": 74, "end_pos": 74, "sequence_org": "P", "sequence_mut": "A", "comment": "Reduces activity.", "evidence": [ { "database": "UniProtKB", "id": "P62952", "url": "https://www.uniprot.org/uniprotkb/P62952" }, { "database": "PubMed", "id": "26986503", "url": "https://pubmed.ncbi.nlm.nih.gov/26986503" } ], "uniprot_canonical_ac": "P62952-1" }, { "start_pos": 78, "end_pos": 78, "sequence_org": "S", "sequence_mut": "A", "comment": "No significant effect on activity.", "evidence": [ { "database": "UniProtKB", "id": "P62952", "url": "https://www.uniprot.org/uniprotkb/P62952" }, { "database": "PubMed", "id": "26986503", "url": "https://pubmed.ncbi.nlm.nih.gov/26986503" } ], "uniprot_canonical_ac": "P62952-1" } ], "record_id": "pubmed.26986503", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and partial genomic sequence of the human retinoblastoma susceptibility gene.", "journal": "Gene", "date": "1989", "authors": "McGee T L, Yandell D W, Dryja T P", "reference": { "type": "PubMed", "id": "2701949", "url": "https://pubmed.ncbi.nlm.nih.gov/2701949" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2701949", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic organization of the human retinoblastoma gene.", "journal": "Oncogene", "date": "1989", "authors": "T'Ang A, Wu K J, Hashimoto T, Liu W Y, Takahashi R, Shi X H, Mihara K, Zhang F H, Chen Y Y, Du C", "reference": { "type": "PubMed", "id": "2717184", "url": "https://pubmed.ncbi.nlm.nih.gov/2717184" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2717184", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of the Retinoblastoma Protein in Childhood Acute Lymphoblastic Leukemia.", "journal": "Hematology (Amsterdam, Netherlands)", "date": "2001", "authors": "Schmitz NM, Leibundgut K, Hirt A", "reference": { "type": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "IEDB", "id": "P06400", "url": "https://www.iedb.org/epitope/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "27869121", "url": "https://pubmed.ncbi.nlm.nih.gov/27869121" }, { "database": "PubMed", "id": "31848261", "url": "https://pubmed.ncbi.nlm.nih.gov/31848261" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "29468545", "url": "https://pubmed.ncbi.nlm.nih.gov/29468545" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr252", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 373, "end_pos": 373, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "34042274", "url": "https://pubmed.ncbi.nlm.nih.gov/34042274" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr373", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 608, "end_pos": 608, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "12895470", "url": "https://pubmed.ncbi.nlm.nih.gov/12895470" }, { "database": "PubMed", "id": "15081408", "url": "https://pubmed.ncbi.nlm.nih.gov/15081408" }, { "database": "PubMed", "id": "22322860", "url": "https://pubmed.ncbi.nlm.nih.gov/22322860" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "34042274", "url": "https://pubmed.ncbi.nlm.nih.gov/34042274" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" }, { "database": "PubMed", "id": "9010227", "url": "https://pubmed.ncbi.nlm.nih.gov/9010227" } ], "site_lbl": "Ser608", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.27419601", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of P16-RBSP3 inactivation with phosphorylated RB1 overexpression in basal-parabasal layers of normal cervix unchanged during CACX development.", "journal": "The Biochemical journal", "date": "2016", "authors": "Chakraborty C, Roychowdhury A, Samadder S, Roy A, Mandal RK, Basu P, Roychoudhury S, Panda CK", "reference": { "type": "PubMed", "id": "27458253", "url": "https://pubmed.ncbi.nlm.nih.gov/27458253" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 567, "end_pos": 567, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK2", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "27458253", "url": "https://pubmed.ncbi.nlm.nih.gov/27458253" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" } ], "site_lbl": "Ser567", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.27458253", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "1-(2-Hydroxy-5-methylphenyl)-3-phenyl-1,3-propanedione Induces G1 Cell Cycle Arrest and Autophagy in HeLa Cervical Cancer Cells.", "journal": "International journal of molecular sciences", "date": "2016-08-05", "authors": "Tsai Jie-Heng, Hsu Li-Sung, Huang Hsiu-Chen, Lin Chih-Li, Pan Min-Hsiung, Hong Hui-Mei, Chen Wei-Jen", "reference": { "type": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.27527160", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Acquired CDK6 amplification promotes breast cancer resistance to CDK4/6 inhibitors and loss of ER signaling and dependence.", "journal": "Oncogene", "date": "2017-04-20", "authors": "Yang C, Li Z, Bhatt T, Dickler M, Giri D, Scaltriti M, Baselga J, Rosen N, Chandarlapaty S", "reference": { "type": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.27748766", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Palbociclib (PD-0332991), a selective CDK4/6 inhibitor, restricts tumour growth in preclinical models of hepatocellular carcinoma.", "journal": "Gut", "date": "2017", "authors": "Bollard J, Miguela V, Ruiz de Galarreta M, Venkatesh A, Bian CB, Roberto MP, Tovar V, Sia D, Molina-Sanchez P, Nguyen CB, Nakagawa S, Llovet JM, Hoshida Y, Lujambio A", "reference": { "type": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.27849562", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The antiviral cytokine interferon-gamma restricts neural stem/progenitor cell proliferation through activation of STAT1 and modulation of retinoblastoma protein phosphorylation.", "journal": "Journal of neuroscience research", "date": "2017", "authors": "Kulkarni A, Scully TJ, O'Donnell LA", "reference": { "type": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42224-1", "protein_name": "Signal transducer and activator of transcription 1-alpha/beta", "gene_name": "STAT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FER and PTK6", "evidence": [ { "database": "UniProtKB", "id": "P40763", "url": "https://www.uniprot.org/uniprotkb/P40763" }, { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" }, { "database": "IntAct", "id": "P40763", "url": "https://www.ebi.ac.uk/intact/interactors/id:P40763*" }, { "database": "PubMed", "id": "7510216", "url": "https://pubmed.ncbi.nlm.nih.gov/7510216" }, { "database": "PubMed", "id": "8662591", "url": "https://pubmed.ncbi.nlm.nih.gov/8662591" }, { "database": "PubMed", "id": "10446219", "url": "https://pubmed.ncbi.nlm.nih.gov/10446219" }, { "database": "PubMed", "id": "10537060", "url": "https://pubmed.ncbi.nlm.nih.gov/10537060" }, { "database": "PubMed", "id": "10623619", "url": "https://pubmed.ncbi.nlm.nih.gov/10623619" }, { "database": "PubMed", "id": "10660304", "url": "https://pubmed.ncbi.nlm.nih.gov/10660304" }, { "database": "PubMed", "id": "10845908", "url": "https://pubmed.ncbi.nlm.nih.gov/10845908" }, { "database": "PubMed", "id": "11278353", "url": "https://pubmed.ncbi.nlm.nih.gov/11278353" }, { "database": "PubMed", "id": "11278729", "url": "https://pubmed.ncbi.nlm.nih.gov/11278729" }, { "database": "PubMed", "id": "11322950", "url": "https://pubmed.ncbi.nlm.nih.gov/11322950" }, { "database": "PubMed", "id": "11335711", "url": "https://pubmed.ncbi.nlm.nih.gov/11335711" }, { "database": "PubMed", "id": "11378264", "url": "https://pubmed.ncbi.nlm.nih.gov/11378264" }, { "database": "PubMed", "id": "11429693", "url": "https://pubmed.ncbi.nlm.nih.gov/11429693" }, { "database": "PubMed", "id": "11470914", "url": "https://pubmed.ncbi.nlm.nih.gov/11470914" }, { "database": "PubMed", "id": "11553624", "url": "https://pubmed.ncbi.nlm.nih.gov/11553624" }, { "database": "PubMed", "id": "11777539", "url": "https://pubmed.ncbi.nlm.nih.gov/11777539" }, { "database": "PubMed", "id": "12061840", "url": "https://pubmed.ncbi.nlm.nih.gov/12061840" }, { "database": "PubMed", "id": "12208879", "url": "https://pubmed.ncbi.nlm.nih.gov/12208879" }, { "database": "PubMed", "id": "12474230", "url": "https://pubmed.ncbi.nlm.nih.gov/12474230" }, { "database": "PubMed", "id": "12494267", "url": "https://pubmed.ncbi.nlm.nih.gov/12494267" }, { "database": "PubMed", "id": "12670499", "url": "https://pubmed.ncbi.nlm.nih.gov/12670499" }, { "database": "PubMed", "id": "12763138", "url": "https://pubmed.ncbi.nlm.nih.gov/12763138" }, { "database": "PubMed", "id": "12842895", "url": "https://pubmed.ncbi.nlm.nih.gov/12842895" }, { "database": "PubMed", "id": "13678425", "url": "https://pubmed.ncbi.nlm.nih.gov/13678425" }, { "database": "PubMed", "id": "14701810", "url": "https://pubmed.ncbi.nlm.nih.gov/14701810" }, { "database": "PubMed", "id": "14963038", "url": "https://pubmed.ncbi.nlm.nih.gov/14963038" }, { "database": "PubMed", "id": "14996842", "url": "https://pubmed.ncbi.nlm.nih.gov/14996842" }, { "database": "PubMed", "id": "14999683", "url": "https://pubmed.ncbi.nlm.nih.gov/14999683" }, { "database": "PubMed", "id": "15030166", "url": "https://pubmed.ncbi.nlm.nih.gov/15030166" }, { "database": "PubMed", "id": "15143062", "url": "https://pubmed.ncbi.nlm.nih.gov/15143062" }, { "database": "PubMed", "id": "15155836", "url": "https://pubmed.ncbi.nlm.nih.gov/15155836" }, { "database": "PubMed", "id": "15173005", "url": "https://pubmed.ncbi.nlm.nih.gov/15173005" }, { "database": "PubMed", "id": "15174071", "url": "https://pubmed.ncbi.nlm.nih.gov/15174071" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15527783", "url": "https://pubmed.ncbi.nlm.nih.gov/15527783" }, { "database": "PubMed", "id": "15705894", "url": "https://pubmed.ncbi.nlm.nih.gov/15705894" }, { "database": "PubMed", "id": "15753368", "url": "https://pubmed.ncbi.nlm.nih.gov/15753368" }, { "database": "PubMed", "id": "15864742", "url": "https://pubmed.ncbi.nlm.nih.gov/15864742" }, { "database": "PubMed", "id": "16048438", "url": "https://pubmed.ncbi.nlm.nih.gov/16048438" }, { "database": "PubMed", "id": "16081048", "url": "https://pubmed.ncbi.nlm.nih.gov/16081048" }, { "database": "PubMed", "id": "16150460", "url": "https://pubmed.ncbi.nlm.nih.gov/16150460" }, { "database": "PubMed", "id": "16247467", "url": "https://pubmed.ncbi.nlm.nih.gov/16247467" }, { "database": "PubMed", "id": "16288304", "url": "https://pubmed.ncbi.nlm.nih.gov/16288304" }, { "database": "PubMed", "id": "16384639", "url": "https://pubmed.ncbi.nlm.nih.gov/16384639" }, { "database": "PubMed", "id": "16401721", "url": "https://pubmed.ncbi.nlm.nih.gov/16401721" }, { "database": "PubMed", "id": "16413037", "url": "https://pubmed.ncbi.nlm.nih.gov/16413037" }, { "database": "PubMed", "id": "16427042", "url": "https://pubmed.ncbi.nlm.nih.gov/16427042" }, { "database": "PubMed", "id": "16455651", "url": "https://pubmed.ncbi.nlm.nih.gov/16455651" }, { "database": "PubMed", "id": "16463269", "url": "https://pubmed.ncbi.nlm.nih.gov/16463269" }, { "database": "PubMed", "id": "16603078", "url": "https://pubmed.ncbi.nlm.nih.gov/16603078" }, { "database": "PubMed", "id": "16613491", "url": "https://pubmed.ncbi.nlm.nih.gov/16613491" }, { "database": "PubMed", "id": "16619044", "url": "https://pubmed.ncbi.nlm.nih.gov/16619044" }, { "database": "PubMed", "id": "16651438", "url": "https://pubmed.ncbi.nlm.nih.gov/16651438" }, { "database": "PubMed", "id": "16669628", "url": "https://pubmed.ncbi.nlm.nih.gov/16669628" }, { "database": "PubMed", "id": "16801397", "url": "https://pubmed.ncbi.nlm.nih.gov/16801397" }, { "database": "PubMed", "id": "16846476", "url": "https://pubmed.ncbi.nlm.nih.gov/16846476" }, { "database": "PubMed", "id": "16849418", "url": "https://pubmed.ncbi.nlm.nih.gov/16849418" }, { "database": "PubMed", "id": "16951338", "url": "https://pubmed.ncbi.nlm.nih.gov/16951338" }, { "database": "PubMed", "id": "17008315", "url": "https://pubmed.ncbi.nlm.nih.gov/17008315" }, { "database": "PubMed", "id": "17173857", "url": "https://pubmed.ncbi.nlm.nih.gov/17173857" }, { "database": "PubMed", "id": "17176261", "url": "https://pubmed.ncbi.nlm.nih.gov/17176261" }, { "database": "PubMed", "id": "17202361", "url": "https://pubmed.ncbi.nlm.nih.gov/17202361" }, { "database": "PubMed", "id": "17204573", "url": "https://pubmed.ncbi.nlm.nih.gov/17204573" }, { "database": "PubMed", "id": "17237271", "url": "https://pubmed.ncbi.nlm.nih.gov/17237271" }, { "database": "PubMed", "id": "17311011", "url": "https://pubmed.ncbi.nlm.nih.gov/17311011" }, { "database": "PubMed", "id": "17341659", "url": "https://pubmed.ncbi.nlm.nih.gov/17341659" }, { "database": "PubMed", "id": "17432718", "url": "https://pubmed.ncbi.nlm.nih.gov/17432718" }, { "database": "PubMed", "id": "17543278", "url": "https://pubmed.ncbi.nlm.nih.gov/17543278" }, { "database": "PubMed", "id": "17575268", "url": "https://pubmed.ncbi.nlm.nih.gov/17575268" }, { "database": "PubMed", "id": "17586727", "url": "https://pubmed.ncbi.nlm.nih.gov/17586727" }, { "database": "PubMed", "id": "17616983", "url": "https://pubmed.ncbi.nlm.nih.gov/17616983" }, { "database": "PubMed", "id": "17670892", "url": "https://pubmed.ncbi.nlm.nih.gov/17670892" }, { "database": "PubMed", "id": "17761947", "url": "https://pubmed.ncbi.nlm.nih.gov/17761947" }, { "database": "PubMed", "id": "17931419", "url": "https://pubmed.ncbi.nlm.nih.gov/17931419" }, { "database": "PubMed", "id": "17967179", "url": "https://pubmed.ncbi.nlm.nih.gov/17967179" }, { "database": "PubMed", "id": "18196976", "url": "https://pubmed.ncbi.nlm.nih.gov/18196976" }, { "database": "PubMed", "id": "18198175", "url": "https://pubmed.ncbi.nlm.nih.gov/18198175" }, { "database": "PubMed", "id": "18203738", "url": "https://pubmed.ncbi.nlm.nih.gov/18203738" }, { "database": "PubMed", "id": "18204781", "url": "https://pubmed.ncbi.nlm.nih.gov/18204781" }, { "database": "PubMed", "id": "18353781", "url": "https://pubmed.ncbi.nlm.nih.gov/18353781" }, { "database": "PubMed", "id": "18365011", "url": "https://pubmed.ncbi.nlm.nih.gov/18365011" }, { "database": "PubMed", "id": "18463684", "url": "https://pubmed.ncbi.nlm.nih.gov/18463684" }, { "database": "PubMed", "id": "18498667", "url": "https://pubmed.ncbi.nlm.nih.gov/18498667" }, { "database": "PubMed", "id": "18519681", "url": "https://pubmed.ncbi.nlm.nih.gov/18519681" }, { "database": "PubMed", "id": "18525315", "url": "https://pubmed.ncbi.nlm.nih.gov/18525315" }, { "database": "PubMed", "id": "18544087", "url": "https://pubmed.ncbi.nlm.nih.gov/18544087" }, { "database": "PubMed", "id": "18550668", "url": "https://pubmed.ncbi.nlm.nih.gov/18550668" }, { "database": "PubMed", "id": "18593565", "url": "https://pubmed.ncbi.nlm.nih.gov/18593565" }, { "database": "PubMed", "id": "18612371", "url": "https://pubmed.ncbi.nlm.nih.gov/18612371" }, { "database": "PubMed", "id": "18755267", "url": "https://pubmed.ncbi.nlm.nih.gov/18755267" }, { "database": "PubMed", "id": "18755494", "url": "https://pubmed.ncbi.nlm.nih.gov/18755494" }, { "database": "PubMed", "id": "18779368", "url": "https://pubmed.ncbi.nlm.nih.gov/18779368" }, { "database": "PubMed", "id": "18790750", "url": "https://pubmed.ncbi.nlm.nih.gov/18790750" }, { "database": "PubMed", "id": "18939995", "url": "https://pubmed.ncbi.nlm.nih.gov/18939995" }, { "database": "PubMed", "id": "18941632", "url": "https://pubmed.ncbi.nlm.nih.gov/18941632" }, { "database": "PubMed", "id": "18995957", "url": "https://pubmed.ncbi.nlm.nih.gov/18995957" }, { "database": "PubMed", "id": "19001435", "url": "https://pubmed.ncbi.nlm.nih.gov/19001435" }, { "database": "PubMed", "id": "19025606", "url": "https://pubmed.ncbi.nlm.nih.gov/19025606" }, { "database": "PubMed", "id": "19118003", "url": "https://pubmed.ncbi.nlm.nih.gov/19118003" }, { "database": "PubMed", "id": "19182994", "url": "https://pubmed.ncbi.nlm.nih.gov/19182994" }, { "database": "PubMed", "id": "19201396", "url": "https://pubmed.ncbi.nlm.nih.gov/19201396" }, { "database": "PubMed", "id": "19232485", "url": "https://pubmed.ncbi.nlm.nih.gov/19232485" }, { "database": "PubMed", "id": "19351839", "url": "https://pubmed.ncbi.nlm.nih.gov/19351839" }, { "database": "PubMed", "id": "19421230", "url": "https://pubmed.ncbi.nlm.nih.gov/19421230" }, { "database": "PubMed", "id": "19440292", "url": "https://pubmed.ncbi.nlm.nih.gov/19440292" }, { "database": "PubMed", "id": "19506034", "url": "https://pubmed.ncbi.nlm.nih.gov/19506034" }, { "database": "PubMed", "id": "19595669", "url": "https://pubmed.ncbi.nlm.nih.gov/19595669" }, { "database": "PubMed", "id": "19623660", "url": "https://pubmed.ncbi.nlm.nih.gov/19623660" }, { "database": "PubMed", "id": "19712481", "url": "https://pubmed.ncbi.nlm.nih.gov/19712481" }, { "database": "PubMed", "id": "19723038", "url": "https://pubmed.ncbi.nlm.nih.gov/19723038" }, { "database": "PubMed", "id": "19741197", "url": "https://pubmed.ncbi.nlm.nih.gov/19741197" }, { "database": "PubMed", "id": "19744341", "url": "https://pubmed.ncbi.nlm.nih.gov/19744341" }, { "database": "PubMed", "id": "19754877", "url": "https://pubmed.ncbi.nlm.nih.gov/19754877" }, { "database": "PubMed", "id": "19764570", "url": "https://pubmed.ncbi.nlm.nih.gov/19764570" }, { "database": "PubMed", "id": "19808903", "url": "https://pubmed.ncbi.nlm.nih.gov/19808903" }, { "database": "PubMed", "id": "19821497", "url": "https://pubmed.ncbi.nlm.nih.gov/19821497" }, { "database": "PubMed", "id": "19901082", "url": "https://pubmed.ncbi.nlm.nih.gov/19901082" }, { "database": "PubMed", "id": "19903761", "url": "https://pubmed.ncbi.nlm.nih.gov/19903761" }, { "database": "PubMed", "id": "19903771", "url": "https://pubmed.ncbi.nlm.nih.gov/19903771" }, { "database": "PubMed", "id": "19995546", "url": "https://pubmed.ncbi.nlm.nih.gov/19995546" }, { "database": "PubMed", "id": "20072652", "url": "https://pubmed.ncbi.nlm.nih.gov/20072652" }, { "database": "PubMed", "id": "20156552", "url": "https://pubmed.ncbi.nlm.nih.gov/20156552" }, { "database": "PubMed", "id": "20169197", "url": "https://pubmed.ncbi.nlm.nih.gov/20169197" }, { "database": "PubMed", "id": "20228845", "url": "https://pubmed.ncbi.nlm.nih.gov/20228845" }, { "database": "PubMed", "id": "20233902", "url": "https://pubmed.ncbi.nlm.nih.gov/20233902" }, { "database": "PubMed", "id": "20351777", "url": "https://pubmed.ncbi.nlm.nih.gov/20351777" }, { "database": "PubMed", "id": "20371721", "url": "https://pubmed.ncbi.nlm.nih.gov/20371721" }, { "database": "PubMed", "id": "20455003", "url": "https://pubmed.ncbi.nlm.nih.gov/20455003" }, { "database": "PubMed", "id": "20507639", "url": "https://pubmed.ncbi.nlm.nih.gov/20507639" }, { "database": "PubMed", "id": "20534983", "url": "https://pubmed.ncbi.nlm.nih.gov/20534983" }, { "database": "PubMed", "id": "20576164", "url": "https://pubmed.ncbi.nlm.nih.gov/20576164" }, { "database": "PubMed", "id": "20589525", "url": "https://pubmed.ncbi.nlm.nih.gov/20589525" }, { "database": "PubMed", "id": "20712901", "url": "https://pubmed.ncbi.nlm.nih.gov/20712901" }, { "database": "PubMed", "id": "20724373", "url": "https://pubmed.ncbi.nlm.nih.gov/20724373" }, { "database": "PubMed", "id": "20808823", "url": "https://pubmed.ncbi.nlm.nih.gov/20808823" }, { "database": "PubMed", "id": "20840775", "url": "https://pubmed.ncbi.nlm.nih.gov/20840775" }, { "database": "PubMed", "id": "20851386", "url": "https://pubmed.ncbi.nlm.nih.gov/20851386" }, { "database": "PubMed", "id": "20877211", "url": "https://pubmed.ncbi.nlm.nih.gov/20877211" }, { "database": "PubMed", "id": "20959517", "url": "https://pubmed.ncbi.nlm.nih.gov/20959517" }, { "database": "PubMed", "id": "20977777", "url": "https://pubmed.ncbi.nlm.nih.gov/20977777" }, { "database": "PubMed", "id": "21098725", "url": "https://pubmed.ncbi.nlm.nih.gov/21098725" }, { "database": "PubMed", "id": "21122157", "url": "https://pubmed.ncbi.nlm.nih.gov/21122157" }, { "database": "PubMed", "id": "21163886", "url": "https://pubmed.ncbi.nlm.nih.gov/21163886" }, { "database": "PubMed", "id": "21253577", "url": "https://pubmed.ncbi.nlm.nih.gov/21253577" }, { "database": "PubMed", "id": "21254404", "url": "https://pubmed.ncbi.nlm.nih.gov/21254404" }, { "database": "PubMed", "id": "21311975", "url": "https://pubmed.ncbi.nlm.nih.gov/21311975" }, { "database": "PubMed", "id": "21360612", "url": "https://pubmed.ncbi.nlm.nih.gov/21360612" }, { "database": "PubMed", "id": "21369699", "url": "https://pubmed.ncbi.nlm.nih.gov/21369699" }, { "database": "PubMed", "id": "21388555", "url": "https://pubmed.ncbi.nlm.nih.gov/21388555" }, { "database": "PubMed", "id": "21435102", "url": "https://pubmed.ncbi.nlm.nih.gov/21435102" }, { "database": "PubMed", "id": "21443800", "url": "https://pubmed.ncbi.nlm.nih.gov/21443800" }, { "database": "PubMed", "id": "21486470", "url": "https://pubmed.ncbi.nlm.nih.gov/21486470" }, { "database": "PubMed", "id": "21490133", "url": "https://pubmed.ncbi.nlm.nih.gov/21490133" }, { "database": "PubMed", "id": "21524651", "url": "https://pubmed.ncbi.nlm.nih.gov/21524651" }, { "database": "PubMed", "id": "21526200", "url": "https://pubmed.ncbi.nlm.nih.gov/21526200" }, { "database": "PubMed", "id": "21538419", "url": "https://pubmed.ncbi.nlm.nih.gov/21538419" }, { "database": "PubMed", "id": "21625473", "url": "https://pubmed.ncbi.nlm.nih.gov/21625473" }, { "database": "PubMed", "id": "21625522", "url": "https://pubmed.ncbi.nlm.nih.gov/21625522" }, { "database": "PubMed", "id": "21625597", "url": "https://pubmed.ncbi.nlm.nih.gov/21625597" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21655185", "url": "https://pubmed.ncbi.nlm.nih.gov/21655185" }, { "database": "PubMed", "id": "21677772", "url": "https://pubmed.ncbi.nlm.nih.gov/21677772" }, { "database": "PubMed", "id": "21685938", "url": "https://pubmed.ncbi.nlm.nih.gov/21685938" }, { "database": "PubMed", "id": "21689417", "url": "https://pubmed.ncbi.nlm.nih.gov/21689417" }, { "database": "PubMed", "id": "21690253", "url": "https://pubmed.ncbi.nlm.nih.gov/21690253" }, { "database": "PubMed", "id": "21694723", "url": "https://pubmed.ncbi.nlm.nih.gov/21694723" }, { "database": "PubMed", "id": "21730976", "url": "https://pubmed.ncbi.nlm.nih.gov/21730976" }, { "database": "PubMed", "id": "21738667", "url": "https://pubmed.ncbi.nlm.nih.gov/21738667" }, { "database": "PubMed", "id": "21785467", "url": "https://pubmed.ncbi.nlm.nih.gov/21785467" }, { "database": "PubMed", "id": "21799891", "url": "https://pubmed.ncbi.nlm.nih.gov/21799891" }, { "database": "PubMed", "id": "21801384", "url": "https://pubmed.ncbi.nlm.nih.gov/21801384" }, { "database": "PubMed", "id": "21840932", "url": "https://pubmed.ncbi.nlm.nih.gov/21840932" }, { "database": "PubMed", "id": "21906308", "url": "https://pubmed.ncbi.nlm.nih.gov/21906308" }, { "database": "PubMed", "id": "21915376", "url": "https://pubmed.ncbi.nlm.nih.gov/21915376" }, { "database": "PubMed", "id": "21931595", "url": "https://pubmed.ncbi.nlm.nih.gov/21931595" }, { "database": "PubMed", "id": "21954831", "url": "https://pubmed.ncbi.nlm.nih.gov/21954831" }, { "database": "PubMed", "id": "22016776", "url": "https://pubmed.ncbi.nlm.nih.gov/22016776" }, { "database": "PubMed", "id": "22110204", "url": "https://pubmed.ncbi.nlm.nih.gov/22110204" }, { "database": "PubMed", "id": "22142222", "url": "https://pubmed.ncbi.nlm.nih.gov/22142222" }, { "database": "PubMed", "id": "22174695", "url": "https://pubmed.ncbi.nlm.nih.gov/22174695" }, { "database": "PubMed", "id": "22174819", "url": "https://pubmed.ncbi.nlm.nih.gov/22174819" }, { "database": "PubMed", "id": "22179221", "url": "https://pubmed.ncbi.nlm.nih.gov/22179221" }, { "database": "PubMed", "id": "22210382", "url": "https://pubmed.ncbi.nlm.nih.gov/22210382" }, { "database": "PubMed", "id": "22259633", "url": "https://pubmed.ncbi.nlm.nih.gov/22259633" }, { "database": "PubMed", "id": "22279540", "url": "https://pubmed.ncbi.nlm.nih.gov/22279540" }, { "database": "PubMed", "id": "22280969", "url": "https://pubmed.ncbi.nlm.nih.gov/22280969" }, { "database": "PubMed", "id": "22313388", "url": "https://pubmed.ncbi.nlm.nih.gov/22313388" }, { "database": "PubMed", "id": "22315522", "url": "https://pubmed.ncbi.nlm.nih.gov/22315522" }, { "database": "PubMed", "id": "22349830", "url": "https://pubmed.ncbi.nlm.nih.gov/22349830" }, { "database": "PubMed", "id": "22351606", "url": "https://pubmed.ncbi.nlm.nih.gov/22351606" }, { "database": "PubMed", "id": "22359610", "url": "https://pubmed.ncbi.nlm.nih.gov/22359610" }, { "database": "PubMed", "id": "22366233", "url": "https://pubmed.ncbi.nlm.nih.gov/22366233" }, { "database": "PubMed", "id": "22370645", "url": "https://pubmed.ncbi.nlm.nih.gov/22370645" }, { "database": "PubMed", "id": "22374428", "url": "https://pubmed.ncbi.nlm.nih.gov/22374428" }, { "database": "PubMed", "id": "22406995", "url": "https://pubmed.ncbi.nlm.nih.gov/22406995" }, { "database": "PubMed", "id": "22418867", "url": "https://pubmed.ncbi.nlm.nih.gov/22418867" }, { "database": "PubMed", "id": "22450744", "url": "https://pubmed.ncbi.nlm.nih.gov/22450744" }, { "database": "PubMed", "id": "22461519", "url": "https://pubmed.ncbi.nlm.nih.gov/22461519" }, { "database": "PubMed", "id": "22465052", "url": "https://pubmed.ncbi.nlm.nih.gov/22465052" }, { "database": "PubMed", "id": "22484976", "url": "https://pubmed.ncbi.nlm.nih.gov/22484976" }, { "database": "PubMed", "id": "22504904", "url": "https://pubmed.ncbi.nlm.nih.gov/22504904" }, { "database": "PubMed", "id": "22522613", "url": "https://pubmed.ncbi.nlm.nih.gov/22522613" }, { "database": "PubMed", "id": "22581261", "url": "https://pubmed.ncbi.nlm.nih.gov/22581261" }, { "database": "PubMed", "id": "22642622", "url": "https://pubmed.ncbi.nlm.nih.gov/22642622" }, { "database": "PubMed", "id": "22677902", "url": "https://pubmed.ncbi.nlm.nih.gov/22677902" }, { "database": "PubMed", "id": "22754353", "url": "https://pubmed.ncbi.nlm.nih.gov/22754353" }, { "database": "PubMed", "id": "22799634", "url": "https://pubmed.ncbi.nlm.nih.gov/22799634" }, { "database": "PubMed", "id": "22801507", "url": "https://pubmed.ncbi.nlm.nih.gov/22801507" }, { "database": "PubMed", "id": "22824293", "url": "https://pubmed.ncbi.nlm.nih.gov/22824293" }, { "database": "PubMed", "id": "22829072", "url": "https://pubmed.ncbi.nlm.nih.gov/22829072" }, { "database": "PubMed", "id": "22870139", "url": "https://pubmed.ncbi.nlm.nih.gov/22870139" }, { "database": "PubMed", "id": "22899991", "url": "https://pubmed.ncbi.nlm.nih.gov/22899991" }, { "database": "PubMed", "id": "22905257", "url": "https://pubmed.ncbi.nlm.nih.gov/22905257" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22922995", "url": "https://pubmed.ncbi.nlm.nih.gov/22922995" }, { "database": "PubMed", "id": "22937084", "url": "https://pubmed.ncbi.nlm.nih.gov/22937084" }, { "database": "PubMed", "id": "22978563", "url": "https://pubmed.ncbi.nlm.nih.gov/22978563" }, { "database": "PubMed", "id": "22984561", "url": "https://pubmed.ncbi.nlm.nih.gov/22984561" }, { "database": "PubMed", "id": "22987802", "url": "https://pubmed.ncbi.nlm.nih.gov/22987802" }, { "database": "PubMed", "id": "23007731", "url": "https://pubmed.ncbi.nlm.nih.gov/23007731" }, { "database": "PubMed", "id": "23056374", "url": "https://pubmed.ncbi.nlm.nih.gov/23056374" }, { "database": "PubMed", "id": "23056515", "url": "https://pubmed.ncbi.nlm.nih.gov/23056515" }, { "database": "PubMed", "id": "23074171", "url": "https://pubmed.ncbi.nlm.nih.gov/23074171" }, { "database": "PubMed", "id": "23094050", "url": "https://pubmed.ncbi.nlm.nih.gov/23094050" }, { "database": "PubMed", "id": "23108098", "url": "https://pubmed.ncbi.nlm.nih.gov/23108098" }, { "database": "PubMed", "id": "23125416", "url": "https://pubmed.ncbi.nlm.nih.gov/23125416" }, { "database": "PubMed", "id": "23166634", "url": "https://pubmed.ncbi.nlm.nih.gov/23166634" }, { "database": "PubMed", "id": "23189171", "url": "https://pubmed.ncbi.nlm.nih.gov/23189171" }, { "database": "PubMed", "id": "23226414", "url": "https://pubmed.ncbi.nlm.nih.gov/23226414" }, { "database": "PubMed", "id": "23251493", "url": "https://pubmed.ncbi.nlm.nih.gov/23251493" }, { "database": "PubMed", "id": "23279849", "url": "https://pubmed.ncbi.nlm.nih.gov/23279849" }, { "database": "PubMed", "id": "23303450", "url": "https://pubmed.ncbi.nlm.nih.gov/23303450" }, { "database": "PubMed", "id": "23318430", "url": "https://pubmed.ncbi.nlm.nih.gov/23318430" }, { "database": "PubMed", "id": "23322008", "url": "https://pubmed.ncbi.nlm.nih.gov/23322008" }, { "database": "PubMed", "id": "23326583", "url": "https://pubmed.ncbi.nlm.nih.gov/23326583" }, { "database": "PubMed", "id": "23350355", "url": "https://pubmed.ncbi.nlm.nih.gov/23350355" }, { "database": "PubMed", "id": "23372833", "url": "https://pubmed.ncbi.nlm.nih.gov/23372833" }, { "database": "PubMed", "id": "23382914", "url": "https://pubmed.ncbi.nlm.nih.gov/23382914" }, { "database": "PubMed", "id": "23416975", "url": "https://pubmed.ncbi.nlm.nih.gov/23416975" }, { "database": "PubMed", "id": "23434226", "url": "https://pubmed.ncbi.nlm.nih.gov/23434226" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23446809", "url": "https://pubmed.ncbi.nlm.nih.gov/23446809" }, { "database": "PubMed", "id": "23455323", "url": "https://pubmed.ncbi.nlm.nih.gov/23455323" }, { "database": "PubMed", "id": "23496892", "url": "https://pubmed.ncbi.nlm.nih.gov/23496892" }, { "database": "PubMed", "id": "23525442", "url": "https://pubmed.ncbi.nlm.nih.gov/23525442" }, { "database": "PubMed", "id": "23528817", "url": "https://pubmed.ncbi.nlm.nih.gov/23528817" }, { "database": "PubMed", "id": "23614738", "url": "https://pubmed.ncbi.nlm.nih.gov/23614738" }, { "database": "PubMed", "id": "23637829", "url": "https://pubmed.ncbi.nlm.nih.gov/23637829" }, { "database": "PubMed", "id": "23686305", "url": "https://pubmed.ncbi.nlm.nih.gov/23686305" }, { "database": "PubMed", "id": "23686482", "url": "https://pubmed.ncbi.nlm.nih.gov/23686482" }, { "database": "PubMed", "id": "23690956", "url": "https://pubmed.ncbi.nlm.nih.gov/23690956" }, { "database": "PubMed", "id": "23704931", "url": "https://pubmed.ncbi.nlm.nih.gov/23704931" }, { "database": "PubMed", "id": "23740516", "url": "https://pubmed.ncbi.nlm.nih.gov/23740516" }, { "database": "PubMed", "id": "23755918", "url": "https://pubmed.ncbi.nlm.nih.gov/23755918" }, { "database": "PubMed", "id": "23756865", "url": "https://pubmed.ncbi.nlm.nih.gov/23756865" }, { "database": "PubMed", "id": "23774064", "url": "https://pubmed.ncbi.nlm.nih.gov/23774064" }, { "database": "PubMed", "id": "23776396", "url": "https://pubmed.ncbi.nlm.nih.gov/23776396" }, { "database": "PubMed", "id": "23782265", "url": "https://pubmed.ncbi.nlm.nih.gov/23782265" }, { "database": "PubMed", "id": "23831387", "url": "https://pubmed.ncbi.nlm.nih.gov/23831387" }, { "database": "PubMed", "id": "23861822", "url": "https://pubmed.ncbi.nlm.nih.gov/23861822" }, { "database": "PubMed", "id": "23872421", "url": "https://pubmed.ncbi.nlm.nih.gov/23872421" }, { "database": "PubMed", "id": "23874455", "url": "https://pubmed.ncbi.nlm.nih.gov/23874455" }, { "database": "PubMed", "id": "23889739", "url": "https://pubmed.ncbi.nlm.nih.gov/23889739" }, { "database": "PubMed", "id": "23894143", "url": "https://pubmed.ncbi.nlm.nih.gov/23894143" }, { "database": "PubMed", "id": "23903834", "url": "https://pubmed.ncbi.nlm.nih.gov/23903834" }, { "database": "PubMed", "id": "23923048", "url": "https://pubmed.ncbi.nlm.nih.gov/23923048" }, { "database": "PubMed", "id": "23928694", "url": "https://pubmed.ncbi.nlm.nih.gov/23928694" }, { "database": "PubMed", "id": "23936533", "url": "https://pubmed.ncbi.nlm.nih.gov/23936533" }, { "database": "PubMed", "id": "23947369", "url": "https://pubmed.ncbi.nlm.nih.gov/23947369" }, { "database": "PubMed", "id": "23967200", "url": "https://pubmed.ncbi.nlm.nih.gov/23967200" }, { "database": "PubMed", "id": "23991099", "url": "https://pubmed.ncbi.nlm.nih.gov/23991099" }, { "database": "PubMed", "id": "24015205", "url": "https://pubmed.ncbi.nlm.nih.gov/24015205" }, { "database": "PubMed", "id": "24019973", "url": "https://pubmed.ncbi.nlm.nih.gov/24019973" }, { "database": "PubMed", "id": "24043762", "url": "https://pubmed.ncbi.nlm.nih.gov/24043762" }, { "database": "PubMed", "id": "24048798", "url": "https://pubmed.ncbi.nlm.nih.gov/24048798" }, { "database": "PubMed", "id": "24058749", "url": "https://pubmed.ncbi.nlm.nih.gov/24058749" }, { "database": "PubMed", "id": "24058783", "url": "https://pubmed.ncbi.nlm.nih.gov/24058783" }, { "database": "PubMed", "id": "24063605", "url": "https://pubmed.ncbi.nlm.nih.gov/24063605" }, { "database": "PubMed", "id": "24069562", "url": "https://pubmed.ncbi.nlm.nih.gov/24069562" }, { "database": "PubMed", "id": "24086526", "url": "https://pubmed.ncbi.nlm.nih.gov/24086526" }, { "database": "PubMed", "id": "24090995", "url": "https://pubmed.ncbi.nlm.nih.gov/24090995" }, { "database": "PubMed", "id": "24098663", "url": "https://pubmed.ncbi.nlm.nih.gov/24098663" }, { "database": "PubMed", "id": "24129709", "url": "https://pubmed.ncbi.nlm.nih.gov/24129709" }, { "database": "PubMed", "id": "24154873", "url": "https://pubmed.ncbi.nlm.nih.gov/24154873" }, { "database": "PubMed", "id": "24164699", "url": "https://pubmed.ncbi.nlm.nih.gov/24164699" }, { "database": "PubMed", "id": "24165129", "url": "https://pubmed.ncbi.nlm.nih.gov/24165129" }, { "database": "PubMed", "id": "24192293", "url": "https://pubmed.ncbi.nlm.nih.gov/24192293" }, { "database": "PubMed", "id": "24280348", "url": "https://pubmed.ncbi.nlm.nih.gov/24280348" }, { "database": "PubMed", "id": "24288470", "url": "https://pubmed.ncbi.nlm.nih.gov/24288470" }, { "database": "PubMed", "id": "24312439", "url": "https://pubmed.ncbi.nlm.nih.gov/24312439" }, { "database": "PubMed", "id": "24314214", "url": "https://pubmed.ncbi.nlm.nih.gov/24314214" }, { "database": "PubMed", "id": "24317090", "url": "https://pubmed.ncbi.nlm.nih.gov/24317090" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24324713", "url": "https://pubmed.ncbi.nlm.nih.gov/24324713" }, { "database": "PubMed", "id": "24348829", "url": "https://pubmed.ncbi.nlm.nih.gov/24348829" }, { "database": "PubMed", "id": "24418169", "url": "https://pubmed.ncbi.nlm.nih.gov/24418169" }, { "database": "PubMed", "id": "24423131", "url": "https://pubmed.ncbi.nlm.nih.gov/24423131" }, { "database": "PubMed", "id": "24499623", "url": "https://pubmed.ncbi.nlm.nih.gov/24499623" }, { "database": "PubMed", "id": "24505404", "url": "https://pubmed.ncbi.nlm.nih.gov/24505404" }, { "database": "PubMed", "id": "24520293", "url": "https://pubmed.ncbi.nlm.nih.gov/24520293" }, { "database": "PubMed", "id": "24533098", "url": "https://pubmed.ncbi.nlm.nih.gov/24533098" }, { "database": "PubMed", "id": "24586249", "url": "https://pubmed.ncbi.nlm.nih.gov/24586249" }, { "database": "PubMed", "id": "24602263", "url": "https://pubmed.ncbi.nlm.nih.gov/24602263" }, { "database": "PubMed", "id": "24615012", "url": "https://pubmed.ncbi.nlm.nih.gov/24615012" }, { "database": "PubMed", "id": "24622734", "url": "https://pubmed.ncbi.nlm.nih.gov/24622734" }, { "database": "PubMed", "id": "24652192", "url": "https://pubmed.ncbi.nlm.nih.gov/24652192" }, { "database": "PubMed", "id": "24661007", "url": "https://pubmed.ncbi.nlm.nih.gov/24661007" }, { "database": "PubMed", "id": "24671465", "url": "https://pubmed.ncbi.nlm.nih.gov/24671465" }, { "database": "PubMed", "id": "24671708", "url": "https://pubmed.ncbi.nlm.nih.gov/24671708" }, { "database": "PubMed", "id": "24687132", "url": "https://pubmed.ncbi.nlm.nih.gov/24687132" }, { "database": "PubMed", "id": "24707243", "url": "https://pubmed.ncbi.nlm.nih.gov/24707243" }, { "database": "PubMed", "id": "24726840", "url": "https://pubmed.ncbi.nlm.nih.gov/24726840" }, { "database": "PubMed", "id": "24736071", "url": "https://pubmed.ncbi.nlm.nih.gov/24736071" }, { "database": "PubMed", "id": "24756126", "url": "https://pubmed.ncbi.nlm.nih.gov/24756126" }, { "database": "PubMed", "id": "24799285", "url": "https://pubmed.ncbi.nlm.nih.gov/24799285" }, { "database": "PubMed", "id": "24846175", "url": "https://pubmed.ncbi.nlm.nih.gov/24846175" }, { "database": "PubMed", "id": "24855827", "url": "https://pubmed.ncbi.nlm.nih.gov/24855827" }, { "database": "PubMed", "id": "24909826", "url": "https://pubmed.ncbi.nlm.nih.gov/24909826" }, { "database": "PubMed", "id": "24930769", "url": "https://pubmed.ncbi.nlm.nih.gov/24930769" }, { "database": "PubMed", "id": "24931163", "url": "https://pubmed.ncbi.nlm.nih.gov/24931163" }, { "database": "PubMed", "id": "24932134", "url": "https://pubmed.ncbi.nlm.nih.gov/24932134" }, { "database": "PubMed", "id": "24945434", "url": "https://pubmed.ncbi.nlm.nih.gov/24945434" }, { "database": "PubMed", "id": "24953430", "url": "https://pubmed.ncbi.nlm.nih.gov/24953430" }, { "database": "PubMed", "id": "24954857", "url": "https://pubmed.ncbi.nlm.nih.gov/24954857" }, { "database": "PubMed", "id": "24970801", "url": "https://pubmed.ncbi.nlm.nih.gov/24970801" }, { "database": "PubMed", "id": "24978112", "url": "https://pubmed.ncbi.nlm.nih.gov/24978112" }, { "database": "PubMed", "id": "25013907", "url": "https://pubmed.ncbi.nlm.nih.gov/25013907" }, { "database": "PubMed", "id": "25016575", "url": "https://pubmed.ncbi.nlm.nih.gov/25016575" }, { "database": "PubMed", "id": "25031733", "url": "https://pubmed.ncbi.nlm.nih.gov/25031733" }, { "database": "PubMed", "id": "25036749", "url": "https://pubmed.ncbi.nlm.nih.gov/25036749" }, { "database": "PubMed", "id": "25040935", "url": "https://pubmed.ncbi.nlm.nih.gov/25040935" }, { "database": "PubMed", "id": "25047660", "url": "https://pubmed.ncbi.nlm.nih.gov/25047660" }, { "database": "PubMed", "id": "25071018", "url": "https://pubmed.ncbi.nlm.nih.gov/25071018" }, { "database": "PubMed", "id": "25072782", "url": "https://pubmed.ncbi.nlm.nih.gov/25072782" }, { "database": "PubMed", "id": "25101566", "url": "https://pubmed.ncbi.nlm.nih.gov/25101566" }, { "database": "PubMed", "id": "25116684", "url": "https://pubmed.ncbi.nlm.nih.gov/25116684" }, { "database": "PubMed", "id": "25200966", "url": "https://pubmed.ncbi.nlm.nih.gov/25200966" }, { "database": "PubMed", "id": "25216529", "url": "https://pubmed.ncbi.nlm.nih.gov/25216529" }, { "database": "PubMed", "id": "25217633", "url": "https://pubmed.ncbi.nlm.nih.gov/25217633" }, { "database": "PubMed", "id": "25226283", "url": "https://pubmed.ncbi.nlm.nih.gov/25226283" }, { "database": "PubMed", "id": "25231320", "url": "https://pubmed.ncbi.nlm.nih.gov/25231320" }, { "database": "PubMed", "id": "25246098", "url": "https://pubmed.ncbi.nlm.nih.gov/25246098" }, { "database": "PubMed", "id": "25252914", "url": "https://pubmed.ncbi.nlm.nih.gov/25252914" }, { "database": "PubMed", "id": "25266665", "url": "https://pubmed.ncbi.nlm.nih.gov/25266665" }, { "database": "PubMed", "id": "25296502", "url": "https://pubmed.ncbi.nlm.nih.gov/25296502" }, { "database": "PubMed", "id": "25299776", "url": "https://pubmed.ncbi.nlm.nih.gov/25299776" }, { "database": "PubMed", "id": "25327561", "url": "https://pubmed.ncbi.nlm.nih.gov/25327561" }, { "database": "PubMed", "id": "25360179", "url": "https://pubmed.ncbi.nlm.nih.gov/25360179" }, { "database": "PubMed", "id": "25373509", "url": "https://pubmed.ncbi.nlm.nih.gov/25373509" }, { "database": "PubMed", "id": "25383546", "url": "https://pubmed.ncbi.nlm.nih.gov/25383546" }, { "database": "PubMed", "id": "25393367", "url": "https://pubmed.ncbi.nlm.nih.gov/25393367" }, { "database": "PubMed", "id": "25401333", "url": "https://pubmed.ncbi.nlm.nih.gov/25401333" }, { "database": "PubMed", "id": "25417721", "url": "https://pubmed.ncbi.nlm.nih.gov/25417721" }, { "database": "PubMed", "id": "25452693", "url": "https://pubmed.ncbi.nlm.nih.gov/25452693" }, { "database": "PubMed", "id": "25476455", "url": "https://pubmed.ncbi.nlm.nih.gov/25476455" }, { "database": "PubMed", "id": "25486864", "url": "https://pubmed.ncbi.nlm.nih.gov/25486864" }, { "database": "PubMed", "id": "25512602", "url": "https://pubmed.ncbi.nlm.nih.gov/25512602" }, { "database": "PubMed", "id": "25539644", "url": "https://pubmed.ncbi.nlm.nih.gov/25539644" }, { "database": "PubMed", "id": "25544757", "url": "https://pubmed.ncbi.nlm.nih.gov/25544757" }, { "database": "PubMed", "id": "25548514", "url": "https://pubmed.ncbi.nlm.nih.gov/25548514" }, { "database": "PubMed", "id": "25561562", "url": "https://pubmed.ncbi.nlm.nih.gov/25561562" }, { "database": "PubMed", "id": "25584415", "url": "https://pubmed.ncbi.nlm.nih.gov/25584415" }, { "database": "PubMed", "id": "25594014", "url": "https://pubmed.ncbi.nlm.nih.gov/25594014" }, { "database": "PubMed", "id": "25597412", "url": "https://pubmed.ncbi.nlm.nih.gov/25597412" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25612622", "url": "https://pubmed.ncbi.nlm.nih.gov/25612622" }, { "database": "PubMed", "id": "25622587", "url": "https://pubmed.ncbi.nlm.nih.gov/25622587" }, { "database": "PubMed", "id": "25661370", "url": "https://pubmed.ncbi.nlm.nih.gov/25661370" }, { "database": "PubMed", "id": "25684140", "url": "https://pubmed.ncbi.nlm.nih.gov/25684140" }, { "database": "PubMed", "id": "25687700", "url": "https://pubmed.ncbi.nlm.nih.gov/25687700" }, { "database": "PubMed", "id": "25699542", "url": "https://pubmed.ncbi.nlm.nih.gov/25699542" }, { "database": "PubMed", "id": "25734337", "url": "https://pubmed.ncbi.nlm.nih.gov/25734337" }, { "database": "PubMed", "id": "25736961", "url": "https://pubmed.ncbi.nlm.nih.gov/25736961" }, { "database": "PubMed", "id": "25744297", "url": "https://pubmed.ncbi.nlm.nih.gov/25744297" }, { "database": "PubMed", "id": "25750173", "url": "https://pubmed.ncbi.nlm.nih.gov/25750173" }, { "database": "PubMed", "id": "25789077", "url": "https://pubmed.ncbi.nlm.nih.gov/25789077" }, { "database": "PubMed", "id": "25793261", "url": "https://pubmed.ncbi.nlm.nih.gov/25793261" }, { "database": "PubMed", "id": "25811798", "url": "https://pubmed.ncbi.nlm.nih.gov/25811798" }, { "database": "PubMed", "id": "25843671", "url": "https://pubmed.ncbi.nlm.nih.gov/25843671" }, { "database": "PubMed", "id": "25849286", "url": "https://pubmed.ncbi.nlm.nih.gov/25849286" }, { "database": "PubMed", "id": "25869100", "url": "https://pubmed.ncbi.nlm.nih.gov/25869100" }, { "database": "PubMed", "id": "25879763", "url": "https://pubmed.ncbi.nlm.nih.gov/25879763" }, { "database": "PubMed", "id": "25881314", "url": "https://pubmed.ncbi.nlm.nih.gov/25881314" }, { "database": "PubMed", "id": "25883212", "url": "https://pubmed.ncbi.nlm.nih.gov/25883212" }, { "database": "PubMed", "id": "25915430", "url": "https://pubmed.ncbi.nlm.nih.gov/25915430" }, { "database": "PubMed", "id": "25928665", "url": "https://pubmed.ncbi.nlm.nih.gov/25928665" }, { "database": "PubMed", "id": "25947346", "url": "https://pubmed.ncbi.nlm.nih.gov/25947346" }, { "database": "PubMed", "id": "25961376", "url": "https://pubmed.ncbi.nlm.nih.gov/25961376" }, { "database": "PubMed", "id": "25968054", "url": "https://pubmed.ncbi.nlm.nih.gov/25968054" }, { "database": "PubMed", "id": "25984943", "url": "https://pubmed.ncbi.nlm.nih.gov/25984943" }, { "database": "PubMed", "id": "26008966", "url": "https://pubmed.ncbi.nlm.nih.gov/26008966" }, { "database": "PubMed", "id": "26028030", "url": "https://pubmed.ncbi.nlm.nih.gov/26028030" }, { "database": "PubMed", "id": "26041409", "url": "https://pubmed.ncbi.nlm.nih.gov/26041409" }, { "database": "PubMed", "id": "26045618", "url": "https://pubmed.ncbi.nlm.nih.gov/26045618" }, { "database": "PubMed", "id": "26051842", "url": "https://pubmed.ncbi.nlm.nih.gov/26051842" }, { "database": "PubMed", "id": "26055806", "url": "https://pubmed.ncbi.nlm.nih.gov/26055806" }, { "database": "PubMed", "id": "26068861", "url": "https://pubmed.ncbi.nlm.nih.gov/26068861" }, { "database": "PubMed", "id": "26084289", "url": "https://pubmed.ncbi.nlm.nih.gov/26084289" }, { "database": "PubMed", "id": "26090459", "url": "https://pubmed.ncbi.nlm.nih.gov/26090459" }, { "database": "PubMed", "id": "26136691", "url": "https://pubmed.ncbi.nlm.nih.gov/26136691" }, { "database": "PubMed", "id": "26138072", "url": "https://pubmed.ncbi.nlm.nih.gov/26138072" }, { "database": "PubMed", "id": "26166037", "url": "https://pubmed.ncbi.nlm.nih.gov/26166037" }, { "database": "PubMed", "id": "26175331", "url": "https://pubmed.ncbi.nlm.nih.gov/26175331" }, { "database": "PubMed", "id": "26212545", "url": "https://pubmed.ncbi.nlm.nih.gov/26212545" }, { "database": "PubMed", "id": "26215634", "url": "https://pubmed.ncbi.nlm.nih.gov/26215634" }, { "database": "PubMed", "id": "26215971", "url": "https://pubmed.ncbi.nlm.nih.gov/26215971" }, { "database": "PubMed", "id": "26279438", "url": "https://pubmed.ncbi.nlm.nih.gov/26279438" }, { "database": "PubMed", "id": "26283544", "url": "https://pubmed.ncbi.nlm.nih.gov/26283544" }, { "database": "PubMed", "id": "26307676", "url": "https://pubmed.ncbi.nlm.nih.gov/26307676" }, { "database": "PubMed", "id": "26329521", "url": "https://pubmed.ncbi.nlm.nih.gov/26329521" }, { "database": "PubMed", "id": "26343524", "url": "https://pubmed.ncbi.nlm.nih.gov/26343524" }, { "database": "PubMed", "id": "26359029", "url": "https://pubmed.ncbi.nlm.nih.gov/26359029" }, { "database": "PubMed", "id": "26376676", "url": "https://pubmed.ncbi.nlm.nih.gov/26376676" }, { "database": "PubMed", "id": "26396689", "url": "https://pubmed.ncbi.nlm.nih.gov/26396689" }, { "database": "PubMed", "id": "26410177", "url": "https://pubmed.ncbi.nlm.nih.gov/26410177" }, { "database": "PubMed", "id": "26418031", "url": "https://pubmed.ncbi.nlm.nih.gov/26418031" }, { "database": "PubMed", "id": "26430964", "url": "https://pubmed.ncbi.nlm.nih.gov/26430964" }, { "database": "PubMed", "id": "26452542", "url": "https://pubmed.ncbi.nlm.nih.gov/26452542" }, { "database": "PubMed", "id": "26459366", "url": "https://pubmed.ncbi.nlm.nih.gov/26459366" }, { "database": "PubMed", "id": "26485029", "url": "https://pubmed.ncbi.nlm.nih.gov/26485029" }, { "database": "PubMed", "id": "26486080", "url": "https://pubmed.ncbi.nlm.nih.gov/26486080" }, { "database": "PubMed", "id": "26528725", "url": "https://pubmed.ncbi.nlm.nih.gov/26528725" }, { "database": "PubMed", "id": "26542452", "url": "https://pubmed.ncbi.nlm.nih.gov/26542452" }, { "database": "PubMed", "id": "26549437", "url": "https://pubmed.ncbi.nlm.nih.gov/26549437" }, { "database": "PubMed", "id": "26549519", "url": "https://pubmed.ncbi.nlm.nih.gov/26549519" }, { "database": "PubMed", "id": "26575169", "url": "https://pubmed.ncbi.nlm.nih.gov/26575169" }, { "database": "PubMed", "id": "26580615", "url": "https://pubmed.ncbi.nlm.nih.gov/26580615" }, { "database": "PubMed", "id": "26610526", "url": "https://pubmed.ncbi.nlm.nih.gov/26610526" }, { "database": "PubMed", "id": "26646010", "url": "https://pubmed.ncbi.nlm.nih.gov/26646010" }, { "database": "PubMed", "id": "26657118", "url": "https://pubmed.ncbi.nlm.nih.gov/26657118" }, { "database": "PubMed", "id": "26664907", "url": "https://pubmed.ncbi.nlm.nih.gov/26664907" }, { "database": "PubMed", "id": "26667266", "url": "https://pubmed.ncbi.nlm.nih.gov/26667266" }, { "database": "PubMed", "id": "26700461", "url": "https://pubmed.ncbi.nlm.nih.gov/26700461" }, { "database": "PubMed", "id": "26755645", "url": "https://pubmed.ncbi.nlm.nih.gov/26755645" }, { "database": "PubMed", "id": "26799670", "url": "https://pubmed.ncbi.nlm.nih.gov/26799670" }, { "database": "PubMed", "id": "26807955", "url": "https://pubmed.ncbi.nlm.nih.gov/26807955" }, { "database": "PubMed", "id": "26843613", "url": "https://pubmed.ncbi.nlm.nih.gov/26843613" }, { "database": "PubMed", "id": "26848618", "url": "https://pubmed.ncbi.nlm.nih.gov/26848618" }, { "database": "PubMed", "id": "26883202", "url": "https://pubmed.ncbi.nlm.nih.gov/26883202" }, { "database": "PubMed", "id": "26883847", "url": "https://pubmed.ncbi.nlm.nih.gov/26883847" }, { "database": "PubMed", "id": "26893174", "url": "https://pubmed.ncbi.nlm.nih.gov/26893174" }, { "database": "PubMed", "id": "26893580", "url": "https://pubmed.ncbi.nlm.nih.gov/26893580" }, { "database": "PubMed", "id": "26898989", "url": "https://pubmed.ncbi.nlm.nih.gov/26898989" }, { "database": "PubMed", "id": "26904942", "url": "https://pubmed.ncbi.nlm.nih.gov/26904942" }, { "database": "PubMed", "id": "26904961", "url": "https://pubmed.ncbi.nlm.nih.gov/26904961" }, { "database": "PubMed", "id": "26909608", "url": "https://pubmed.ncbi.nlm.nih.gov/26909608" }, { "database": "PubMed", "id": "26911335", "url": "https://pubmed.ncbi.nlm.nih.gov/26911335" }, { "database": "PubMed", "id": "26921179", "url": "https://pubmed.ncbi.nlm.nih.gov/26921179" }, { "database": "PubMed", "id": "26926996", "url": "https://pubmed.ncbi.nlm.nih.gov/26926996" }, { "database": "PubMed", "id": "26927669", "url": "https://pubmed.ncbi.nlm.nih.gov/26927669" }, { "database": "PubMed", "id": "26949510", "url": "https://pubmed.ncbi.nlm.nih.gov/26949510" }, { "database": "PubMed", "id": "26956050", "url": "https://pubmed.ncbi.nlm.nih.gov/26956050" }, { "database": "PubMed", "id": "26959890", "url": "https://pubmed.ncbi.nlm.nih.gov/26959890" }, { "database": "PubMed", "id": "26967055", "url": "https://pubmed.ncbi.nlm.nih.gov/26967055" }, { "database": "PubMed", "id": "26974964", "url": "https://pubmed.ncbi.nlm.nih.gov/26974964" }, { "database": "PubMed", "id": "27009358", "url": "https://pubmed.ncbi.nlm.nih.gov/27009358" }, { "database": "PubMed", "id": "27036022", "url": "https://pubmed.ncbi.nlm.nih.gov/27036022" }, { "database": "PubMed", "id": "27050371", "url": "https://pubmed.ncbi.nlm.nih.gov/27050371" }, { "database": "PubMed", "id": "27064016", "url": "https://pubmed.ncbi.nlm.nih.gov/27064016" }, { "database": "PubMed", "id": "27080861", "url": "https://pubmed.ncbi.nlm.nih.gov/27080861" }, { "database": "PubMed", "id": "27107422", "url": "https://pubmed.ncbi.nlm.nih.gov/27107422" }, { "database": "PubMed", "id": "27121055", "url": "https://pubmed.ncbi.nlm.nih.gov/27121055" }, { "database": "PubMed", "id": "27145367", "url": "https://pubmed.ncbi.nlm.nih.gov/27145367" }, { "database": "PubMed", "id": "27151455", "url": "https://pubmed.ncbi.nlm.nih.gov/27151455" }, { "database": "PubMed", "id": "27181202", "url": "https://pubmed.ncbi.nlm.nih.gov/27181202" }, { "database": "PubMed", "id": "27200496", "url": "https://pubmed.ncbi.nlm.nih.gov/27200496" }, { "database": "PubMed", "id": "27216197", "url": "https://pubmed.ncbi.nlm.nih.gov/27216197" }, { "database": "PubMed", "id": "27264264", "url": "https://pubmed.ncbi.nlm.nih.gov/27264264" }, { "database": "PubMed", "id": "27274723", "url": "https://pubmed.ncbi.nlm.nih.gov/27274723" }, { "database": "PubMed", "id": "27279256", "url": "https://pubmed.ncbi.nlm.nih.gov/27279256" }, { "database": "PubMed", "id": "27292026", "url": "https://pubmed.ncbi.nlm.nih.gov/27292026" }, { "database": "PubMed", "id": "27317770", "url": "https://pubmed.ncbi.nlm.nih.gov/27317770" }, { "database": "PubMed", "id": "27323414", "url": "https://pubmed.ncbi.nlm.nih.gov/27323414" }, { "database": "PubMed", "id": "27326257", "url": "https://pubmed.ncbi.nlm.nih.gov/27326257" }, { "database": "PubMed", "id": "27344175", "url": "https://pubmed.ncbi.nlm.nih.gov/27344175" }, { "database": "PubMed", "id": "27362806", "url": "https://pubmed.ncbi.nlm.nih.gov/27362806" }, { "database": "PubMed", "id": "27373978", "url": "https://pubmed.ncbi.nlm.nih.gov/27373978" }, { "database": "PubMed", "id": "27384401", "url": "https://pubmed.ncbi.nlm.nih.gov/27384401" }, { "database": "PubMed", "id": "27418138", "url": "https://pubmed.ncbi.nlm.nih.gov/27418138" }, { "database": "PubMed", "id": "27419630", "url": "https://pubmed.ncbi.nlm.nih.gov/27419630" }, { "database": "PubMed", "id": "27428425", "url": "https://pubmed.ncbi.nlm.nih.gov/27428425" }, { "database": "PubMed", "id": "27456333", "url": "https://pubmed.ncbi.nlm.nih.gov/27456333" }, { "database": "PubMed", "id": "27457246", "url": "https://pubmed.ncbi.nlm.nih.gov/27457246" }, { "database": "PubMed", "id": "27458171", "url": "https://pubmed.ncbi.nlm.nih.gov/27458171" }, { "database": "PubMed", "id": "27462789", "url": "https://pubmed.ncbi.nlm.nih.gov/27462789" }, { "database": "PubMed", "id": "27486258", "url": "https://pubmed.ncbi.nlm.nih.gov/27486258" }, { "database": "PubMed", "id": "27502076", "url": "https://pubmed.ncbi.nlm.nih.gov/27502076" }, { "database": "PubMed", "id": "27537522", "url": "https://pubmed.ncbi.nlm.nih.gov/27537522" }, { "database": "PubMed", "id": "27555284", "url": "https://pubmed.ncbi.nlm.nih.gov/27555284" }, { "database": "PubMed", "id": "27602766", "url": "https://pubmed.ncbi.nlm.nih.gov/27602766" }, { "database": "PubMed", "id": "27616044", "url": "https://pubmed.ncbi.nlm.nih.gov/27616044" }, { "database": "PubMed", "id": "27624867", "url": "https://pubmed.ncbi.nlm.nih.gov/27624867" }, { "database": "PubMed", "id": "27626315", "url": "https://pubmed.ncbi.nlm.nih.gov/27626315" }, { "database": "PubMed", "id": "27658964", "url": "https://pubmed.ncbi.nlm.nih.gov/27658964" }, { "database": "PubMed", "id": "27660268", "url": "https://pubmed.ncbi.nlm.nih.gov/27660268" }, { "database": "PubMed", "id": "27687804", "url": "https://pubmed.ncbi.nlm.nih.gov/27687804" }, { "database": "PubMed", "id": "27694691", "url": "https://pubmed.ncbi.nlm.nih.gov/27694691" }, { "database": "PubMed", "id": "27705908", "url": "https://pubmed.ncbi.nlm.nih.gov/27705908" }, { "database": "PubMed", "id": "27708408", "url": "https://pubmed.ncbi.nlm.nih.gov/27708408" }, { "database": "PubMed", "id": "27732936", "url": "https://pubmed.ncbi.nlm.nih.gov/27732936" }, { "database": "PubMed", "id": "27748760", "url": "https://pubmed.ncbi.nlm.nih.gov/27748760" }, { "database": "PubMed", "id": "27748818", "url": "https://pubmed.ncbi.nlm.nih.gov/27748818" }, { "database": "PubMed", "id": "27806334", "url": "https://pubmed.ncbi.nlm.nih.gov/27806334" }, { "database": "PubMed", "id": "27824155", "url": "https://pubmed.ncbi.nlm.nih.gov/27824155" }, { "database": "PubMed", "id": "27834930", "url": "https://pubmed.ncbi.nlm.nih.gov/27834930" }, { "database": "PubMed", "id": "27845909", "url": "https://pubmed.ncbi.nlm.nih.gov/27845909" }, { "database": "PubMed", "id": "27855189", "url": "https://pubmed.ncbi.nlm.nih.gov/27855189" }, { "database": "PubMed", "id": "27855669", "url": "https://pubmed.ncbi.nlm.nih.gov/27855669" }, { "database": "PubMed", "id": "27861147", "url": "https://pubmed.ncbi.nlm.nih.gov/27861147" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "27864909", "url": "https://pubmed.ncbi.nlm.nih.gov/27864909" }, { "database": "PubMed", "id": "27871173", "url": "https://pubmed.ncbi.nlm.nih.gov/27871173" }, { "database": "PubMed", "id": "27888804", "url": "https://pubmed.ncbi.nlm.nih.gov/27888804" }, { "database": "PubMed", "id": "27903968", "url": "https://pubmed.ncbi.nlm.nih.gov/27903968" }, { "database": "PubMed", "id": "27977009", "url": "https://pubmed.ncbi.nlm.nih.gov/27977009" }, { "database": "PubMed", "id": "28000790", "url": "https://pubmed.ncbi.nlm.nih.gov/28000790" }, { "database": "PubMed", "id": "28004755", "url": "https://pubmed.ncbi.nlm.nih.gov/28004755" }, { "database": "PubMed", "id": "28017654", "url": "https://pubmed.ncbi.nlm.nih.gov/28017654" }, { "database": "PubMed", "id": "28030813", "url": "https://pubmed.ncbi.nlm.nih.gov/28030813" }, { "database": "PubMed", "id": "28035720", "url": "https://pubmed.ncbi.nlm.nih.gov/28035720" }, { "database": "PubMed", "id": "28053540", "url": "https://pubmed.ncbi.nlm.nih.gov/28053540" }, { "database": "PubMed", "id": "28054649", "url": "https://pubmed.ncbi.nlm.nih.gov/28054649" }, { "database": "PubMed", "id": "28055016", "url": "https://pubmed.ncbi.nlm.nih.gov/28055016" }, { "database": "PubMed", "id": "28100038", "url": "https://pubmed.ncbi.nlm.nih.gov/28100038" }, { "database": "PubMed", "id": "28123608", "url": "https://pubmed.ncbi.nlm.nih.gov/28123608" }, { "database": "PubMed", "id": "28125678", "url": "https://pubmed.ncbi.nlm.nih.gov/28125678" }, { "database": "PubMed", "id": "28134252", "url": "https://pubmed.ncbi.nlm.nih.gov/28134252" }, { "database": "PubMed", "id": "28138036", "url": "https://pubmed.ncbi.nlm.nih.gov/28138036" }, { "database": "PubMed", "id": "28150703", "url": "https://pubmed.ncbi.nlm.nih.gov/28150703" }, { "database": "PubMed", "id": "28150717", "url": "https://pubmed.ncbi.nlm.nih.gov/28150717" }, { "database": "PubMed", "id": "28157205", "url": "https://pubmed.ncbi.nlm.nih.gov/28157205" }, { "database": "PubMed", "id": "28157698", "url": "https://pubmed.ncbi.nlm.nih.gov/28157698" }, { "database": "PubMed", "id": "28157712", "url": "https://pubmed.ncbi.nlm.nih.gov/28157712" }, { "database": "PubMed", "id": "28159925", "url": "https://pubmed.ncbi.nlm.nih.gov/28159925" }, { "database": "PubMed", "id": "28160777", "url": "https://pubmed.ncbi.nlm.nih.gov/28160777" }, { "database": "PubMed", "id": "28207963", "url": "https://pubmed.ncbi.nlm.nih.gov/28207963" }, { "database": "PubMed", "id": "28222632", "url": "https://pubmed.ncbi.nlm.nih.gov/28222632" }, { "database": "PubMed", "id": "28223425", "url": "https://pubmed.ncbi.nlm.nih.gov/28223425" }, { "database": "PubMed", "id": "28228214", "url": "https://pubmed.ncbi.nlm.nih.gov/28228214" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28264935", "url": "https://pubmed.ncbi.nlm.nih.gov/28264935" }, { "database": "PubMed", "id": "28276425", "url": "https://pubmed.ncbi.nlm.nih.gov/28276425" }, { "database": "PubMed", "id": "28280036", "url": "https://pubmed.ncbi.nlm.nih.gov/28280036" }, { "database": "PubMed", "id": "28345832", "url": "https://pubmed.ncbi.nlm.nih.gov/28345832" }, { "database": "PubMed", "id": "28350008", "url": "https://pubmed.ncbi.nlm.nih.gov/28350008" }, { "database": "PubMed", "id": "28367059", "url": "https://pubmed.ncbi.nlm.nih.gov/28367059" }, { "database": "PubMed", "id": "28376152", "url": "https://pubmed.ncbi.nlm.nih.gov/28376152" }, { "database": "PubMed", "id": "28384648", "url": "https://pubmed.ncbi.nlm.nih.gov/28384648" }, { "database": "PubMed", "id": "28388577", "url": "https://pubmed.ncbi.nlm.nih.gov/28388577" }, { "database": "PubMed", "id": "28397855", "url": "https://pubmed.ncbi.nlm.nih.gov/28397855" }, { "database": "PubMed", "id": "28415760", "url": "https://pubmed.ncbi.nlm.nih.gov/28415760" }, { "database": "PubMed", "id": "28427199", "url": "https://pubmed.ncbi.nlm.nih.gov/28427199" }, { "database": "PubMed", "id": "28427224", "url": "https://pubmed.ncbi.nlm.nih.gov/28427224" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28469272", "url": "https://pubmed.ncbi.nlm.nih.gov/28469272" }, { "database": "PubMed", "id": "28483518", "url": "https://pubmed.ncbi.nlm.nih.gov/28483518" }, { "database": "PubMed", "id": "28492557", "url": "https://pubmed.ncbi.nlm.nih.gov/28492557" }, { "database": "PubMed", "id": "28500786", "url": "https://pubmed.ncbi.nlm.nih.gov/28500786" }, { "database": "PubMed", "id": "28503147", "url": "https://pubmed.ncbi.nlm.nih.gov/28503147" }, { "database": "PubMed", "id": "28520923", "url": "https://pubmed.ncbi.nlm.nih.gov/28520923" }, { "database": "PubMed", "id": "28526807", "url": "https://pubmed.ncbi.nlm.nih.gov/28526807" }, { "database": "PubMed", "id": "28526849", "url": "https://pubmed.ncbi.nlm.nih.gov/28526849" }, { "database": "PubMed", "id": "28542650", "url": "https://pubmed.ncbi.nlm.nih.gov/28542650" }, { "database": "PubMed", "id": "28549350", "url": "https://pubmed.ncbi.nlm.nih.gov/28549350" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28560454", "url": "https://pubmed.ncbi.nlm.nih.gov/28560454" }, { "database": "PubMed", "id": "28572601", "url": "https://pubmed.ncbi.nlm.nih.gov/28572601" }, { "database": "PubMed", "id": "28574510", "url": "https://pubmed.ncbi.nlm.nih.gov/28574510" }, { "database": "PubMed", "id": "28588262", "url": "https://pubmed.ncbi.nlm.nih.gov/28588262" }, { "database": "PubMed", "id": "28629363", "url": "https://pubmed.ncbi.nlm.nih.gov/28629363" }, { "database": "PubMed", "id": "28634059", "url": "https://pubmed.ncbi.nlm.nih.gov/28634059" }, { "database": "PubMed", "id": "28636670", "url": "https://pubmed.ncbi.nlm.nih.gov/28636670" }, { "database": "PubMed", "id": "28654902", "url": "https://pubmed.ncbi.nlm.nih.gov/28654902" }, { "database": "PubMed", "id": "28661045", "url": "https://pubmed.ncbi.nlm.nih.gov/28661045" }, { "database": "PubMed", "id": "28664080", "url": "https://pubmed.ncbi.nlm.nih.gov/28664080" }, { "database": "PubMed", "id": "28666623", "url": "https://pubmed.ncbi.nlm.nih.gov/28666623" }, { "database": "PubMed", "id": "28670112", "url": "https://pubmed.ncbi.nlm.nih.gov/28670112" }, { "database": "PubMed", "id": "28672024", "url": "https://pubmed.ncbi.nlm.nih.gov/28672024" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28705432", "url": "https://pubmed.ncbi.nlm.nih.gov/28705432" }, { "database": "PubMed", "id": "28720093", "url": "https://pubmed.ncbi.nlm.nih.gov/28720093" }, { "database": "PubMed", "id": "28745314", "url": "https://pubmed.ncbi.nlm.nih.gov/28745314" }, { "database": "PubMed", "id": "28750624", "url": "https://pubmed.ncbi.nlm.nih.gov/28750624" }, { "database": "PubMed", "id": "28757590", "url": "https://pubmed.ncbi.nlm.nih.gov/28757590" }, { "database": "PubMed", "id": "28781685", "url": "https://pubmed.ncbi.nlm.nih.gov/28781685" }, { "database": "PubMed", "id": "28783167", "url": "https://pubmed.ncbi.nlm.nih.gov/28783167" }, { "database": "PubMed", "id": "28785079", "url": "https://pubmed.ncbi.nlm.nih.gov/28785079" }, { "database": "PubMed", "id": "28785380", "url": "https://pubmed.ncbi.nlm.nih.gov/28785380" }, { "database": "PubMed", "id": "28859117", "url": "https://pubmed.ncbi.nlm.nih.gov/28859117" }, { "database": "PubMed", "id": "28881473", "url": "https://pubmed.ncbi.nlm.nih.gov/28881473" }, { "database": "PubMed", "id": "28883791", "url": "https://pubmed.ncbi.nlm.nih.gov/28883791" }, { "database": "PubMed", "id": "28884137", "url": "https://pubmed.ncbi.nlm.nih.gov/28884137" }, { "database": "PubMed", "id": "28903349", "url": "https://pubmed.ncbi.nlm.nih.gov/28903349" }, { "database": "PubMed", "id": "28918059", "url": "https://pubmed.ncbi.nlm.nih.gov/28918059" }, { "database": "PubMed", "id": "29024195", "url": "https://pubmed.ncbi.nlm.nih.gov/29024195" }, { "database": "PubMed", "id": "29050232", "url": "https://pubmed.ncbi.nlm.nih.gov/29050232" }, { "database": "PubMed", "id": "29062282", "url": "https://pubmed.ncbi.nlm.nih.gov/29062282" }, { "database": "PubMed", "id": "29082496", "url": "https://pubmed.ncbi.nlm.nih.gov/29082496" }, { "database": "PubMed", "id": "29088733", "url": "https://pubmed.ncbi.nlm.nih.gov/29088733" }, { "database": "PubMed", "id": "29126425", "url": "https://pubmed.ncbi.nlm.nih.gov/29126425" }, { "database": "PubMed", "id": "29133922", "url": "https://pubmed.ncbi.nlm.nih.gov/29133922" }, { "database": "PubMed", "id": "29142074", "url": "https://pubmed.ncbi.nlm.nih.gov/29142074" }, { "database": "PubMed", "id": "29158850", "url": "https://pubmed.ncbi.nlm.nih.gov/29158850" }, { "database": "PubMed", "id": "29162862", "url": "https://pubmed.ncbi.nlm.nih.gov/29162862" }, { "database": "PubMed", "id": "29174507", "url": "https://pubmed.ncbi.nlm.nih.gov/29174507" }, { "database": "PubMed", "id": "29179471", "url": "https://pubmed.ncbi.nlm.nih.gov/29179471" }, { "database": "PubMed", "id": "29180818", "url": "https://pubmed.ncbi.nlm.nih.gov/29180818" }, { "database": "PubMed", "id": "29182685", "url": "https://pubmed.ncbi.nlm.nih.gov/29182685" }, { "database": "PubMed", "id": "29185442", "url": "https://pubmed.ncbi.nlm.nih.gov/29185442" }, { "database": "PubMed", "id": "29190960", "url": "https://pubmed.ncbi.nlm.nih.gov/29190960" }, { "database": "PubMed", "id": "29207075", "url": "https://pubmed.ncbi.nlm.nih.gov/29207075" }, { "database": "PubMed", "id": "29207614", "url": "https://pubmed.ncbi.nlm.nih.gov/29207614" }, { "database": "PubMed", "id": "29212252", "url": "https://pubmed.ncbi.nlm.nih.gov/29212252" }, { "database": "PubMed", "id": "29228628", "url": "https://pubmed.ncbi.nlm.nih.gov/29228628" }, { "database": "PubMed", "id": "29229958", "url": "https://pubmed.ncbi.nlm.nih.gov/29229958" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29242509", "url": "https://pubmed.ncbi.nlm.nih.gov/29242509" }, { "database": "PubMed", "id": "29253028", "url": "https://pubmed.ncbi.nlm.nih.gov/29253028" }, { "database": "PubMed", "id": "29254221", "url": "https://pubmed.ncbi.nlm.nih.gov/29254221" }, { "database": "PubMed", "id": "29263930", "url": "https://pubmed.ncbi.nlm.nih.gov/29263930" }, { "database": "PubMed", "id": "29270528", "url": "https://pubmed.ncbi.nlm.nih.gov/29270528" }, { "database": "PubMed", "id": "29286132", "url": "https://pubmed.ncbi.nlm.nih.gov/29286132" }, { "database": "PubMed", "id": "29290793", "url": "https://pubmed.ncbi.nlm.nih.gov/29290793" }, { "database": "PubMed", "id": "29309895", "url": "https://pubmed.ncbi.nlm.nih.gov/29309895" }, { "database": "PubMed", "id": "29330478", "url": "https://pubmed.ncbi.nlm.nih.gov/29330478" }, { "database": "PubMed", "id": "29351406", "url": "https://pubmed.ncbi.nlm.nih.gov/29351406" }, { "database": "PubMed", "id": "29402895", "url": "https://pubmed.ncbi.nlm.nih.gov/29402895" }, { "database": "PubMed", "id": "29423098", "url": "https://pubmed.ncbi.nlm.nih.gov/29423098" }, { "database": "PubMed", "id": "29449694", "url": "https://pubmed.ncbi.nlm.nih.gov/29449694" }, { "database": "PubMed", "id": "29456111", "url": "https://pubmed.ncbi.nlm.nih.gov/29456111" }, { "database": "PubMed", "id": "29456240", "url": "https://pubmed.ncbi.nlm.nih.gov/29456240" }, { "database": "PubMed", "id": "29464030", "url": "https://pubmed.ncbi.nlm.nih.gov/29464030" }, { "database": "PubMed", "id": "29488000", "url": "https://pubmed.ncbi.nlm.nih.gov/29488000" }, { "database": "PubMed", "id": "29499951", "url": "https://pubmed.ncbi.nlm.nih.gov/29499951" }, { "database": "PubMed", "id": "29511087", "url": "https://pubmed.ncbi.nlm.nih.gov/29511087" }, { "database": "PubMed", "id": "29511600", "url": "https://pubmed.ncbi.nlm.nih.gov/29511600" }, { "database": "PubMed", "id": "29518696", "url": "https://pubmed.ncbi.nlm.nih.gov/29518696" }, { "database": "PubMed", "id": "29540666", "url": "https://pubmed.ncbi.nlm.nih.gov/29540666" }, { "database": "PubMed", "id": "29565987", "url": "https://pubmed.ncbi.nlm.nih.gov/29565987" }, { "database": "PubMed", "id": "29566069", "url": "https://pubmed.ncbi.nlm.nih.gov/29566069" }, { "database": "PubMed", "id": "29571296", "url": "https://pubmed.ncbi.nlm.nih.gov/29571296" }, { "database": "PubMed", "id": "29595328", "url": "https://pubmed.ncbi.nlm.nih.gov/29595328" }, { "database": "PubMed", "id": "29599917", "url": "https://pubmed.ncbi.nlm.nih.gov/29599917" }, { "database": "PubMed", "id": "29606890", "url": "https://pubmed.ncbi.nlm.nih.gov/29606890" }, { "database": "PubMed", "id": "29630659", "url": "https://pubmed.ncbi.nlm.nih.gov/29630659" }, { "database": "PubMed", "id": "29636527", "url": "https://pubmed.ncbi.nlm.nih.gov/29636527" }, { "database": "PubMed", "id": "29637003", "url": "https://pubmed.ncbi.nlm.nih.gov/29637003" }, { "database": "PubMed", "id": "29652915", "url": "https://pubmed.ncbi.nlm.nih.gov/29652915" }, { "database": "PubMed", "id": "29660364", "url": "https://pubmed.ncbi.nlm.nih.gov/29660364" }, { "database": "PubMed", "id": "29666362", "url": "https://pubmed.ncbi.nlm.nih.gov/29666362" }, { "database": "PubMed", "id": "29682112", "url": "https://pubmed.ncbi.nlm.nih.gov/29682112" }, { "database": "PubMed", "id": "29686295", "url": "https://pubmed.ncbi.nlm.nih.gov/29686295" }, { "database": "PubMed", "id": "29717134", "url": "https://pubmed.ncbi.nlm.nih.gov/29717134" }, { "database": "PubMed", "id": "29721383", "url": "https://pubmed.ncbi.nlm.nih.gov/29721383" }, { "database": "PubMed", "id": "29749438", "url": "https://pubmed.ncbi.nlm.nih.gov/29749438" }, { "database": "PubMed", "id": "29765448", "url": "https://pubmed.ncbi.nlm.nih.gov/29765448" }, { "database": "PubMed", "id": "29774125", "url": "https://pubmed.ncbi.nlm.nih.gov/29774125" }, { "database": "PubMed", "id": "29795016", "url": "https://pubmed.ncbi.nlm.nih.gov/29795016" }, { "database": "PubMed", "id": "29805309", "url": "https://pubmed.ncbi.nlm.nih.gov/29805309" }, { "database": "PubMed", "id": "29807795", "url": "https://pubmed.ncbi.nlm.nih.gov/29807795" }, { "database": "PubMed", "id": "29855616", "url": "https://pubmed.ncbi.nlm.nih.gov/29855616" }, { "database": "PubMed", "id": "29891854", "url": "https://pubmed.ncbi.nlm.nih.gov/29891854" }, { "database": "PubMed", "id": "29892198", "url": "https://pubmed.ncbi.nlm.nih.gov/29892198" }, { "database": "PubMed", "id": "29901083", "url": "https://pubmed.ncbi.nlm.nih.gov/29901083" }, { "database": "PubMed", "id": "29904948", "url": "https://pubmed.ncbi.nlm.nih.gov/29904948" }, { "database": "PubMed", "id": "29915371", "url": "https://pubmed.ncbi.nlm.nih.gov/29915371" }, { "database": "PubMed", "id": "29920512", "url": "https://pubmed.ncbi.nlm.nih.gov/29920512" }, { "database": "PubMed", "id": "29921768", "url": "https://pubmed.ncbi.nlm.nih.gov/29921768" }, { "database": "PubMed", "id": "29949238", "url": "https://pubmed.ncbi.nlm.nih.gov/29949238" }, { "database": "PubMed", "id": "29950561", "url": "https://pubmed.ncbi.nlm.nih.gov/29950561" }, { "database": "PubMed", "id": "29991802", "url": "https://pubmed.ncbi.nlm.nih.gov/29991802" }, { "database": "PubMed", "id": "29995595", "url": "https://pubmed.ncbi.nlm.nih.gov/29995595" }, { "database": "PubMed", "id": "30008594", "url": "https://pubmed.ncbi.nlm.nih.gov/30008594" }, { "database": "PubMed", "id": "30009856", "url": "https://pubmed.ncbi.nlm.nih.gov/30009856" }, { "database": "PubMed", "id": "30015159", "url": "https://pubmed.ncbi.nlm.nih.gov/30015159" }, { "database": "PubMed", "id": "30016456", "url": "https://pubmed.ncbi.nlm.nih.gov/30016456" }, { "database": "PubMed", "id": "30036966", "url": "https://pubmed.ncbi.nlm.nih.gov/30036966" }, { "database": "PubMed", "id": "30072687", "url": "https://pubmed.ncbi.nlm.nih.gov/30072687" }, { "database": "PubMed", "id": "30080291", "url": "https://pubmed.ncbi.nlm.nih.gov/30080291" }, { "database": "PubMed", "id": "30106087", "url": "https://pubmed.ncbi.nlm.nih.gov/30106087" }, { "database": "PubMed", "id": "30123428", "url": "https://pubmed.ncbi.nlm.nih.gov/30123428" }, { "database": "PubMed", "id": "30127373", "url": "https://pubmed.ncbi.nlm.nih.gov/30127373" }, { "database": "PubMed", "id": "30127519", "url": "https://pubmed.ncbi.nlm.nih.gov/30127519" }, { "database": "PubMed", "id": "30135074", "url": "https://pubmed.ncbi.nlm.nih.gov/30135074" }, { "database": "PubMed", "id": "30135654", "url": "https://pubmed.ncbi.nlm.nih.gov/30135654" }, { "database": "PubMed", "id": "30209389", "url": "https://pubmed.ncbi.nlm.nih.gov/30209389" }, { "database": "PubMed", "id": "30214513", "url": "https://pubmed.ncbi.nlm.nih.gov/30214513" }, { "database": "PubMed", "id": "30234199", "url": "https://pubmed.ncbi.nlm.nih.gov/30234199" }, { "database": "PubMed", "id": "30250641", "url": "https://pubmed.ncbi.nlm.nih.gov/30250641" }, { "database": "PubMed", "id": "30251272", "url": "https://pubmed.ncbi.nlm.nih.gov/30251272" }, { "database": "PubMed", "id": "30261753", "url": "https://pubmed.ncbi.nlm.nih.gov/30261753" }, { "database": "PubMed", "id": "30286779", "url": "https://pubmed.ncbi.nlm.nih.gov/30286779" }, { "database": "PubMed", "id": "30302278", "url": "https://pubmed.ncbi.nlm.nih.gov/30302278" }, { "database": "PubMed", "id": "30323565", "url": "https://pubmed.ncbi.nlm.nih.gov/30323565" }, { "database": "PubMed", "id": "30368518", "url": "https://pubmed.ncbi.nlm.nih.gov/30368518" }, { "database": "PubMed", "id": "30375708", "url": "https://pubmed.ncbi.nlm.nih.gov/30375708" }, { "database": "PubMed", "id": "30410767", "url": "https://pubmed.ncbi.nlm.nih.gov/30410767" }, { "database": "PubMed", "id": "30442941", "url": "https://pubmed.ncbi.nlm.nih.gov/30442941" }, { "database": "PubMed", "id": "30455690", "url": "https://pubmed.ncbi.nlm.nih.gov/30455690" }, { "database": "PubMed", "id": "30481203", "url": "https://pubmed.ncbi.nlm.nih.gov/30481203" }, { "database": "PubMed", "id": "30519314", "url": "https://pubmed.ncbi.nlm.nih.gov/30519314" }, { "database": "PubMed", "id": "30523261", "url": "https://pubmed.ncbi.nlm.nih.gov/30523261" }, { "database": "PubMed", "id": "30577812", "url": "https://pubmed.ncbi.nlm.nih.gov/30577812" }, { "database": "PubMed", "id": "30622543", "url": "https://pubmed.ncbi.nlm.nih.gov/30622543" }, { "database": "PubMed", "id": "30622697", "url": "https://pubmed.ncbi.nlm.nih.gov/30622697" }, { "database": "PubMed", "id": "30631031", "url": "https://pubmed.ncbi.nlm.nih.gov/30631031" }, { "database": "PubMed", "id": "30668440", "url": "https://pubmed.ncbi.nlm.nih.gov/30668440" }, { "database": "PubMed", "id": "30674340", "url": "https://pubmed.ncbi.nlm.nih.gov/30674340" }, { "database": "PubMed", "id": "30675525", "url": "https://pubmed.ncbi.nlm.nih.gov/30675525" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30720080", "url": "https://pubmed.ncbi.nlm.nih.gov/30720080" }, { "database": "PubMed", "id": "30720090", "url": "https://pubmed.ncbi.nlm.nih.gov/30720090" }, { "database": "PubMed", "id": "30735121", "url": "https://pubmed.ncbi.nlm.nih.gov/30735121" }, { "database": "PubMed", "id": "30745853", "url": "https://pubmed.ncbi.nlm.nih.gov/30745853" }, { "database": "PubMed", "id": "30756445", "url": "https://pubmed.ncbi.nlm.nih.gov/30756445" }, { "database": "PubMed", "id": "30760703", "url": "https://pubmed.ncbi.nlm.nih.gov/30760703" }, { "database": "PubMed", "id": "30770798", "url": "https://pubmed.ncbi.nlm.nih.gov/30770798" }, { "database": "PubMed", "id": "30783489", "url": "https://pubmed.ncbi.nlm.nih.gov/30783489" }, { "database": "PubMed", "id": "30787270", "url": "https://pubmed.ncbi.nlm.nih.gov/30787270" }, { "database": "PubMed", "id": "30810286", "url": "https://pubmed.ncbi.nlm.nih.gov/30810286" }, { "database": "PubMed", "id": "30833574", "url": "https://pubmed.ncbi.nlm.nih.gov/30833574" }, { "database": "PubMed", "id": "30854231", "url": "https://pubmed.ncbi.nlm.nih.gov/30854231" }, { "database": "PubMed", "id": "30857539", "url": "https://pubmed.ncbi.nlm.nih.gov/30857539" }, { "database": "PubMed", "id": "30899371", "url": "https://pubmed.ncbi.nlm.nih.gov/30899371" }, { "database": "PubMed", "id": "30947697", "url": "https://pubmed.ncbi.nlm.nih.gov/30947697" }, { "database": "PubMed", "id": "30948493", "url": "https://pubmed.ncbi.nlm.nih.gov/30948493" }, { "database": "PubMed", "id": "30949204", "url": "https://pubmed.ncbi.nlm.nih.gov/30949204" }, { "database": "PubMed", "id": "30950039", "url": "https://pubmed.ncbi.nlm.nih.gov/30950039" }, { "database": "PubMed", "id": "30958597", "url": "https://pubmed.ncbi.nlm.nih.gov/30958597" }, { "database": "PubMed", "id": "30980700", "url": "https://pubmed.ncbi.nlm.nih.gov/30980700" }, { "database": "PubMed", "id": "30981183", "url": "https://pubmed.ncbi.nlm.nih.gov/30981183" }, { "database": "PubMed", "id": "30986607", "url": "https://pubmed.ncbi.nlm.nih.gov/30986607" }, { "database": "PubMed", "id": "31002364", "url": "https://pubmed.ncbi.nlm.nih.gov/31002364" }, { "database": "PubMed", "id": "31013746", "url": "https://pubmed.ncbi.nlm.nih.gov/31013746" }, { "database": "PubMed", "id": "31018021", "url": "https://pubmed.ncbi.nlm.nih.gov/31018021" }, { "database": "PubMed", "id": "31048139", "url": "https://pubmed.ncbi.nlm.nih.gov/31048139" }, { "database": "PubMed", "id": "31058868", "url": "https://pubmed.ncbi.nlm.nih.gov/31058868" }, { "database": "PubMed", "id": "31068940", "url": "https://pubmed.ncbi.nlm.nih.gov/31068940" }, { "database": "PubMed", "id": "31105997", "url": "https://pubmed.ncbi.nlm.nih.gov/31105997" }, { "database": "PubMed", "id": "31118769", "url": "https://pubmed.ncbi.nlm.nih.gov/31118769" }, { "database": "PubMed", "id": "31129031", "url": "https://pubmed.ncbi.nlm.nih.gov/31129031" }, { "database": "PubMed", "id": "31182137", "url": "https://pubmed.ncbi.nlm.nih.gov/31182137" }, { "database": "PubMed", "id": "31198634", "url": "https://pubmed.ncbi.nlm.nih.gov/31198634" }, { "database": "PubMed", "id": "31201357", "url": "https://pubmed.ncbi.nlm.nih.gov/31201357" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31213027", "url": "https://pubmed.ncbi.nlm.nih.gov/31213027" }, { "database": "PubMed", "id": "31226168", "url": "https://pubmed.ncbi.nlm.nih.gov/31226168" }, { "database": "PubMed", "id": "31227842", "url": "https://pubmed.ncbi.nlm.nih.gov/31227842" }, { "database": "PubMed", "id": "31277507", "url": "https://pubmed.ncbi.nlm.nih.gov/31277507" }, { "database": "PubMed", "id": "31277685", "url": "https://pubmed.ncbi.nlm.nih.gov/31277685" }, { "database": "PubMed", "id": "31284599", "url": "https://pubmed.ncbi.nlm.nih.gov/31284599" }, { "database": "PubMed", "id": "31285546", "url": "https://pubmed.ncbi.nlm.nih.gov/31285546" }, { "database": "PubMed", "id": "31306849", "url": "https://pubmed.ncbi.nlm.nih.gov/31306849" }, { "database": "PubMed", "id": "31319869", "url": "https://pubmed.ncbi.nlm.nih.gov/31319869" }, { "database": "PubMed", "id": "31323961", "url": "https://pubmed.ncbi.nlm.nih.gov/31323961" }, { "database": "PubMed", "id": "31337063", "url": "https://pubmed.ncbi.nlm.nih.gov/31337063" }, { "database": "PubMed", "id": "31337349", "url": "https://pubmed.ncbi.nlm.nih.gov/31337349" }, { "database": "PubMed", "id": "31337843", "url": "https://pubmed.ncbi.nlm.nih.gov/31337843" }, { "database": "PubMed", "id": "31361391", "url": "https://pubmed.ncbi.nlm.nih.gov/31361391" }, { "database": "PubMed", "id": "31361777", "url": "https://pubmed.ncbi.nlm.nih.gov/31361777" }, { "database": "PubMed", "id": "31372043", "url": "https://pubmed.ncbi.nlm.nih.gov/31372043" }, { "database": "PubMed", "id": "31375423", "url": "https://pubmed.ncbi.nlm.nih.gov/31375423" }, { "database": "PubMed", "id": "31383893", "url": "https://pubmed.ncbi.nlm.nih.gov/31383893" }, { "database": "PubMed", "id": "31390744", "url": "https://pubmed.ncbi.nlm.nih.gov/31390744" }, { "database": "PubMed", "id": "31409371", "url": "https://pubmed.ncbi.nlm.nih.gov/31409371" }, { "database": "PubMed", "id": "31412593", "url": "https://pubmed.ncbi.nlm.nih.gov/31412593" }, { "database": "PubMed", "id": "31422383", "url": "https://pubmed.ncbi.nlm.nih.gov/31422383" }, { "database": "PubMed", "id": "31438472", "url": "https://pubmed.ncbi.nlm.nih.gov/31438472" }, { "database": "PubMed", "id": "31438567", "url": "https://pubmed.ncbi.nlm.nih.gov/31438567" }, { "database": "PubMed", "id": "31448054", "url": "https://pubmed.ncbi.nlm.nih.gov/31448054" }, { "database": "PubMed", "id": "31455240", "url": "https://pubmed.ncbi.nlm.nih.gov/31455240" }, { "database": "PubMed", "id": "31465777", "url": "https://pubmed.ncbi.nlm.nih.gov/31465777" }, { "database": "PubMed", "id": "31500219", "url": "https://pubmed.ncbi.nlm.nih.gov/31500219" }, { "database": "PubMed", "id": "31511071", "url": "https://pubmed.ncbi.nlm.nih.gov/31511071" }, { "database": "PubMed", "id": "31530281", "url": "https://pubmed.ncbi.nlm.nih.gov/31530281" }, { "database": "PubMed", "id": "31537377", "url": "https://pubmed.ncbi.nlm.nih.gov/31537377" }, { "database": "PubMed", "id": "31568643", "url": "https://pubmed.ncbi.nlm.nih.gov/31568643" }, { "database": "PubMed", "id": "31573734", "url": "https://pubmed.ncbi.nlm.nih.gov/31573734" }, { "database": "PubMed", "id": "31575007", "url": "https://pubmed.ncbi.nlm.nih.gov/31575007" }, { "database": "PubMed", "id": "31597912", "url": "https://pubmed.ncbi.nlm.nih.gov/31597912" }, { "database": "PubMed", "id": "31616177", "url": "https://pubmed.ncbi.nlm.nih.gov/31616177" }, { "database": "PubMed", "id": "31655629", "url": "https://pubmed.ncbi.nlm.nih.gov/31655629" }, { "database": "PubMed", "id": "31695791", "url": "https://pubmed.ncbi.nlm.nih.gov/31695791" }, { "database": "PubMed", "id": "31709178", "url": "https://pubmed.ncbi.nlm.nih.gov/31709178" }, { "database": "PubMed", "id": "31744223", "url": "https://pubmed.ncbi.nlm.nih.gov/31744223" }, { "database": "PubMed", "id": "31750256", "url": "https://pubmed.ncbi.nlm.nih.gov/31750256" }, { "database": "PubMed", "id": "31760402", "url": "https://pubmed.ncbi.nlm.nih.gov/31760402" }, { "database": "PubMed", "id": "31765941", "url": "https://pubmed.ncbi.nlm.nih.gov/31765941" }, { "database": "PubMed", "id": "31781039", "url": "https://pubmed.ncbi.nlm.nih.gov/31781039" }, { "database": "PubMed", "id": "31816634", "url": "https://pubmed.ncbi.nlm.nih.gov/31816634" }, { "database": "PubMed", "id": "31817171", "url": "https://pubmed.ncbi.nlm.nih.gov/31817171" }, { "database": "PubMed", "id": "31847229", "url": "https://pubmed.ncbi.nlm.nih.gov/31847229" }, { "database": "PubMed", "id": "31878046", "url": "https://pubmed.ncbi.nlm.nih.gov/31878046" }, { "database": "PubMed", "id": "31888532", "url": "https://pubmed.ncbi.nlm.nih.gov/31888532" }, { "database": "PubMed", "id": "31894334", "url": "https://pubmed.ncbi.nlm.nih.gov/31894334" }, { "database": "PubMed", "id": "31900385", "url": "https://pubmed.ncbi.nlm.nih.gov/31900385" }, { "database": "PubMed", "id": "31908417", "url": "https://pubmed.ncbi.nlm.nih.gov/31908417" }, { "database": "PubMed", "id": "31920333", "url": "https://pubmed.ncbi.nlm.nih.gov/31920333" }, { "database": "PubMed", "id": "31936807", "url": "https://pubmed.ncbi.nlm.nih.gov/31936807" }, { "database": "PubMed", "id": "31938049", "url": "https://pubmed.ncbi.nlm.nih.gov/31938049" }, { "database": "PubMed", "id": "31956373", "url": "https://pubmed.ncbi.nlm.nih.gov/31956373" }, { "database": "PubMed", "id": "31980595", "url": "https://pubmed.ncbi.nlm.nih.gov/31980595" }, { "database": "PubMed", "id": "31990532", "url": "https://pubmed.ncbi.nlm.nih.gov/31990532" }, { "database": "PubMed", "id": "32005797", "url": "https://pubmed.ncbi.nlm.nih.gov/32005797" }, { "database": "PubMed", "id": "32005799", "url": "https://pubmed.ncbi.nlm.nih.gov/32005799" }, { "database": "PubMed", "id": "32021288", "url": "https://pubmed.ncbi.nlm.nih.gov/32021288" }, { "database": "PubMed", "id": "32029900", "url": "https://pubmed.ncbi.nlm.nih.gov/32029900" }, { "database": "PubMed", "id": "32051479", "url": "https://pubmed.ncbi.nlm.nih.gov/32051479" }, { "database": "PubMed", "id": "32054489", "url": "https://pubmed.ncbi.nlm.nih.gov/32054489" }, { "database": "PubMed", "id": "32071920", "url": "https://pubmed.ncbi.nlm.nih.gov/32071920" }, { "database": "PubMed", "id": "32080166", "url": "https://pubmed.ncbi.nlm.nih.gov/32080166" }, { "database": "PubMed", "id": "32150979", "url": "https://pubmed.ncbi.nlm.nih.gov/32150979" }, { "database": "PubMed", "id": "32164483", "url": "https://pubmed.ncbi.nlm.nih.gov/32164483" }, { "database": "PubMed", "id": "32171124", "url": "https://pubmed.ncbi.nlm.nih.gov/32171124" }, { "database": "PubMed", "id": "32182833", "url": "https://pubmed.ncbi.nlm.nih.gov/32182833" }, { "database": "PubMed", "id": "32188095", "url": "https://pubmed.ncbi.nlm.nih.gov/32188095" }, { "database": "PubMed", "id": "32242230", "url": "https://pubmed.ncbi.nlm.nih.gov/32242230" }, { "database": "PubMed", "id": "32252311", "url": "https://pubmed.ncbi.nlm.nih.gov/32252311" }, { "database": "PubMed", "id": "32257917", "url": "https://pubmed.ncbi.nlm.nih.gov/32257917" }, { "database": "PubMed", "id": "32273843", "url": "https://pubmed.ncbi.nlm.nih.gov/32273843" }, { "database": "PubMed", "id": "32365859", "url": "https://pubmed.ncbi.nlm.nih.gov/32365859" }, { "database": "PubMed", "id": "32391256", "url": "https://pubmed.ncbi.nlm.nih.gov/32391256" }, { "database": "PubMed", "id": "32422984", "url": "https://pubmed.ncbi.nlm.nih.gov/32422984" }, { "database": "PubMed", "id": "32450513", "url": "https://pubmed.ncbi.nlm.nih.gov/32450513" }, { "database": "PubMed", "id": "32456348", "url": "https://pubmed.ncbi.nlm.nih.gov/32456348" }, { "database": "PubMed", "id": "32475380", "url": "https://pubmed.ncbi.nlm.nih.gov/32475380" }, { "database": "PubMed", "id": "32483468", "url": "https://pubmed.ncbi.nlm.nih.gov/32483468" }, { "database": "PubMed", "id": "32491253", "url": "https://pubmed.ncbi.nlm.nih.gov/32491253" }, { "database": "PubMed", "id": "32495998", "url": "https://pubmed.ncbi.nlm.nih.gov/32495998" }, { "database": "PubMed", "id": "32517717", "url": "https://pubmed.ncbi.nlm.nih.gov/32517717" }, { "database": "PubMed", "id": "32526010", "url": "https://pubmed.ncbi.nlm.nih.gov/32526010" }, { "database": "PubMed", "id": "32528731", "url": "https://pubmed.ncbi.nlm.nih.gov/32528731" }, { "database": "PubMed", "id": "32580970", "url": "https://pubmed.ncbi.nlm.nih.gov/32580970" }, { "database": "PubMed", "id": "32587662", "url": "https://pubmed.ncbi.nlm.nih.gov/32587662" }, { "database": "PubMed", "id": "32589311", "url": "https://pubmed.ncbi.nlm.nih.gov/32589311" }, { "database": "PubMed", "id": "32641029", "url": "https://pubmed.ncbi.nlm.nih.gov/32641029" }, { "database": "PubMed", "id": "32657763", "url": "https://pubmed.ncbi.nlm.nih.gov/32657763" }, { "database": "PubMed", "id": "32667731", "url": "https://pubmed.ncbi.nlm.nih.gov/32667731" }, { "database": "PubMed", "id": "32716315", "url": "https://pubmed.ncbi.nlm.nih.gov/32716315" }, { "database": "PubMed", "id": "32721246", "url": "https://pubmed.ncbi.nlm.nih.gov/32721246" }, { "database": "PubMed", "id": "32735617", "url": "https://pubmed.ncbi.nlm.nih.gov/32735617" }, { "database": "PubMed", "id": "32751884", "url": "https://pubmed.ncbi.nlm.nih.gov/32751884" }, { "database": "PubMed", "id": "32754441", "url": "https://pubmed.ncbi.nlm.nih.gov/32754441" }, { "database": "PubMed", "id": "32766155", "url": "https://pubmed.ncbi.nlm.nih.gov/32766155" }, { "database": "PubMed", "id": "32767999", "url": "https://pubmed.ncbi.nlm.nih.gov/32767999" }, { "database": "PubMed", "id": "32807795", "url": "https://pubmed.ncbi.nlm.nih.gov/32807795" }, { "database": "PubMed", "id": "32811873", "url": "https://pubmed.ncbi.nlm.nih.gov/32811873" }, { "database": "PubMed", "id": "32850477", "url": "https://pubmed.ncbi.nlm.nih.gov/32850477" }, { "database": "PubMed", "id": "32852592", "url": "https://pubmed.ncbi.nlm.nih.gov/32852592" }, { "database": "PubMed", "id": "32863764", "url": "https://pubmed.ncbi.nlm.nih.gov/32863764" }, { "database": "PubMed", "id": "32868906", "url": "https://pubmed.ncbi.nlm.nih.gov/32868906" }, { "database": "PubMed", "id": "32877289", "url": "https://pubmed.ncbi.nlm.nih.gov/32877289" }, { "database": "PubMed", "id": "32885530", "url": "https://pubmed.ncbi.nlm.nih.gov/32885530" }, { "database": "PubMed", "id": "32908147", "url": "https://pubmed.ncbi.nlm.nih.gov/32908147" }, { "database": "PubMed", "id": "32922036", "url": "https://pubmed.ncbi.nlm.nih.gov/32922036" }, { "database": "PubMed", "id": "32929201", "url": "https://pubmed.ncbi.nlm.nih.gov/32929201" }, { "database": "PubMed", "id": "32961646", "url": "https://pubmed.ncbi.nlm.nih.gov/32961646" }, { "database": "PubMed", "id": "32971907", "url": "https://pubmed.ncbi.nlm.nih.gov/32971907" }, { "database": "PubMed", "id": "32972460", "url": "https://pubmed.ncbi.nlm.nih.gov/32972460" }, { "database": "PubMed", "id": "32973302", "url": "https://pubmed.ncbi.nlm.nih.gov/32973302" }, { "database": "PubMed", "id": "33015502", "url": "https://pubmed.ncbi.nlm.nih.gov/33015502" }, { "database": "PubMed", "id": "33038372", "url": "https://pubmed.ncbi.nlm.nih.gov/33038372" }, { "database": "PubMed", "id": "33040485", "url": "https://pubmed.ncbi.nlm.nih.gov/33040485" }, { "database": "PubMed", "id": "33042115", "url": "https://pubmed.ncbi.nlm.nih.gov/33042115" }, { "database": "PubMed", "id": "33053804", "url": "https://pubmed.ncbi.nlm.nih.gov/33053804" }, { "database": "PubMed", "id": "33061855", "url": "https://pubmed.ncbi.nlm.nih.gov/33061855" }, { "database": "PubMed", "id": "33066004", "url": "https://pubmed.ncbi.nlm.nih.gov/33066004" }, { "database": "PubMed", "id": "33101052", "url": "https://pubmed.ncbi.nlm.nih.gov/33101052" }, { "database": "PubMed", "id": "33140053", "url": "https://pubmed.ncbi.nlm.nih.gov/33140053" }, { "database": "PubMed", "id": "33144502", "url": "https://pubmed.ncbi.nlm.nih.gov/33144502" }, { "database": "PubMed", "id": "33164240", "url": "https://pubmed.ncbi.nlm.nih.gov/33164240" }, { "database": "PubMed", "id": "33174044", "url": "https://pubmed.ncbi.nlm.nih.gov/33174044" }, { "database": "PubMed", "id": "33178223", "url": "https://pubmed.ncbi.nlm.nih.gov/33178223" }, { "database": "PubMed", "id": "33193827", "url": "https://pubmed.ncbi.nlm.nih.gov/33193827" }, { "database": "PubMed", "id": "33217668", "url": "https://pubmed.ncbi.nlm.nih.gov/33217668" }, { "database": "PubMed", "id": "33249747", "url": "https://pubmed.ncbi.nlm.nih.gov/33249747" }, { "database": "PubMed", "id": "33257655", "url": "https://pubmed.ncbi.nlm.nih.gov/33257655" }, { "database": "PubMed", "id": "33259114", "url": "https://pubmed.ncbi.nlm.nih.gov/33259114" }, { "database": "PubMed", "id": "33262462", "url": "https://pubmed.ncbi.nlm.nih.gov/33262462" }, { "database": "PubMed", "id": "33274592", "url": "https://pubmed.ncbi.nlm.nih.gov/33274592" }, { "database": "PubMed", "id": "33277798", "url": "https://pubmed.ncbi.nlm.nih.gov/33277798" }, { "database": "PubMed", "id": "33279931", "url": "https://pubmed.ncbi.nlm.nih.gov/33279931" }, { "database": "PubMed", "id": "33281966", "url": "https://pubmed.ncbi.nlm.nih.gov/33281966" }, { "database": "PubMed", "id": "33291686", "url": "https://pubmed.ncbi.nlm.nih.gov/33291686" }, { "database": "PubMed", "id": "33293765", "url": "https://pubmed.ncbi.nlm.nih.gov/33293765" }, { "database": "PubMed", "id": "33380422", "url": "https://pubmed.ncbi.nlm.nih.gov/33380422" }, { "database": "PubMed", "id": "33391507", "url": "https://pubmed.ncbi.nlm.nih.gov/33391507" }, { "database": "PubMed", "id": "33392396", "url": "https://pubmed.ncbi.nlm.nih.gov/33392396" }, { "database": "PubMed", "id": "33420372", "url": "https://pubmed.ncbi.nlm.nih.gov/33420372" }, { "database": "PubMed", "id": "33440995", "url": "https://pubmed.ncbi.nlm.nih.gov/33440995" }, { "database": "PubMed", "id": "33448097", "url": "https://pubmed.ncbi.nlm.nih.gov/33448097" }, { "database": "PubMed", "id": "33450849", "url": "https://pubmed.ncbi.nlm.nih.gov/33450849" }, { "database": "PubMed", "id": "33469308", "url": "https://pubmed.ncbi.nlm.nih.gov/33469308" }, { "database": "PubMed", "id": "33513694", "url": "https://pubmed.ncbi.nlm.nih.gov/33513694" }, { "database": "PubMed", "id": "33517393", "url": "https://pubmed.ncbi.nlm.nih.gov/33517393" }, { "database": "PubMed", "id": "33529218", "url": "https://pubmed.ncbi.nlm.nih.gov/33529218" }, { "database": "PubMed", "id": "33541421", "url": "https://pubmed.ncbi.nlm.nih.gov/33541421" }, { "database": "PubMed", "id": "33640759", "url": "https://pubmed.ncbi.nlm.nih.gov/33640759" }, { "database": "PubMed", "id": "33658640", "url": "https://pubmed.ncbi.nlm.nih.gov/33658640" }, { "database": "PubMed", "id": "33660414", "url": "https://pubmed.ncbi.nlm.nih.gov/33660414" }, { "database": "PubMed", "id": "33669259", "url": "https://pubmed.ncbi.nlm.nih.gov/33669259" }, { "database": "PubMed", "id": "33669634", "url": "https://pubmed.ncbi.nlm.nih.gov/33669634" }, { "database": "PubMed", "id": "33772065", "url": "https://pubmed.ncbi.nlm.nih.gov/33772065" }, { "database": "PubMed", "id": "33818016", "url": "https://pubmed.ncbi.nlm.nih.gov/33818016" }, { "database": "PubMed", "id": "33824475", "url": "https://pubmed.ncbi.nlm.nih.gov/33824475" }, { "database": "PubMed", "id": "33839684", "url": "https://pubmed.ncbi.nlm.nih.gov/33839684" }, { "database": "PubMed", "id": "33909625", "url": "https://pubmed.ncbi.nlm.nih.gov/33909625" }, { "database": "PubMed", "id": "33920736", "url": "https://pubmed.ncbi.nlm.nih.gov/33920736" }, { "database": "PubMed", "id": "33924087", "url": "https://pubmed.ncbi.nlm.nih.gov/33924087" }, { "database": "PubMed", "id": "33968084", "url": "https://pubmed.ncbi.nlm.nih.gov/33968084" }, { "database": "PubMed", "id": "33986510", "url": "https://pubmed.ncbi.nlm.nih.gov/33986510" }, { "database": "PubMed", "id": "34067421", "url": "https://pubmed.ncbi.nlm.nih.gov/34067421" }, { "database": "PubMed", "id": "34440160", "url": "https://pubmed.ncbi.nlm.nih.gov/34440160" }, { "database": "PubMed", "id": "34908808", "url": "https://pubmed.ncbi.nlm.nih.gov/34908808" }, { "database": "PubMed", "id": "35131454", "url": "https://pubmed.ncbi.nlm.nih.gov/35131454" }, { "database": "PubMed", "id": "35184394", "url": "https://pubmed.ncbi.nlm.nih.gov/35184394" }, { "database": "PubMed", "id": "35200033", "url": "https://pubmed.ncbi.nlm.nih.gov/35200033" }, { "database": "PubMed", "id": "35476936", "url": "https://pubmed.ncbi.nlm.nih.gov/35476936" }, { "database": "PubMed", "id": "35566660", "url": "https://pubmed.ncbi.nlm.nih.gov/35566660" }, { "database": "PubMed", "id": "35670018", "url": "https://pubmed.ncbi.nlm.nih.gov/35670018" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "35722967", "url": "https://pubmed.ncbi.nlm.nih.gov/35722967" }, { "database": "PubMed", "id": "35756080", "url": "https://pubmed.ncbi.nlm.nih.gov/35756080" }, { "database": "PubMed", "id": "35809767", "url": "https://pubmed.ncbi.nlm.nih.gov/35809767" }, { "database": "PubMed", "id": "35932642", "url": "https://pubmed.ncbi.nlm.nih.gov/35932642" }, { "database": "PubMed", "id": "36017196", "url": "https://pubmed.ncbi.nlm.nih.gov/36017196" }, { "database": "PubMed", "id": "36068200", "url": "https://pubmed.ncbi.nlm.nih.gov/36068200" }, { "database": "PubMed", "id": "36103247", "url": "https://pubmed.ncbi.nlm.nih.gov/36103247" }, { "database": "PubMed", "id": "36179418", "url": "https://pubmed.ncbi.nlm.nih.gov/36179418" }, { "database": "PubMed", "id": "36207761", "url": "https://pubmed.ncbi.nlm.nih.gov/36207761" }, { "database": "PubMed", "id": "36282975", "url": "https://pubmed.ncbi.nlm.nih.gov/36282975" }, { "database": "PubMed", "id": "36362294", "url": "https://pubmed.ncbi.nlm.nih.gov/36362294" }, { "database": "PubMed", "id": "9531474", "url": "https://pubmed.ncbi.nlm.nih.gov/9531474" }, { "database": "PubMed", "id": "12637586", "url": "https://pubmed.ncbi.nlm.nih.gov/12637586" }, { "database": "PubMed", "id": "15592455", "url": "https://pubmed.ncbi.nlm.nih.gov/15592455" }, { "database": "PubMed", "id": "16568091", "url": "https://pubmed.ncbi.nlm.nih.gov/16568091" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22306293", "url": "https://pubmed.ncbi.nlm.nih.gov/22306293" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "26293184", "url": "https://pubmed.ncbi.nlm.nih.gov/26293184" }, { "database": "PubMed", "id": "31899195", "url": "https://pubmed.ncbi.nlm.nih.gov/31899195" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" }, { "start_pos": 701, "end_pos": 701, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by JAK1, JAK2 or TYK2", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7657660", "url": "https://pubmed.ncbi.nlm.nih.gov/7657660" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "IntAct", "id": "P42224", "url": "https://www.ebi.ac.uk/intact/interactors/id:P42224*" }, { "database": "PubMed", "id": "8605877", "url": "https://pubmed.ncbi.nlm.nih.gov/8605877" }, { "database": "PubMed", "id": "9630226", "url": "https://pubmed.ncbi.nlm.nih.gov/9630226" }, { "database": "PubMed", "id": "24255956", "url": "https://pubmed.ncbi.nlm.nih.gov/24255956" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10453004", "url": "https://pubmed.ncbi.nlm.nih.gov/10453004" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "11023524", "url": "https://pubmed.ncbi.nlm.nih.gov/11023524" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11641425", "url": "https://pubmed.ncbi.nlm.nih.gov/11641425" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11886239", "url": "https://pubmed.ncbi.nlm.nih.gov/11886239" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12223098", "url": "https://pubmed.ncbi.nlm.nih.gov/12223098" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12804067", "url": "https://pubmed.ncbi.nlm.nih.gov/12804067" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14978237", "url": "https://pubmed.ncbi.nlm.nih.gov/14978237" }, { "database": "PubMed", "id": "15140960", "url": "https://pubmed.ncbi.nlm.nih.gov/15140960" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15284024", "url": "https://pubmed.ncbi.nlm.nih.gov/15284024" }, { "database": "PubMed", "id": "15297606", "url": "https://pubmed.ncbi.nlm.nih.gov/15297606" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16314732", "url": "https://pubmed.ncbi.nlm.nih.gov/16314732" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16418217", "url": "https://pubmed.ncbi.nlm.nih.gov/16418217" }, { "database": "PubMed", "id": "16729885", "url": "https://pubmed.ncbi.nlm.nih.gov/16729885" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "16934001", "url": "https://pubmed.ncbi.nlm.nih.gov/16934001" }, { "database": "PubMed", "id": "17072862", "url": "https://pubmed.ncbi.nlm.nih.gov/17072862" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17237409", "url": "https://pubmed.ncbi.nlm.nih.gov/17237409" }, { "database": "PubMed", "id": "17277783", "url": "https://pubmed.ncbi.nlm.nih.gov/17277783" }, { "database": "PubMed", "id": "17325127", "url": "https://pubmed.ncbi.nlm.nih.gov/17325127" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17488182", "url": "https://pubmed.ncbi.nlm.nih.gov/17488182" }, { "database": "PubMed", "id": "17525742", "url": "https://pubmed.ncbi.nlm.nih.gov/17525742" }, { "database": "PubMed", "id": "17579625", "url": "https://pubmed.ncbi.nlm.nih.gov/17579625" }, { "database": "PubMed", "id": "17622177", "url": "https://pubmed.ncbi.nlm.nih.gov/17622177" }, { "database": "PubMed", "id": "17696225", "url": "https://pubmed.ncbi.nlm.nih.gov/17696225" }, { "database": "PubMed", "id": "17785551", "url": "https://pubmed.ncbi.nlm.nih.gov/17785551" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17986321", "url": "https://pubmed.ncbi.nlm.nih.gov/17986321" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19052084", "url": "https://pubmed.ncbi.nlm.nih.gov/19052084" }, { "database": "PubMed", "id": "19088846", "url": "https://pubmed.ncbi.nlm.nih.gov/19088846" }, { "database": "PubMed", "id": "19174562", "url": "https://pubmed.ncbi.nlm.nih.gov/19174562" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19367337", "url": "https://pubmed.ncbi.nlm.nih.gov/19367337" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19397895", "url": "https://pubmed.ncbi.nlm.nih.gov/19397895" }, { "database": "PubMed", "id": "19404407", "url": "https://pubmed.ncbi.nlm.nih.gov/19404407" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20006573", "url": "https://pubmed.ncbi.nlm.nih.gov/20006573" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20738848", "url": "https://pubmed.ncbi.nlm.nih.gov/20738848" }, { "database": "PubMed", "id": "20974954", "url": "https://pubmed.ncbi.nlm.nih.gov/20974954" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21311224", "url": "https://pubmed.ncbi.nlm.nih.gov/21311224" }, { "database": "PubMed", "id": "21345084", "url": "https://pubmed.ncbi.nlm.nih.gov/21345084" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21545749", "url": "https://pubmed.ncbi.nlm.nih.gov/21545749" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21968657", "url": "https://pubmed.ncbi.nlm.nih.gov/21968657" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22038826", "url": "https://pubmed.ncbi.nlm.nih.gov/22038826" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22306001", "url": "https://pubmed.ncbi.nlm.nih.gov/22306001" }, { "database": "PubMed", "id": "22355301", "url": "https://pubmed.ncbi.nlm.nih.gov/22355301" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22527947", "url": "https://pubmed.ncbi.nlm.nih.gov/22527947" }, { "database": "PubMed", "id": "22788969", "url": "https://pubmed.ncbi.nlm.nih.gov/22788969" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23043228", "url": "https://pubmed.ncbi.nlm.nih.gov/23043228" }, { "database": "PubMed", "id": "23086340", "url": "https://pubmed.ncbi.nlm.nih.gov/23086340" }, { "database": "PubMed", "id": "23174178", "url": "https://pubmed.ncbi.nlm.nih.gov/23174178" }, { "database": "PubMed", "id": "23178573", "url": "https://pubmed.ncbi.nlm.nih.gov/23178573" }, { "database": "PubMed", "id": "23221969", "url": "https://pubmed.ncbi.nlm.nih.gov/23221969" }, { "database": "PubMed", "id": "23245396", "url": "https://pubmed.ncbi.nlm.nih.gov/23245396" }, { "database": "PubMed", "id": "23257612", "url": "https://pubmed.ncbi.nlm.nih.gov/23257612" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23580655", "url": "https://pubmed.ncbi.nlm.nih.gov/23580655" }, { "database": "PubMed", "id": "23633948", "url": "https://pubmed.ncbi.nlm.nih.gov/23633948" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23917221", "url": "https://pubmed.ncbi.nlm.nih.gov/23917221" }, { "database": "PubMed", "id": "24014650", "url": "https://pubmed.ncbi.nlm.nih.gov/24014650" }, { "database": "PubMed", "id": "24065129", "url": "https://pubmed.ncbi.nlm.nih.gov/24065129" }, { "database": "PubMed", "id": "24131713", "url": "https://pubmed.ncbi.nlm.nih.gov/24131713" }, { "database": "PubMed", "id": "24166946", "url": "https://pubmed.ncbi.nlm.nih.gov/24166946" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24646078", "url": "https://pubmed.ncbi.nlm.nih.gov/24646078" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24728078", "url": "https://pubmed.ncbi.nlm.nih.gov/24728078" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24839978", "url": "https://pubmed.ncbi.nlm.nih.gov/24839978" }, { "database": "PubMed", "id": "24886089", "url": "https://pubmed.ncbi.nlm.nih.gov/24886089" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25170834", "url": "https://pubmed.ncbi.nlm.nih.gov/25170834" }, { "database": "PubMed", "id": "25271420", "url": "https://pubmed.ncbi.nlm.nih.gov/25271420" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25690042", "url": "https://pubmed.ncbi.nlm.nih.gov/25690042" }, { "database": "PubMed", "id": "25858560", "url": "https://pubmed.ncbi.nlm.nih.gov/25858560" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26155422", "url": "https://pubmed.ncbi.nlm.nih.gov/26155422" }, { "database": "PubMed", "id": "26232434", "url": "https://pubmed.ncbi.nlm.nih.gov/26232434" }, { "database": "PubMed", "id": "26265185", "url": "https://pubmed.ncbi.nlm.nih.gov/26265185" }, { "database": "PubMed", "id": "26342467", "url": "https://pubmed.ncbi.nlm.nih.gov/26342467" }, { "database": "PubMed", "id": "26351076", "url": "https://pubmed.ncbi.nlm.nih.gov/26351076" }, { "database": "PubMed", "id": "26604104", "url": "https://pubmed.ncbi.nlm.nih.gov/26604104" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "26839680", "url": "https://pubmed.ncbi.nlm.nih.gov/26839680" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27080594", "url": "https://pubmed.ncbi.nlm.nih.gov/27080594" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27457515", "url": "https://pubmed.ncbi.nlm.nih.gov/27457515" }, { "database": "PubMed", "id": "27486982", "url": "https://pubmed.ncbi.nlm.nih.gov/27486982" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28059079", "url": "https://pubmed.ncbi.nlm.nih.gov/28059079" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28859974", "url": "https://pubmed.ncbi.nlm.nih.gov/28859974" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29270166", "url": "https://pubmed.ncbi.nlm.nih.gov/29270166" }, { "database": "PubMed", "id": "29348488", "url": "https://pubmed.ncbi.nlm.nih.gov/29348488" }, { "database": "PubMed", "id": "29371942", "url": "https://pubmed.ncbi.nlm.nih.gov/29371942" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29474442", "url": "https://pubmed.ncbi.nlm.nih.gov/29474442" }, { "database": "PubMed", "id": "29540832", "url": "https://pubmed.ncbi.nlm.nih.gov/29540832" }, { "database": "PubMed", "id": "29604049", "url": "https://pubmed.ncbi.nlm.nih.gov/29604049" }, { "database": "PubMed", "id": "29686406", "url": "https://pubmed.ncbi.nlm.nih.gov/29686406" }, { "database": "PubMed", "id": "29691476", "url": "https://pubmed.ncbi.nlm.nih.gov/29691476" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "29893425", "url": "https://pubmed.ncbi.nlm.nih.gov/29893425" }, { "database": "PubMed", "id": "29925830", "url": "https://pubmed.ncbi.nlm.nih.gov/29925830" }, { "database": "PubMed", "id": "29930380", "url": "https://pubmed.ncbi.nlm.nih.gov/29930380" }, { "database": "PubMed", "id": "29946223", "url": "https://pubmed.ncbi.nlm.nih.gov/29946223" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30150992", "url": "https://pubmed.ncbi.nlm.nih.gov/30150992" }, { "database": "PubMed", "id": "30323286", "url": "https://pubmed.ncbi.nlm.nih.gov/30323286" }, { "database": "PubMed", "id": "30373602", "url": "https://pubmed.ncbi.nlm.nih.gov/30373602" }, { "database": "PubMed", "id": "30455980", "url": "https://pubmed.ncbi.nlm.nih.gov/30455980" }, { "database": "PubMed", "id": "30619249", "url": "https://pubmed.ncbi.nlm.nih.gov/30619249" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30940163", "url": "https://pubmed.ncbi.nlm.nih.gov/30940163" }, { "database": "PubMed", "id": "30952894", "url": "https://pubmed.ncbi.nlm.nih.gov/30952894" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31202985", "url": "https://pubmed.ncbi.nlm.nih.gov/31202985" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31804622", "url": "https://pubmed.ncbi.nlm.nih.gov/31804622" }, { "database": "PubMed", "id": "31840082", "url": "https://pubmed.ncbi.nlm.nih.gov/31840082" }, { "database": "PubMed", "id": "31846457", "url": "https://pubmed.ncbi.nlm.nih.gov/31846457" }, { "database": "PubMed", "id": "31918717", "url": "https://pubmed.ncbi.nlm.nih.gov/31918717" }, { "database": "PubMed", "id": "32032660", "url": "https://pubmed.ncbi.nlm.nih.gov/32032660" }, { "database": "PubMed", "id": "32123171", "url": "https://pubmed.ncbi.nlm.nih.gov/32123171" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32196427", "url": "https://pubmed.ncbi.nlm.nih.gov/32196427" }, { "database": "PubMed", "id": "32286295", "url": "https://pubmed.ncbi.nlm.nih.gov/32286295" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32420725", "url": "https://pubmed.ncbi.nlm.nih.gov/32420725" }, { "database": "PubMed", "id": "32606936", "url": "https://pubmed.ncbi.nlm.nih.gov/32606936" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32696599", "url": "https://pubmed.ncbi.nlm.nih.gov/32696599" }, { "database": "PubMed", "id": "32792604", "url": "https://pubmed.ncbi.nlm.nih.gov/32792604" }, { "database": "PubMed", "id": "32831137", "url": "https://pubmed.ncbi.nlm.nih.gov/32831137" }, { "database": "PubMed", "id": "32864202", "url": "https://pubmed.ncbi.nlm.nih.gov/32864202" }, { "database": "PubMed", "id": "32938761", "url": "https://pubmed.ncbi.nlm.nih.gov/32938761" }, { "database": "PubMed", "id": "33046973", "url": "https://pubmed.ncbi.nlm.nih.gov/33046973" }, { "database": "PubMed", "id": "33208444", "url": "https://pubmed.ncbi.nlm.nih.gov/33208444" }, { "database": "PubMed", "id": "33361763", "url": "https://pubmed.ncbi.nlm.nih.gov/33361763" }, { "database": "PubMed", "id": "33389635", "url": "https://pubmed.ncbi.nlm.nih.gov/33389635" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33504682", "url": "https://pubmed.ncbi.nlm.nih.gov/33504682" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33644712", "url": "https://pubmed.ncbi.nlm.nih.gov/33644712" }, { "database": "PubMed", "id": "33734579", "url": "https://pubmed.ncbi.nlm.nih.gov/33734579" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "33815425", "url": "https://pubmed.ncbi.nlm.nih.gov/33815425" }, { "database": "PubMed", "id": "35537286", "url": "https://pubmed.ncbi.nlm.nih.gov/35537286" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "7592750", "url": "https://pubmed.ncbi.nlm.nih.gov/7592750" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "8940092", "url": "https://pubmed.ncbi.nlm.nih.gov/8940092" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "9724754", "url": "https://pubmed.ncbi.nlm.nih.gov/9724754" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" }, { "database": "PubMed", "id": "27796300", "url": "https://pubmed.ncbi.nlm.nih.gov/27796300" }, { "database": "PubMed", "id": "28753426", "url": "https://pubmed.ncbi.nlm.nih.gov/28753426" }, { "database": "PubMed", "id": "17561467", "url": "https://pubmed.ncbi.nlm.nih.gov/17561467" } ], "site_lbl": "Tyr701", "uniprot_canonical_ac": "P42224-1" }, { "start_pos": 727, "end_pos": 727, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CaMK2, CDK8 and MAPK14", "evidence": [ { "database": "UniProtKB", "id": "P42224", "url": "https://www.uniprot.org/uniprotkb/P42224" }, { "database": "iPTMnet", "id": "P42224", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P42224" }, { "database": "PubMed", "id": "11839738", "url": "https://pubmed.ncbi.nlm.nih.gov/11839738" }, { "database": "PubMed", "id": "11972023", "url": "https://pubmed.ncbi.nlm.nih.gov/11972023" }, { "database": "PubMed", "id": "12637327", "url": "https://pubmed.ncbi.nlm.nih.gov/12637327" }, { "database": "PubMed", "id": "14963018", "url": "https://pubmed.ncbi.nlm.nih.gov/14963018" }, { "database": "PubMed", "id": "15322115", "url": "https://pubmed.ncbi.nlm.nih.gov/15322115" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "7543024", "url": "https://pubmed.ncbi.nlm.nih.gov/7543024" }, { "database": "PubMed", "id": "7690989", "url": "https://pubmed.ncbi.nlm.nih.gov/7690989" }, { "database": "PubMed", "id": "9355737", "url": "https://pubmed.ncbi.nlm.nih.gov/9355737" }, { "database": "PubMed", "id": "16799645", "url": "https://pubmed.ncbi.nlm.nih.gov/16799645" }, { "database": "PRO", "id": "P42224", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P42224" }, { "database": "PubMed", "id": "10329948", "url": "https://pubmed.ncbi.nlm.nih.gov/10329948" }, { "database": "PubMed", "id": "10383940", "url": "https://pubmed.ncbi.nlm.nih.gov/10383940" }, { "database": "PubMed", "id": "10523304", "url": "https://pubmed.ncbi.nlm.nih.gov/10523304" }, { "database": "PubMed", "id": "10542198", "url": "https://pubmed.ncbi.nlm.nih.gov/10542198" }, { "database": "PubMed", "id": "10570180", "url": "https://pubmed.ncbi.nlm.nih.gov/10570180" }, { "database": "PubMed", "id": "10645003", "url": "https://pubmed.ncbi.nlm.nih.gov/10645003" }, { "database": "PubMed", "id": "10748192", "url": "https://pubmed.ncbi.nlm.nih.gov/10748192" }, { "database": "PubMed", "id": "10753717", "url": "https://pubmed.ncbi.nlm.nih.gov/10753717" }, { "database": "PubMed", "id": "10820245", "url": "https://pubmed.ncbi.nlm.nih.gov/10820245" }, { "database": "PubMed", "id": "10878008", "url": "https://pubmed.ncbi.nlm.nih.gov/10878008" }, { "database": "PubMed", "id": "10918594", "url": "https://pubmed.ncbi.nlm.nih.gov/10918594" }, { "database": "PubMed", "id": "10940874", "url": "https://pubmed.ncbi.nlm.nih.gov/10940874" }, { "database": "PubMed", "id": "11309387", "url": "https://pubmed.ncbi.nlm.nih.gov/11309387" }, { "database": "PubMed", "id": "11438544", "url": "https://pubmed.ncbi.nlm.nih.gov/11438544" }, { "database": "PubMed", "id": "11675348", "url": "https://pubmed.ncbi.nlm.nih.gov/11675348" }, { "database": "PubMed", "id": "11777927", "url": "https://pubmed.ncbi.nlm.nih.gov/11777927" }, { "database": "PubMed", "id": "11884587", "url": "https://pubmed.ncbi.nlm.nih.gov/11884587" }, { "database": "PubMed", "id": "12068083", "url": "https://pubmed.ncbi.nlm.nih.gov/12068083" }, { "database": "PubMed", "id": "12232043", "url": "https://pubmed.ncbi.nlm.nih.gov/12232043" }, { "database": "PubMed", "id": "12232802", "url": "https://pubmed.ncbi.nlm.nih.gov/12232802" }, { "database": "PubMed", "id": "12526087", "url": "https://pubmed.ncbi.nlm.nih.gov/12526087" }, { "database": "PubMed", "id": "12748293", "url": "https://pubmed.ncbi.nlm.nih.gov/12748293" }, { "database": "PubMed", "id": "12799548", "url": "https://pubmed.ncbi.nlm.nih.gov/12799548" }, { "database": "PubMed", "id": "12807916", "url": "https://pubmed.ncbi.nlm.nih.gov/12807916" }, { "database": "PubMed", "id": "12811837", "url": "https://pubmed.ncbi.nlm.nih.gov/12811837" }, { "database": "PubMed", "id": "12817007", "url": "https://pubmed.ncbi.nlm.nih.gov/12817007" }, { "database": "PubMed", "id": "12856330", "url": "https://pubmed.ncbi.nlm.nih.gov/12856330" }, { "database": "PubMed", "id": "12883649", "url": "https://pubmed.ncbi.nlm.nih.gov/12883649" }, { "database": "PubMed", "id": "12971583", "url": "https://pubmed.ncbi.nlm.nih.gov/12971583" }, { "database": "PubMed", "id": "14648593", "url": "https://pubmed.ncbi.nlm.nih.gov/14648593" }, { "database": "PubMed", "id": "15182726", "url": "https://pubmed.ncbi.nlm.nih.gov/15182726" }, { "database": "PubMed", "id": "15585657", "url": "https://pubmed.ncbi.nlm.nih.gov/15585657" }, { "database": "PubMed", "id": "15695932", "url": "https://pubmed.ncbi.nlm.nih.gov/15695932" }, { "database": "PubMed", "id": "15728510", "url": "https://pubmed.ncbi.nlm.nih.gov/15728510" }, { "database": "PubMed", "id": "15850832", "url": "https://pubmed.ncbi.nlm.nih.gov/15850832" }, { "database": "PubMed", "id": "15994321", "url": "https://pubmed.ncbi.nlm.nih.gov/15994321" }, { "database": "PubMed", "id": "15994429", "url": "https://pubmed.ncbi.nlm.nih.gov/15994429" }, { "database": "PubMed", "id": "16059651", "url": "https://pubmed.ncbi.nlm.nih.gov/16059651" }, { "database": "PubMed", "id": "16204068", "url": "https://pubmed.ncbi.nlm.nih.gov/16204068" }, { "database": "PubMed", "id": "16257975", "url": "https://pubmed.ncbi.nlm.nih.gov/16257975" }, { "database": "PubMed", "id": "16260419", "url": "https://pubmed.ncbi.nlm.nih.gov/16260419" }, { "database": "PubMed", "id": "16324217", "url": "https://pubmed.ncbi.nlm.nih.gov/16324217" }, { "database": "PubMed", "id": "16343349", "url": "https://pubmed.ncbi.nlm.nih.gov/16343349" }, { "database": "PubMed", "id": "16516295", "url": "https://pubmed.ncbi.nlm.nih.gov/16516295" }, { "database": "PubMed", "id": "16918696", "url": "https://pubmed.ncbi.nlm.nih.gov/16918696" }, { "database": "PubMed", "id": "17075845", "url": "https://pubmed.ncbi.nlm.nih.gov/17075845" }, { "database": "PubMed", "id": "17258468", "url": "https://pubmed.ncbi.nlm.nih.gov/17258468" }, { "database": "PubMed", "id": "17293456", "url": "https://pubmed.ncbi.nlm.nih.gov/17293456" }, { "database": "PubMed", "id": "17371985", "url": "https://pubmed.ncbi.nlm.nih.gov/17371985" }, { "database": "PubMed", "id": "17383622", "url": "https://pubmed.ncbi.nlm.nih.gov/17383622" }, { "database": "PubMed", "id": "17565448", "url": "https://pubmed.ncbi.nlm.nih.gov/17565448" }, { "database": "PubMed", "id": "17785783", "url": "https://pubmed.ncbi.nlm.nih.gov/17785783" }, { "database": "PubMed", "id": "17897103", "url": "https://pubmed.ncbi.nlm.nih.gov/17897103" }, { "database": "PubMed", "id": "17933493", "url": "https://pubmed.ncbi.nlm.nih.gov/17933493" }, { "database": "PubMed", "id": "18190974", "url": "https://pubmed.ncbi.nlm.nih.gov/18190974" }, { "database": "PubMed", "id": "18378670", "url": "https://pubmed.ncbi.nlm.nih.gov/18378670" }, { "database": "PubMed", "id": "18574148", "url": "https://pubmed.ncbi.nlm.nih.gov/18574148" }, { "database": "PubMed", "id": "18817573", "url": "https://pubmed.ncbi.nlm.nih.gov/18817573" }, { "database": "PubMed", "id": "18941537", "url": "https://pubmed.ncbi.nlm.nih.gov/18941537" }, { "database": "PubMed", "id": "19214187", "url": "https://pubmed.ncbi.nlm.nih.gov/19214187" }, { "database": "PubMed", "id": "19349465", "url": "https://pubmed.ncbi.nlm.nih.gov/19349465" }, { "database": "PubMed", "id": "19396596", "url": "https://pubmed.ncbi.nlm.nih.gov/19396596" }, { "database": "PubMed", "id": "19502801", "url": "https://pubmed.ncbi.nlm.nih.gov/19502801" }, { "database": "PubMed", "id": "19551150", "url": "https://pubmed.ncbi.nlm.nih.gov/19551150" }, { "database": "PubMed", "id": "19801665", "url": "https://pubmed.ncbi.nlm.nih.gov/19801665" }, { "database": "PubMed", "id": "19846878", "url": "https://pubmed.ncbi.nlm.nih.gov/19846878" }, { "database": "PubMed", "id": "19915063", "url": "https://pubmed.ncbi.nlm.nih.gov/19915063" }, { "database": "PubMed", "id": "20353823", "url": "https://pubmed.ncbi.nlm.nih.gov/20353823" }, { "database": "PubMed", "id": "20504369", "url": "https://pubmed.ncbi.nlm.nih.gov/20504369" }, { "database": "PubMed", "id": "20675591", "url": "https://pubmed.ncbi.nlm.nih.gov/20675591" }, { "database": "PubMed", "id": "21084836", "url": "https://pubmed.ncbi.nlm.nih.gov/21084836" }, { "database": "PubMed", "id": "21189227", "url": "https://pubmed.ncbi.nlm.nih.gov/21189227" }, { "database": "PubMed", "id": "21303487", "url": "https://pubmed.ncbi.nlm.nih.gov/21303487" }, { "database": "PubMed", "id": "21351482", "url": "https://pubmed.ncbi.nlm.nih.gov/21351482" }, { "database": "PubMed", "id": "21533215", "url": "https://pubmed.ncbi.nlm.nih.gov/21533215" }, { "database": "PubMed", "id": "21783819", "url": "https://pubmed.ncbi.nlm.nih.gov/21783819" }, { "database": "PubMed", "id": "21878628", "url": "https://pubmed.ncbi.nlm.nih.gov/21878628" }, { "database": "PubMed", "id": "21992896", "url": "https://pubmed.ncbi.nlm.nih.gov/21992896" }, { "database": "PubMed", "id": "21999474", "url": "https://pubmed.ncbi.nlm.nih.gov/21999474" }, { "database": "PubMed", "id": "22110204", "url": "https://pubmed.ncbi.nlm.nih.gov/22110204" }, { "database": "PubMed", "id": "22126015", "url": "https://pubmed.ncbi.nlm.nih.gov/22126015" }, { "database": "PubMed", "id": "22435755", "url": "https://pubmed.ncbi.nlm.nih.gov/22435755" }, { "database": "PubMed", "id": "22823229", "url": "https://pubmed.ncbi.nlm.nih.gov/22823229" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22996189", "url": "https://pubmed.ncbi.nlm.nih.gov/22996189" }, { "database": "PubMed", "id": "23013371", "url": "https://pubmed.ncbi.nlm.nih.gov/23013371" }, { "database": "PubMed", "id": "23349666", "url": "https://pubmed.ncbi.nlm.nih.gov/23349666" }, { "database": "PubMed", "id": "23352233", "url": "https://pubmed.ncbi.nlm.nih.gov/23352233" }, { "database": "PubMed", "id": "23449448", "url": "https://pubmed.ncbi.nlm.nih.gov/23449448" }, { "database": "PubMed", "id": "23597922", "url": "https://pubmed.ncbi.nlm.nih.gov/23597922" }, { "database": "PubMed", "id": "23637938", "url": "https://pubmed.ncbi.nlm.nih.gov/23637938" }, { "database": "PubMed", "id": "23760261", "url": "https://pubmed.ncbi.nlm.nih.gov/23760261" }, { "database": "PubMed", "id": "23825585", "url": "https://pubmed.ncbi.nlm.nih.gov/23825585" }, { "database": "PubMed", "id": "24449862", "url": "https://pubmed.ncbi.nlm.nih.gov/24449862" }, { "database": "PubMed", "id": "24699362", "url": "https://pubmed.ncbi.nlm.nih.gov/24699362" }, { "database": "PubMed", "id": "24725474", "url": "https://pubmed.ncbi.nlm.nih.gov/24725474" }, { "database": "PubMed", "id": "24788809", "url": "https://pubmed.ncbi.nlm.nih.gov/24788809" }, { "database": "PubMed", "id": "24838635", "url": "https://pubmed.ncbi.nlm.nih.gov/24838635" }, { "database": "PubMed", "id": "24911872", "url": "https://pubmed.ncbi.nlm.nih.gov/24911872" }, { "database": "PubMed", "id": "25226283", "url": "https://pubmed.ncbi.nlm.nih.gov/25226283" }, { "database": "PubMed", "id": "25340519", "url": "https://pubmed.ncbi.nlm.nih.gov/25340519" }, { "database": "PubMed", "id": "25535969", "url": "https://pubmed.ncbi.nlm.nih.gov/25535969" }, { "database": "PubMed", "id": "25686822", "url": "https://pubmed.ncbi.nlm.nih.gov/25686822" }, { "database": "PubMed", "id": "25753288", "url": "https://pubmed.ncbi.nlm.nih.gov/25753288" }, { "database": "PubMed", "id": "25941617", "url": "https://pubmed.ncbi.nlm.nih.gov/25941617" }, { "database": "PubMed", "id": "25950470", "url": "https://pubmed.ncbi.nlm.nih.gov/25950470" }, { "database": "PubMed", "id": "25995822", "url": "https://pubmed.ncbi.nlm.nih.gov/25995822" }, { "database": "PubMed", "id": "26113305", "url": "https://pubmed.ncbi.nlm.nih.gov/26113305" }, { "database": "PubMed", "id": "26141950", "url": "https://pubmed.ncbi.nlm.nih.gov/26141950" }, { "database": "PubMed", "id": "26735690", "url": "https://pubmed.ncbi.nlm.nih.gov/26735690" }, { "database": "PubMed", "id": "26783516", "url": "https://pubmed.ncbi.nlm.nih.gov/26783516" }, { "database": "PubMed", "id": "27074819", "url": "https://pubmed.ncbi.nlm.nih.gov/27074819" }, { "database": "PubMed", "id": "27387064", "url": "https://pubmed.ncbi.nlm.nih.gov/27387064" }, { "database": "PubMed", "id": "27434509", "url": "https://pubmed.ncbi.nlm.nih.gov/27434509" }, { "database": "PubMed", "id": "27791205", "url": "https://pubmed.ncbi.nlm.nih.gov/27791205" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28086195", "url": "https://pubmed.ncbi.nlm.nih.gov/28086195" }, { "database": "PubMed", "id": "28262979", "url": "https://pubmed.ncbi.nlm.nih.gov/28262979" }, { "database": "PubMed", "id": "28422713", "url": "https://pubmed.ncbi.nlm.nih.gov/28422713" }, { "database": "PubMed", "id": "28431406", "url": "https://pubmed.ncbi.nlm.nih.gov/28431406" }, { "database": "PubMed", "id": "28471454", "url": "https://pubmed.ncbi.nlm.nih.gov/28471454" }, { "database": "PubMed", "id": "28542650", "url": "https://pubmed.ncbi.nlm.nih.gov/28542650" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28560754", "url": "https://pubmed.ncbi.nlm.nih.gov/28560754" }, { "database": "PubMed", "id": "29239838", "url": "https://pubmed.ncbi.nlm.nih.gov/29239838" }, { "database": "PubMed", "id": "29374380", "url": "https://pubmed.ncbi.nlm.nih.gov/29374380" }, { "database": "PubMed", "id": "29751820", "url": "https://pubmed.ncbi.nlm.nih.gov/29751820" }, { "database": "PubMed", "id": "29796172", "url": "https://pubmed.ncbi.nlm.nih.gov/29796172" }, { "database": "PubMed", "id": "29855346", "url": "https://pubmed.ncbi.nlm.nih.gov/29855346" }, { "database": "PubMed", "id": "30007645", "url": "https://pubmed.ncbi.nlm.nih.gov/30007645" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30724425", "url": "https://pubmed.ncbi.nlm.nih.gov/30724425" }, { "database": "PubMed", "id": "30886199", "url": "https://pubmed.ncbi.nlm.nih.gov/30886199" }, { "database": "PubMed", "id": "30967527", "url": "https://pubmed.ncbi.nlm.nih.gov/30967527" }, { "database": "PubMed", "id": "31196219", "url": "https://pubmed.ncbi.nlm.nih.gov/31196219" }, { "database": "PubMed", "id": "31408005", "url": "https://pubmed.ncbi.nlm.nih.gov/31408005" }, { "database": "PubMed", "id": "31653890", "url": "https://pubmed.ncbi.nlm.nih.gov/31653890" }, { "database": "PubMed", "id": "32183180", "url": "https://pubmed.ncbi.nlm.nih.gov/32183180" }, { "database": "PubMed", "id": "32319563", "url": "https://pubmed.ncbi.nlm.nih.gov/32319563" }, { "database": "PubMed", "id": "32358509", "url": "https://pubmed.ncbi.nlm.nih.gov/32358509" }, { "database": "PubMed", "id": "32642677", "url": "https://pubmed.ncbi.nlm.nih.gov/32642677" }, { "database": "PubMed", "id": "32731335", "url": "https://pubmed.ncbi.nlm.nih.gov/32731335" }, { "database": "PubMed", "id": "33391546", "url": "https://pubmed.ncbi.nlm.nih.gov/33391546" }, { "database": "PubMed", "id": "33519429", "url": "https://pubmed.ncbi.nlm.nih.gov/33519429" }, { "database": "PubMed", "id": "33692335", "url": "https://pubmed.ncbi.nlm.nih.gov/33692335" }, { "database": "PubMed", "id": "33747209", "url": "https://pubmed.ncbi.nlm.nih.gov/33747209" }, { "database": "PubMed", "id": "33779079", "url": "https://pubmed.ncbi.nlm.nih.gov/33779079" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "36154299", "url": "https://pubmed.ncbi.nlm.nih.gov/36154299" }, { "database": "PubMed", "id": "36342456", "url": "https://pubmed.ncbi.nlm.nih.gov/36342456" }, { "database": "PubMed", "id": "8523587", "url": "https://pubmed.ncbi.nlm.nih.gov/8523587" }, { "database": "PubMed", "id": "9353323", "url": "https://pubmed.ncbi.nlm.nih.gov/9353323" }, { "database": "PubMed", "id": "9399961", "url": "https://pubmed.ncbi.nlm.nih.gov/9399961" }, { "database": "PubMed", "id": "9649436", "url": "https://pubmed.ncbi.nlm.nih.gov/9649436" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22065572", "url": "https://pubmed.ncbi.nlm.nih.gov/22065572" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "26479788", "url": "https://pubmed.ncbi.nlm.nih.gov/26479788" } ], "site_lbl": "Ser727", "uniprot_canonical_ac": "P42224-1" } ], "record_id": "pubmed.27862183", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BRG1 and BRM loss selectively impacts RB and P53, respectively: BRG1 and BRM have differential functions in vivo.", "journal": "Oncoscience", "date": "2016", "authors": "Marquez-Vilendrer SB, Rai SK, Gramling SJ, Lu L, Reisman DN", "reference": { "type": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 821, "end_pos": 821, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK6", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "19228744", "url": "https://pubmed.ncbi.nlm.nih.gov/19228744" }, { "database": "PubMed", "id": "20010939", "url": "https://pubmed.ncbi.nlm.nih.gov/20010939" }, { "database": "PubMed", "id": "23315497", "url": "https://pubmed.ncbi.nlm.nih.gov/23315497" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "29468543", "url": "https://pubmed.ncbi.nlm.nih.gov/29468543" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "16360038", "url": "https://pubmed.ncbi.nlm.nih.gov/16360038" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr821", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 826, "end_pos": 826, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK4", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "23737759", "url": "https://pubmed.ncbi.nlm.nih.gov/23737759" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "16360038", "url": "https://pubmed.ncbi.nlm.nih.gov/16360038" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr826", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.28105458", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Rb1 tumour suppressor gene modifies telomeric chromatin architecture by regulating TERRA expression.", "journal": "Scientific reports", "date": "2017", "authors": "Gonzalez-Vasconcellos I, Schneider R, Anastasov N, Alonso-Rodriguez S, Sanli-Bonazzi B, Fernandez JL, Atkinson MJ", "reference": { "type": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.28169375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of Skp2 sensitizes lung cancer cells to paclitaxel.", "journal": "OncoTargets and therapy", "date": "2017", "authors": "Huang Tonghai, Yang Lin, Wang Guangsuo, Ding Guanggui, Peng Bin, Wen Yuxin, Wang Zheng", "reference": { "type": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.28176922", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SV40 large tumor antigen forms a specific complex with the product of the retinoblastoma susceptibility gene.", "journal": "Cell", "date": "1988-07-15", "authors": "DeCaprio J A, Ludlow J W, Figge J, Shew J Y, Huang C M, Lee W H, Marsilio E, Paucha E, Livingston D M", "reference": { "type": "PubMed", "id": "2839300", "url": "https://pubmed.ncbi.nlm.nih.gov/2839300" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2839300", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of pRB Pathway Differentially Modulates Apoptosis in Esophageal Cancer Cells.", "journal": "Translational oncology", "date": "2017", "authors": "Soletti RC, Biasoli D, Rodrigues NALV, Delou JMA, Maciel R, Chagas VLA, Martins RAP, Rehen SK, Borges HL", "reference": { "type": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.28734226", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dietary fat/cholesterol-sensitive PKC\u03b2-RB signaling: Potential role in NASH/HCC axis.", "journal": "Oncotarget", "date": "2017-09-26", "authors": "Huang Wei, Mehta Devina, Sif Said, Kent Lindsey N, Jacob Samson T, Ghoshal Kalpana, Mehta Kamal D", "reference": { "type": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.29088742", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Detection of Retinoblastoma Protein Phosphorylation by Immunoblot Analysis.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2018", "authors": "Santiago-Cardona PG, Perez-Morales J, Gonzalez-Flores J", "reference": { "type": "PubMed", "id": "29468543", "url": "https://pubmed.ncbi.nlm.nih.gov/29468543" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 612, "end_pos": 612, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CHEK2 and CHEK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "IntAct", "id": "P06400", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06400*" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "17380128", "url": "https://pubmed.ncbi.nlm.nih.gov/17380128" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "22322860", "url": "https://pubmed.ncbi.nlm.nih.gov/22322860" }, { "database": "PubMed", "id": "23437375", "url": "https://pubmed.ncbi.nlm.nih.gov/23437375" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "29468543", "url": "https://pubmed.ncbi.nlm.nih.gov/29468543" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" } ], "site_lbl": "Ser612", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 821, "end_pos": 821, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK6", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "19228744", "url": "https://pubmed.ncbi.nlm.nih.gov/19228744" }, { "database": "PubMed", "id": "20010939", "url": "https://pubmed.ncbi.nlm.nih.gov/20010939" }, { "database": "PubMed", "id": "23315497", "url": "https://pubmed.ncbi.nlm.nih.gov/23315497" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "29468543", "url": "https://pubmed.ncbi.nlm.nih.gov/29468543" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "16360038", "url": "https://pubmed.ncbi.nlm.nih.gov/16360038" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr821", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.29468543", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Immunohistochemical Detection of Retinoblastoma Protein Phosphorylation in Human Tumor Samples.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2018", "authors": "Perez-Morales J, Nunez-Marrero A, Santiago-Cardona PG", "reference": { "type": "PubMed", "id": "29468545", "url": "https://pubmed.ncbi.nlm.nih.gov/29468545" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "IEDB", "id": "P06400", "url": "https://www.iedb.org/epitope/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "27869121", "url": "https://pubmed.ncbi.nlm.nih.gov/27869121" }, { "database": "PubMed", "id": "31848261", "url": "https://pubmed.ncbi.nlm.nih.gov/31848261" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "29468545", "url": "https://pubmed.ncbi.nlm.nih.gov/29468545" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.29468545", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E2F1 promotes hepatic gluconeogenesis and contributes to hyperglycemia during diabetes.", "journal": "Molecular metabolism", "date": "2018-05", "authors": "Giralt Albert, Denechaud Pierre-Damien, Lopez-Mejia Isabel C, Delacuisine Brigitte, Blanchet Emilie, Bonner Caroline, Pattou Francois, Annicotte Jean-S\u00e9bastien, Fajas Lluis", "reference": { "type": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.29526568", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Targeting the cyclin dependent kinase and retinoblastoma axis overcomes standard of care resistance in BRAF (V600E) -mutant melanoma.", "journal": "Oncotarget", "date": "2018", "authors": "Harris AL, Lee SE, Dawson LK, Marlow LA, Edenfield BH, Durham WF, Flotte TJ, Thompson M, Small DL, Synnott AJ, Markovic SN, Copland JA", "reference": { "type": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.29541385", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ARHGAP9 suppresses the migration and invasion of hepatocellular carcinoma cells through up-regulating FOXJ2/E-cadherin.", "journal": "Cell death & disease", "date": "2018", "authors": "Zhang H, Tang QF, Sun MY, Zhang CY, Zhu JY, Shen YL, Zhao B, Shao ZY, Zhang LJ, Zhang H", "reference": { "type": "PubMed", "id": "30206221", "url": "https://pubmed.ncbi.nlm.nih.gov/30206221" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14497-1", "protein_name": "AT-rich interactive domain-containing protein 1A", "gene_name": "ARID1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y261-1", "protein_name": "Hepatocyte nuclear factor 3-beta", "gene_name": "FOXA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05549-1", "protein_name": "Transcription factor AP-2-alpha", "gene_name": "TFAP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15409-1", "protein_name": "Forkhead box protein P2", "gene_name": "FOXP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43474-3", "protein_name": "Krueppel-like factor 4", "gene_name": "KLF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60315-1", "protein_name": "Zinc finger E-box-binding homeobox 2", "gene_name": "ZEB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13886-1", "protein_name": "Krueppel-like factor 9", "gene_name": "KLF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0K8-1", "protein_name": "Forkhead box protein J2", "gene_name": "FOXJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08047-1", "protein_name": "Transcription factor Sp1", "gene_name": "SP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30206221", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tenascin-C Modulates Cell Cycle Progression to Enhance Tumour Cell Proliferation through AKT/FOXO1 Signalling in Pancreatic Cancer.", "journal": "Journal of Cancer", "date": "2018", "authors": "Cai J, Lu W, Du S, Guo Z, Wang H, Wei W, Shen X", "reference": { "type": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.30519351", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of KLF9 in pancreatic cancer and its effects on the invasion, migration, apoptosis, cell cycle distribution, and proliferation of pancreatic cancer cell lines.", "journal": "Oncology reports", "date": "2018", "authors": "Zhong Z, Zhou F, Wang D, Wu M, Zhou W, Zou Y, Li J, Wu L, Yin X", "reference": { "type": "PubMed", "id": "30542730", "url": "https://pubmed.ncbi.nlm.nih.gov/30542730" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14497-1", "protein_name": "AT-rich interactive domain-containing protein 1A", "gene_name": "ARID1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y261-1", "protein_name": "Hepatocyte nuclear factor 3-beta", "gene_name": "FOXA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05549-1", "protein_name": "Transcription factor AP-2-alpha", "gene_name": "TFAP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15409-1", "protein_name": "Forkhead box protein P2", "gene_name": "FOXP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43474-3", "protein_name": "Krueppel-like factor 4", "gene_name": "KLF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60315-1", "protein_name": "Zinc finger E-box-binding homeobox 2", "gene_name": "ZEB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13886-1", "protein_name": "Krueppel-like factor 9", "gene_name": "KLF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0K8-1", "protein_name": "Forkhead box protein J2", "gene_name": "FOXJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08047-1", "protein_name": "Transcription factor Sp1", "gene_name": "SP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30542730", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Code of Mono-phosphorylation Modulates the Function of RB.", "journal": "Molecular cell", "date": "2019", "authors": "Sanidas I, Morris R, Fella KA, Rumde PH, Boukhali M, Tai EC, Ting DT, Lawrence MS, Haas W, Dyson NJ", "reference": { "type": "PubMed", "id": "30711375", "url": "https://pubmed.ncbi.nlm.nih.gov/30711375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30711375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Epigenetically Down-Regulated Acetyltransferase PCAF Increases the Resistance of Colorectal Cancer to 5-Fluorouracil.", "journal": "Neoplasia (New York, N.Y.)", "date": "2019", "authors": "Liu T, Wang X, Hu W, Fang Z, Jin Y, Fang X, Miao QR", "reference": { "type": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.31042625", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transient Hysteresis in CDK4/6 Activity Underlies Passage of the Restriction Point in G1.", "journal": "Molecular cell", "date": "2019", "authors": "Chung M, Liu C, Yang HW, Koberlin MS, Cappell SD, Meyer T", "reference": { "type": "PubMed", "id": "31543423", "url": "https://pubmed.ncbi.nlm.nih.gov/31543423" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31543423", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Silencing of FOXA2 decreases E-cadherin expression and is associated with lymph node metastasis in oral cancer.", "journal": "Oral diseases", "date": "2020", "authors": "Bow YD, Wang YY, Chen YK, Su CW, Hsu CW, Xiao LY, Yuan SS, Li RN", "reference": { "type": "PubMed", "id": "31957176", "url": "https://pubmed.ncbi.nlm.nih.gov/31957176" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14497-1", "protein_name": "AT-rich interactive domain-containing protein 1A", "gene_name": "ARID1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y261-1", "protein_name": "Hepatocyte nuclear factor 3-beta", "gene_name": "FOXA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05549-1", "protein_name": "Transcription factor AP-2-alpha", "gene_name": "TFAP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15409-1", "protein_name": "Forkhead box protein P2", "gene_name": "FOXP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43474-3", "protein_name": "Krueppel-like factor 4", "gene_name": "KLF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60315-1", "protein_name": "Zinc finger E-box-binding homeobox 2", "gene_name": "ZEB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13886-1", "protein_name": "Krueppel-like factor 9", "gene_name": "KLF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0K8-1", "protein_name": "Forkhead box protein J2", "gene_name": "FOXJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08047-1", "protein_name": "Transcription factor Sp1", "gene_name": "SP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31957176", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dissection of Anti-tumor Activity of Histone Deacetylase Inhibitor SAHA in Nasopharyngeal Carcinoma Cells via Quantitative Phosphoproteomics.", "journal": "Frontiers in cell and developmental biology", "date": "2020", "authors": "Huang Huichao, Fu Ying, Zhang Ye, Peng Fang, Lu Miaolong, Feng Yilu, Chen Lin, Chen Zhuchu, Li Maoyu, Chen Yongheng", "reference": { "type": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04637-1", "protein_name": "Cellular tumor antigen p53", "gene_name": "TP53", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "IEDB", "id": "P06400", "url": "https://www.iedb.org/epitope/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "27869121", "url": "https://pubmed.ncbi.nlm.nih.gov/27869121" }, { "database": "PubMed", "id": "31848261", "url": "https://pubmed.ncbi.nlm.nih.gov/31848261" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "29468545", "url": "https://pubmed.ncbi.nlm.nih.gov/29468545" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr252", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 37, "end_pos": 37, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19415658", "url": "https://pubmed.ncbi.nlm.nih.gov/19415658" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser37", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 612, "end_pos": 612, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CHEK2 and CHEK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "IntAct", "id": "P06400", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06400*" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "17380128", "url": "https://pubmed.ncbi.nlm.nih.gov/17380128" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "22322860", "url": "https://pubmed.ncbi.nlm.nih.gov/22322860" }, { "database": "PubMed", "id": "23437375", "url": "https://pubmed.ncbi.nlm.nih.gov/23437375" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "29468543", "url": "https://pubmed.ncbi.nlm.nih.gov/29468543" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" } ], "site_lbl": "Ser612", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 788, "end_pos": 788, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser788", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 821, "end_pos": 821, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK6", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "19228744", "url": "https://pubmed.ncbi.nlm.nih.gov/19228744" }, { "database": "PubMed", "id": "20010939", "url": "https://pubmed.ncbi.nlm.nih.gov/20010939" }, { "database": "PubMed", "id": "23315497", "url": "https://pubmed.ncbi.nlm.nih.gov/23315497" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "29468543", "url": "https://pubmed.ncbi.nlm.nih.gov/29468543" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "16360038", "url": "https://pubmed.ncbi.nlm.nih.gov/16360038" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr821", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 826, "end_pos": 826, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK4", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "23737759", "url": "https://pubmed.ncbi.nlm.nih.gov/23737759" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "16360038", "url": "https://pubmed.ncbi.nlm.nih.gov/16360038" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr826", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 315, "end_pos": 315, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AURKA, CDK1 and CDK2", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10884347", "url": "https://pubmed.ncbi.nlm.nih.gov/10884347" }, { "database": "PubMed", "id": "12064478", "url": "https://pubmed.ncbi.nlm.nih.gov/12064478" }, { "database": "PubMed", "id": "17287340", "url": "https://pubmed.ncbi.nlm.nih.gov/17287340" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "16552184", "url": "https://pubmed.ncbi.nlm.nih.gov/16552184" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "15469940", "url": "https://pubmed.ncbi.nlm.nih.gov/15469940" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10559267", "url": "https://pubmed.ncbi.nlm.nih.gov/10559267" }, { "database": "PubMed", "id": "10656795", "url": "https://pubmed.ncbi.nlm.nih.gov/10656795" }, { "database": "PubMed", "id": "11078726", "url": "https://pubmed.ncbi.nlm.nih.gov/11078726" }, { "database": "PubMed", "id": "11300786", "url": "https://pubmed.ncbi.nlm.nih.gov/11300786" }, { "database": "PubMed", "id": "11687964", "url": "https://pubmed.ncbi.nlm.nih.gov/11687964" }, { "database": "PubMed", "id": "12397362", "url": "https://pubmed.ncbi.nlm.nih.gov/12397362" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "14640983", "url": "https://pubmed.ncbi.nlm.nih.gov/14640983" }, { "database": "PubMed", "id": "14702041", "url": "https://pubmed.ncbi.nlm.nih.gov/14702041" }, { "database": "PubMed", "id": "15107622", "url": "https://pubmed.ncbi.nlm.nih.gov/15107622" }, { "database": "PubMed", "id": "16037820", "url": "https://pubmed.ncbi.nlm.nih.gov/16037820" }, { "database": "PubMed", "id": "16227590", "url": "https://pubmed.ncbi.nlm.nih.gov/16227590" }, { "database": "PubMed", "id": "16606449", "url": "https://pubmed.ncbi.nlm.nih.gov/16606449" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19903847", "url": "https://pubmed.ncbi.nlm.nih.gov/19903847" }, { "database": "PubMed", "id": "2052362", "url": "https://pubmed.ncbi.nlm.nih.gov/2052362" }, { "database": "PubMed", "id": "20661218", "url": "https://pubmed.ncbi.nlm.nih.gov/20661218" }, { "database": "PubMed", "id": "20808790", "url": "https://pubmed.ncbi.nlm.nih.gov/20808790" }, { "database": "PubMed", "id": "2141171", "url": "https://pubmed.ncbi.nlm.nih.gov/2141171" }, { "database": "PubMed", "id": "2156209", "url": "https://pubmed.ncbi.nlm.nih.gov/2156209" }, { "database": "PubMed", "id": "22245200", "url": "https://pubmed.ncbi.nlm.nih.gov/22245200" }, { "database": "PubMed", "id": "22396649", "url": "https://pubmed.ncbi.nlm.nih.gov/22396649" }, { "database": "PubMed", "id": "23565200", "url": "https://pubmed.ncbi.nlm.nih.gov/23565200" }, { "database": "PubMed", "id": "25645017", "url": "https://pubmed.ncbi.nlm.nih.gov/25645017" }, { "database": "PubMed", "id": "25691063", "url": "https://pubmed.ncbi.nlm.nih.gov/25691063" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "29344296", "url": "https://pubmed.ncbi.nlm.nih.gov/29344296" }, { "database": "PubMed", "id": "30266789", "url": "https://pubmed.ncbi.nlm.nih.gov/30266789" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30942456", "url": "https://pubmed.ncbi.nlm.nih.gov/30942456" }, { "database": "PubMed", "id": "31588224", "url": "https://pubmed.ncbi.nlm.nih.gov/31588224" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33568778", "url": "https://pubmed.ncbi.nlm.nih.gov/33568778" }, { "database": "PubMed", "id": "33649292", "url": "https://pubmed.ncbi.nlm.nih.gov/33649292" }, { "database": "PubMed", "id": "35217309", "url": "https://pubmed.ncbi.nlm.nih.gov/35217309" }, { "database": "PubMed", "id": "36167685", "url": "https://pubmed.ncbi.nlm.nih.gov/36167685" }, { "database": "PubMed", "id": "8956076", "url": "https://pubmed.ncbi.nlm.nih.gov/8956076" }, { "database": "PubMed", "id": "9246643", "url": "https://pubmed.ncbi.nlm.nih.gov/9246643" }, { "database": "PubMed", "id": "9254608", "url": "https://pubmed.ncbi.nlm.nih.gov/9254608" }, { "database": "PubMed", "id": "9467949", "url": "https://pubmed.ncbi.nlm.nih.gov/9467949" } ], "site_lbl": "Ser315", "uniprot_canonical_ac": "P04637-1" }, { "start_pos": 315, "end_pos": 315, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AURKA, CDK1 and CDK2", "evidence": [ { "database": "UniProtKB", "id": "P04637", "url": "https://www.uniprot.org/uniprotkb/P04637" }, { "database": "iPTMnet", "id": "P04637", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P04637" }, { "database": "PubMed", "id": "10884347", "url": "https://pubmed.ncbi.nlm.nih.gov/10884347" }, { "database": "PubMed", "id": "12064478", "url": "https://pubmed.ncbi.nlm.nih.gov/12064478" }, { "database": "PubMed", "id": "17287340", "url": "https://pubmed.ncbi.nlm.nih.gov/17287340" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://pubmed.ncbi.nlm.nih.gov/19664995" }, { "database": "PubMed", "id": "16552184", "url": "https://pubmed.ncbi.nlm.nih.gov/16552184" }, { "database": "PRO", "id": "P04637", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P04637" }, { "database": "PubMed", "id": "15469940", "url": "https://pubmed.ncbi.nlm.nih.gov/15469940" }, { "database": "PubMed", "id": "10208433", "url": "https://pubmed.ncbi.nlm.nih.gov/10208433" }, { "database": "PubMed", "id": "10559267", "url": "https://pubmed.ncbi.nlm.nih.gov/10559267" }, { "database": "PubMed", "id": "10656795", "url": "https://pubmed.ncbi.nlm.nih.gov/10656795" }, { "database": "PubMed", "id": "11078726", "url": "https://pubmed.ncbi.nlm.nih.gov/11078726" }, { "database": "PubMed", "id": "11300786", "url": "https://pubmed.ncbi.nlm.nih.gov/11300786" }, { "database": "PubMed", "id": "11687964", "url": "https://pubmed.ncbi.nlm.nih.gov/11687964" }, { "database": "PubMed", "id": "12397362", "url": "https://pubmed.ncbi.nlm.nih.gov/12397362" }, { "database": "PubMed", "id": "12438576", "url": "https://pubmed.ncbi.nlm.nih.gov/12438576" }, { "database": "PubMed", "id": "14640983", "url": "https://pubmed.ncbi.nlm.nih.gov/14640983" }, { "database": "PubMed", "id": "14702041", "url": "https://pubmed.ncbi.nlm.nih.gov/14702041" }, { "database": "PubMed", "id": "15107622", "url": "https://pubmed.ncbi.nlm.nih.gov/15107622" }, { "database": "PubMed", "id": "16037820", "url": "https://pubmed.ncbi.nlm.nih.gov/16037820" }, { "database": "PubMed", "id": "16227590", "url": "https://pubmed.ncbi.nlm.nih.gov/16227590" }, { "database": "PubMed", "id": "16606449", "url": "https://pubmed.ncbi.nlm.nih.gov/16606449" }, { "database": "PubMed", "id": "18612383", "url": "https://pubmed.ncbi.nlm.nih.gov/18612383" }, { "database": "PubMed", "id": "18697815", "url": "https://pubmed.ncbi.nlm.nih.gov/18697815" }, { "database": "PubMed", "id": "19155208", "url": "https://pubmed.ncbi.nlm.nih.gov/19155208" }, { "database": "PubMed", "id": "19903847", "url": "https://pubmed.ncbi.nlm.nih.gov/19903847" }, { "database": "PubMed", "id": "2052362", "url": "https://pubmed.ncbi.nlm.nih.gov/2052362" }, { "database": "PubMed", "id": "20661218", "url": "https://pubmed.ncbi.nlm.nih.gov/20661218" }, { "database": "PubMed", "id": "20808790", "url": "https://pubmed.ncbi.nlm.nih.gov/20808790" }, { "database": "PubMed", "id": "2141171", "url": "https://pubmed.ncbi.nlm.nih.gov/2141171" }, { "database": "PubMed", "id": "2156209", "url": "https://pubmed.ncbi.nlm.nih.gov/2156209" }, { "database": "PubMed", "id": "22245200", "url": "https://pubmed.ncbi.nlm.nih.gov/22245200" }, { "database": "PubMed", "id": "22396649", "url": "https://pubmed.ncbi.nlm.nih.gov/22396649" }, { "database": "PubMed", "id": "23565200", "url": "https://pubmed.ncbi.nlm.nih.gov/23565200" }, { "database": "PubMed", "id": "25645017", "url": "https://pubmed.ncbi.nlm.nih.gov/25645017" }, { "database": "PubMed", "id": "25691063", "url": "https://pubmed.ncbi.nlm.nih.gov/25691063" }, { "database": "PubMed", "id": "26387611", "url": "https://pubmed.ncbi.nlm.nih.gov/26387611" }, { "database": "PubMed", "id": "29344296", "url": "https://pubmed.ncbi.nlm.nih.gov/29344296" }, { "database": "PubMed", "id": "30266789", "url": "https://pubmed.ncbi.nlm.nih.gov/30266789" }, { "database": "PubMed", "id": "30532707", "url": "https://pubmed.ncbi.nlm.nih.gov/30532707" }, { "database": "PubMed", "id": "30942456", "url": "https://pubmed.ncbi.nlm.nih.gov/30942456" }, { "database": "PubMed", "id": "31588224", "url": "https://pubmed.ncbi.nlm.nih.gov/31588224" }, { "database": "PubMed", "id": "33166398", "url": "https://pubmed.ncbi.nlm.nih.gov/33166398" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33568778", "url": "https://pubmed.ncbi.nlm.nih.gov/33568778" }, { "database": "PubMed", "id": "33649292", "url": "https://pubmed.ncbi.nlm.nih.gov/33649292" }, { "database": "PubMed", "id": "35217309", "url": "https://pubmed.ncbi.nlm.nih.gov/35217309" }, { "database": "PubMed", "id": "36167685", "url": "https://pubmed.ncbi.nlm.nih.gov/36167685" }, { "database": "PubMed", "id": "8956076", "url": "https://pubmed.ncbi.nlm.nih.gov/8956076" }, { "database": "PubMed", "id": "9246643", "url": "https://pubmed.ncbi.nlm.nih.gov/9246643" }, { "database": "PubMed", "id": "9254608", "url": "https://pubmed.ncbi.nlm.nih.gov/9254608" }, { "database": "PubMed", "id": "9467949", "url": "https://pubmed.ncbi.nlm.nih.gov/9467949" } ], "site_lbl": "Ser315", "uniprot_canonical_ac": "P04637-1" } ], "record_id": "pubmed.33324635", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CVB3 VP1 interacts with MAT1 to inhibit cell proliferation by interfering with Cdk-activating kinase complex activity in CVB3-induced acute pancreatitis.", "journal": "PLoS pathogens", "date": "2021-02", "authors": "Zhang Hongxia, Zeng Lingbing, Liu Qiong, Jin Guilin, Zhang Jieyu, Li Zengbin, Xu Yilian, Tian Huizhen, Deng Shanshan, Shi Qiaofa, Huang Xiaotian", "reference": { "type": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.33556114", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arsenic trioxide reduces the expression of E2F1, cyclin E, and phosphorylation of PI3K signaling molecules in acute leukemia cells.", "journal": "Environmental toxicology", "date": "2021-09", "authors": "Kumar Sanjay, Tchounwou Paul B", "reference": { "type": "PubMed", "id": "34042274", "url": "https://pubmed.ncbi.nlm.nih.gov/34042274" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 373, "end_pos": 373, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "34042274", "url": "https://pubmed.ncbi.nlm.nih.gov/34042274" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr373", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 608, "end_pos": 608, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "12895470", "url": "https://pubmed.ncbi.nlm.nih.gov/12895470" }, { "database": "PubMed", "id": "15081408", "url": "https://pubmed.ncbi.nlm.nih.gov/15081408" }, { "database": "PubMed", "id": "22322860", "url": "https://pubmed.ncbi.nlm.nih.gov/22322860" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "34042274", "url": "https://pubmed.ncbi.nlm.nih.gov/34042274" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" }, { "database": "PubMed", "id": "9010227", "url": "https://pubmed.ncbi.nlm.nih.gov/9010227" } ], "site_lbl": "Ser608", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.34042274", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular mechanism of retinoblastoma gene inactivation in retinoblastoma cell line Y79.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1988", "authors": "Lee E Y, Bookstein R, Young L J, Lin C J, Rosenfeld M G, Lee W H", "reference": { "type": "PubMed", "id": "3413073", "url": "https://pubmed.ncbi.nlm.nih.gov/3413073" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3413073", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deletions of a DNA sequence in retinoblastomas and mesenchymal tumors: organization of the sequence and its encoded protein.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1987", "authors": "Friend S H, Horowitz J M, Gerber M R, Wang X F, Bogenmann E, Li F P, Weinberg R A", "reference": { "type": "PubMed", "id": "3480530", "url": "https://pubmed.ncbi.nlm.nih.gov/3480530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3480530", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Over-expression of NUDT21 inhibits the proliferation of HCT-116 colon cancer cells via blocking P53/CDK2/Rb pathway].", "journal": "Xi bao yu fen zi mian yi xue za zhi = Chinese journal of cellular and molecular immunology", "date": "2022", "authors": "Luo Z, Dou L, Wang L, Liu R, Luo G, Lin M, Deng Z, Shen Y, Fu Z, Peng S, Zhang Y", "reference": { "type": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 608, "end_pos": 608, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "12895470", "url": "https://pubmed.ncbi.nlm.nih.gov/12895470" }, { "database": "PubMed", "id": "15081408", "url": "https://pubmed.ncbi.nlm.nih.gov/15081408" }, { "database": "PubMed", "id": "22322860", "url": "https://pubmed.ncbi.nlm.nih.gov/22322860" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "34042274", "url": "https://pubmed.ncbi.nlm.nih.gov/34042274" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" }, { "database": "PubMed", "id": "9010227", "url": "https://pubmed.ncbi.nlm.nih.gov/9010227" } ], "site_lbl": "Ser608", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.35732608", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Retinoblastoma protein as an intrinsic BRD4 inhibitor modulates small molecule BET inhibitor sensitivity in cancer.", "journal": "Nature communications", "date": "2022-10-23", "authors": "Ding Donglin, Zheng Rongbin, Tian Ye, Jimenez Rafael, Hou Xiaonan, Weroha Saravut J, Wang Liguo, Shi Lei, Huang Haojie", "reference": { "type": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "IEDB", "id": "P06400", "url": "https://www.iedb.org/epitope/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "27869121", "url": "https://pubmed.ncbi.nlm.nih.gov/27869121" }, { "database": "PubMed", "id": "31848261", "url": "https://pubmed.ncbi.nlm.nih.gov/31848261" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "29468545", "url": "https://pubmed.ncbi.nlm.nih.gov/29468545" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr252", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.36274096", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ARID1A downregulation promotes cell proliferation and migration of colon cancer via VIM activation and CDH1 suppression.", "journal": "Journal of cellular and molecular medicine", "date": "2022-12", "authors": "Baldi Salem, Zhang Qianshi, Zhang Zhenyu, Safi Mohammed, Khamgan Hassan, Wu Han, Zhang Mengyan, Qian Yuanyuan, Gao Yina, Shopit Abdullah, Al-Danakh Abdullah, Alradhi Mohammed, Al-Nusaif Murad, Zuo Yunfei", "reference": { "type": "PubMed", "id": "36420658", "url": "https://pubmed.ncbi.nlm.nih.gov/36420658" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14497-1", "protein_name": "AT-rich interactive domain-containing protein 1A", "gene_name": "ARID1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y261-1", "protein_name": "Hepatocyte nuclear factor 3-beta", "gene_name": "FOXA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05549-1", "protein_name": "Transcription factor AP-2-alpha", "gene_name": "TFAP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15409-1", "protein_name": "Forkhead box protein P2", "gene_name": "FOXP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43474-3", "protein_name": "Krueppel-like factor 4", "gene_name": "KLF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60315-1", "protein_name": "Zinc finger E-box-binding homeobox 2", "gene_name": "ZEB2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13886-1", "protein_name": "Krueppel-like factor 9", "gene_name": "KLF9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3F4-1", "protein_name": "Serine-threonine kinase receptor-associated protein", "gene_name": "STRAP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9P0K8-1", "protein_name": "Forkhead box protein J2", "gene_name": "FOXJ2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P08047-1", "protein_name": "Transcription factor Sp1", "gene_name": "SP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36420658", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The retinoblastoma susceptibility gene encodes a nuclear phosphoprotein associated with DNA binding activity.", "journal": "Nature", "date": "1987", "authors": "Lee W H, Shew J Y, Hong F D, Sery T W, Donoso L A, Young L J, Bookstein R, Lee E Y", "reference": { "type": "PubMed", "id": "3657987", "url": "https://pubmed.ncbi.nlm.nih.gov/3657987" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3657987", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human retinoblastoma susceptibility gene: cloning, identification, and sequence.", "journal": "Science", "date": "1987", "authors": "Lee W H, Bookstein R, Hong F, Young L J, Shew J Y, Lee E Y", "reference": { "type": "PubMed", "id": "3823889", "url": "https://pubmed.ncbi.nlm.nih.gov/3823889" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3823889", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RB1 Genetic Alterations in Estrogen Receptor-Positive Breast Carcinomas: Correlation With Neuroendocrine Differentiation.", "journal": "Modern pathology : an official journal of the United States and Canadian Academy of Pathology, Inc", "date": "2024-08", "authors": "Schwartz Christopher J, Marra Antonio, Selenica Pier, Gazzo Andrea, Tan Kiki, Ross Dara, Razavi Pedram, Chandarlapaty Sarat, Weigelt Britta, Reis-Filho Jorge S, Brogi Edi, Pareja Fresia, Wen Hannah Y", "reference": { "type": "PubMed", "id": "38897452", "url": "https://pubmed.ncbi.nlm.nih.gov/38897452" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38897452", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An intermediate Rb-E2F activity state safeguards proliferation commitment.", "journal": "Nature", "date": "2024-07", "authors": "Konagaya Yumi, Rosenthal David, Ratnayeke Nalin, Fan Yilin, Meyer Tobias", "reference": { "type": "PubMed", "id": "38926571", "url": "https://pubmed.ncbi.nlm.nih.gov/38926571" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38926571", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The G1-S transition is promoted by Rb degradation via the E3 ligase UBR5.", "journal": "Science advances", "date": "2024-10-25", "authors": "Zhang Shuyuan, Valenzuela Lucas Fuentes, Zatulovskiy Evgeny, Mangiante Lise, Curtis Christina, Skotheim Jan M", "reference": { "type": "PubMed", "id": "39441926", "url": "https://pubmed.ncbi.nlm.nih.gov/39441926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95071-1", "protein_name": "E3 ubiquitin-protein ligase UBR5", "gene_name": "UBR5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39441926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The amino-terminal region of the retinoblastoma gene product binds a novel nuclear matrix protein that co-localizes to centers for RNA processing.", "journal": "J. Cell Biol.", "date": "1994", "authors": "Durfee T, Mancini M A, Jones D, Elledge S J, Lee W H", "reference": { "type": "PubMed", "id": "7525595", "url": "https://pubmed.ncbi.nlm.nih.gov/7525595" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96FV9-1", "protein_name": "THO complex subunit 1", "gene_name": "THOC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7525595", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Both p16 and p21 families of cyclin-dependent kinase (CDK) inhibitors block the phosphorylation of cyclin-dependent kinases by the CDK-activating kinase.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Aprelikova O, Xiong Y, Liu ET", "reference": { "type": "PubMed", "id": "7629134", "url": "https://pubmed.ncbi.nlm.nih.gov/7629134" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y243-1", "protein_name": "RAC-gamma serine/threonine-protein kinase", "gene_name": "AKT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P20248-1", "protein_name": "Cyclin-A2", "gene_name": "CCNA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30291-1", "protein_name": "Wee1-like protein kinase", "gene_name": "WEE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31751-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "AKT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDN4-1", "protein_name": "CDK5 and ABL1 enzyme substrate 1", "gene_name": "CABLES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UM11-1", "protein_name": "Fizzy-related protein homolog", "gene_name": "FZR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30305-1", "protein_name": "M-phase inducer phosphatase 2", "gene_name": "CDC25B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7629134", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Frequent constitutional C to T mutations in CGA-arginine codons in the RB1 gene produce premature stop codons in patients with bilateral (hereditary) retinoblastoma.", "journal": "European journal of human genetics : EJHG", "date": "1994", "authors": "Cowell JK, Smith T, Bia B", "reference": { "type": "PubMed", "id": "7704558", "url": "https://pubmed.ncbi.nlm.nih.gov/7704558" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7704558", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spectrum of germline mutations in the RB1 gene: a study of 232 patients with hereditary and non hereditary retinoblastoma.", "journal": "Human molecular genetics", "date": "1995", "authors": "Blanquet V, Turleau C, Gross-Morand MS, Senamaud-Beaufort C, Doz F, Besmond C", "reference": { "type": "PubMed", "id": "7795591", "url": "https://pubmed.ncbi.nlm.nih.gov/7795591" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7795591", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the retinoblastoma protein-related p107 by G1 cyclin complexes.", "journal": "Genes & development", "date": "1995", "authors": "Beijersbergen RL, Carlee L, Kerkhoven RM, Bernards R", "reference": { "type": "PubMed", "id": "7797074", "url": "https://pubmed.ncbi.nlm.nih.gov/7797074" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7797074", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Spectrum of small length germline mutations in the RB1 gene.", "journal": "Hum. Mol. Genet.", "date": "1994", "authors": "Lohmann D R, Brandt B, H\u00f6pping W, Passarge E, Horsthemke B", "reference": { "type": "PubMed", "id": "7881418", "url": "https://pubmed.ncbi.nlm.nih.gov/7881418" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7881418", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complete genomic sequence of the human retinoblastoma susceptibility gene.", "journal": "Genomics", "date": "1993", "authors": "Toguchida J, McGee T L, Paterson J C, Eagle J R, Tucker S, Yandell D W, Dryja T P", "reference": { "type": "PubMed", "id": "7902321", "url": "https://pubmed.ncbi.nlm.nih.gov/7902321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P43657-1", "protein_name": "Lysophosphatidic acid receptor 6", "gene_name": "LPAR6", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7902321", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Distinct RB1 gene mutations with low penetrance in hereditary retinoblastoma.", "journal": "Human genetics", "date": "1994", "authors": "Lohmann DR, Brandt B, Hopping W, Passarge E, Horsthemke B", "reference": { "type": "PubMed", "id": "7927327", "url": "https://pubmed.ncbi.nlm.nih.gov/7927327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7927327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The role of cellular transcription factor E2F in the regulation of cdc2 mRNA expression and cell cycle control of human hematopoietic cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Furukawa Y, Terui Y, Sakoe K, Ohta M, Saito M", "reference": { "type": "PubMed", "id": "7929342", "url": "https://pubmed.ncbi.nlm.nih.gov/7929342" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7929342", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential specificity for binding of retinoblastoma binding protein 2 to RB, p107, and TATA-binding protein.", "journal": "Mol. Cell. Biol.", "date": "1994", "authors": "Kim YW, Otterson GA, Kratzke RA, Coxon AB, Kaye FJ", "reference": { "type": "PubMed", "id": "7935440", "url": "https://pubmed.ncbi.nlm.nih.gov/7935440" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29375-1", "protein_name": "Lysine-specific demethylase 5A", "gene_name": "KDM5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7935440", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclic AMP-induced G1 phase arrest mediated by an inhibitor (p27Kip1) of cyclin-dependent kinase 4 activation.", "journal": "Cell", "date": "1994", "authors": "Kato JY, Matsuoka M, Polyak K, Massague J, Sherr CJ", "reference": { "type": "PubMed", "id": "7954814", "url": "https://pubmed.ncbi.nlm.nih.gov/7954814" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7954814", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional properties of a Drosophila homolog of the E2F1 gene.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Ohtani K, Nevins JR", "reference": { "type": "PubMed", "id": "8114698", "url": "https://pubmed.ncbi.nlm.nih.gov/8114698" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q27368-1", "protein_name": "Transcription factor E2f1", "gene_name": "E2f1", "tax_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8114698", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 38 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of G1 kinase activity for cdk6, a novel cyclin D partner.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Meyerson M, Harlow E", "reference": { "type": "PubMed", "id": "8114739", "url": "https://pubmed.ncbi.nlm.nih.gov/8114739" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8114739", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in the retinoblastoma gene and their expression in somatic and tumor cells of patients with hereditary retinoblastoma.", "journal": "Human mutation", "date": "1994", "authors": "Kato M V, Ishizaki K, Toguchida J, Kaneko A, Takayama J, Tanooka H, Kato T, Shimizu T, Sasaki M S", "reference": { "type": "PubMed", "id": "8118465", "url": "https://pubmed.ncbi.nlm.nih.gov/8118465" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8118465", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of cyclin D-dependent kinase 4 (cdk4) by cdk4-activating kinase.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Kato JY, Matsuoka M, Strom DK, Sherr CJ", "reference": { "type": "PubMed", "id": "8139570", "url": "https://pubmed.ncbi.nlm.nih.gov/8139570" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30285-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "Cdk4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CAK", "evidence": [ { "database": "UniProtKB", "id": "P30285", "url": "https://www.uniprot.org/uniprotkb/P30285" }, { "database": "iPTMnet", "id": "P30285", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P30285" }, { "database": "PubMed", "id": "30485818", "url": "https://pubmed.ncbi.nlm.nih.gov/30485818" }, { "database": "PubMed", "id": "8139570", "url": "https://pubmed.ncbi.nlm.nih.gov/8139570" } ], "site_lbl": "Thr172", "uniprot_canonical_ac": "P30285-1" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "P50613-1", "kinase_gene_name": "CDK7", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P11802", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11802" }, { "database": "PubMed", "id": "16327805", "url": "https://pubmed.ncbi.nlm.nih.gov/16327805" }, { "database": "PubMed", "id": "16782892", "url": "https://pubmed.ncbi.nlm.nih.gov/16782892" }, { "database": "PubMed", "id": "8139570", "url": "https://pubmed.ncbi.nlm.nih.gov/8139570" } ], "site_lbl": "Thr172", "uniprot_canonical_ac": "P11802-1" }, { "start_pos": 172, "end_pos": 172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P11802", "url": "https://www.uniprot.org/uniprotkb/P11802" }, { "database": "PubMed", "id": "19369195", "url": "https://pubmed.ncbi.nlm.nih.gov/19369195" }, { "database": "PubMed", "id": "19237565", "url": "https://pubmed.ncbi.nlm.nih.gov/19237565" }, { "database": "PubMed", "id": "16782892", "url": "https://pubmed.ncbi.nlm.nih.gov/16782892" }, { "database": "PubMed", "id": "19487459", "url": "https://pubmed.ncbi.nlm.nih.gov/19487459" }, { "database": "PubMed", "id": "19237555", "url": "https://pubmed.ncbi.nlm.nih.gov/19237555" }, { "database": "iPTMnet", "id": "P11802", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P11802" }, { "database": "PubMed", "id": "8139570", "url": "https://pubmed.ncbi.nlm.nih.gov/8139570" }, { "database": "PRO", "id": "P11802", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P11802" }, { "database": "PubMed", "id": "19458076", "url": "https://pubmed.ncbi.nlm.nih.gov/19458076" }, { "database": "PubMed", "id": "20484410", "url": "https://pubmed.ncbi.nlm.nih.gov/20484410" }, { "database": "PubMed", "id": "23737759", "url": "https://pubmed.ncbi.nlm.nih.gov/23737759" }, { "database": "PubMed", "id": "28368408", "url": "https://pubmed.ncbi.nlm.nih.gov/28368408" }, { "database": "PubMed", "id": "28566333", "url": "https://pubmed.ncbi.nlm.nih.gov/28566333" }, { "database": "PubMed", "id": "33039146", "url": "https://pubmed.ncbi.nlm.nih.gov/33039146" }, { "database": "PubMed", "id": "34913830", "url": "https://pubmed.ncbi.nlm.nih.gov/34913830" }, { "database": "PubMed", "id": "36446794", "url": "https://pubmed.ncbi.nlm.nih.gov/36446794" }, { "database": "PubMed", "id": "36453028", "url": "https://pubmed.ncbi.nlm.nih.gov/36453028" }, { "database": "PubMed", "id": "7935441", "url": "https://pubmed.ncbi.nlm.nih.gov/7935441" } ], "site_lbl": "Thr172", "uniprot_canonical_ac": "P11802-1" } ], "record_id": "pubmed.8139570", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The retinoblastoma protein binds to a family of E2F transcription factors.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Lees JA, Saito M, Vidal M, Valentine M, Look T, Harlow E, Dyson N, Helin K", "reference": { "type": "PubMed", "id": "8246996", "url": "https://pubmed.ncbi.nlm.nih.gov/8246996" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8246996", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G1/S-regulated E2F-containing protein complexes bind to the mouse thymidine kinase gene promoter.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Dou QP, Zhao S, Levin AH, Wang J, Helin K, Pardee AB", "reference": { "type": "PubMed", "id": "8288595", "url": "https://pubmed.ncbi.nlm.nih.gov/8288595" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8288595", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A bipartite nuclear localization signal in the retinoblastoma gene product and its importance for biological activity.", "journal": "Mol. Cell. Biol.", "date": "1993", "authors": "Zacksenhaus E, Bremner R, Phillips RA, Gallie BL", "reference": { "type": "PubMed", "id": "8336704", "url": "https://pubmed.ncbi.nlm.nih.gov/8336704" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13405-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "Rb1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q61501-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2f1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 733, "end_pos": 769, "sequence_org": "KRVLIREEEFDSIIVFYNSVFMQRLKTNILQYASTRP", "sequence_mut": "", "comment": "Loss of exclusive nuclear localization. Complete loss of nuclear localization, loss of growth inhibition, when transfected in Saos-2 cells and loss of interaction with SV40 large T antigen, adenovirus E1a and E2F1; when associated with 866-N--Q-869.", "evidence": [ { "database": "UniProtKB", "id": "P13405", "url": "https://www.uniprot.org/uniprotkb/P13405" }, { "database": "PubMed", "id": "8336704", "url": "https://pubmed.ncbi.nlm.nih.gov/8336704" } ], "uniprot_canonical_ac": "P13405-1" }, { "start_pos": 769, "end_pos": 872, "sequence_org": "PPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGGNPPKPLKKLRFDI", "sequence_mut": "", "comment": "Loss of exclusive nuclear localization and loss of growth inhibition, when transfected in Saos-2 cells. No effect on the interaction with SV40 large T antigen.", "evidence": [ { "database": "UniProtKB", "id": "P13405", "url": "https://www.uniprot.org/uniprotkb/P13405" }, { "database": "PubMed", "id": "8336704", "url": "https://pubmed.ncbi.nlm.nih.gov/8336704" } ], "uniprot_canonical_ac": "P13405-1" }, { "start_pos": 853, "end_pos": 869, "sequence_org": "KRSAEGGNPPKPLKKLR", "sequence_mut": "", "comment": "Loss of exclusive nuclear localization. Decreased growth inhibition activity, when transfected in Saos-2 cells. No effect on the interaction with SV40 large T antigen, adenovirus E1a, nor E2F1.", "evidence": [ { "database": "UniProtKB", "id": "P13405", "url": "https://www.uniprot.org/uniprotkb/P13405" }, { "database": "PubMed", "id": "8336704", "url": "https://pubmed.ncbi.nlm.nih.gov/8336704" } ], "uniprot_canonical_ac": "P13405-1" }, { "start_pos": 866, "end_pos": 869, "sequence_org": "KKLR", "sequence_mut": "NKLQ", "comment": "Loss of exclusive nuclear localization, no effect on the interaction with SV40 large T antigen, adenovirus E1a, nor E2F1. Decreased growth inhibition activity, when transfected in Saos-2 cells. Complete loss of nuclear localization, loss of growth inhibition, when transfected in Saos-2 cells and loss of interaction with SV40 large T antigen, adenovirus E1a and E2F1; when associated with 733-K--P-769.", "evidence": [ { "database": "UniProtKB", "id": "P13405", "url": "https://www.uniprot.org/uniprotkb/P13405" }, { "database": "PubMed", "id": "8336704", "url": "https://pubmed.ncbi.nlm.nih.gov/8336704" } ], "uniprot_canonical_ac": "P13405-1" } ], "record_id": "pubmed.8336704", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 48 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular mechanisms of oncogenic mutations in tumors from patients with bilateral and unilateral retinoblastoma.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Hogg A, Bia B, Onadim Z, Cowell JK", "reference": { "type": "PubMed", "id": "8346255", "url": "https://pubmed.ncbi.nlm.nih.gov/8346255" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8346255", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of E2F-1 transactivation by direct binding of the retinoblastoma protein.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Helin K, Harlow E, Fattaey A", "reference": { "type": "PubMed", "id": "8413249", "url": "https://pubmed.ncbi.nlm.nih.gov/8413249" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 411, "end_pos": 411, "sequence_org": "Y", "sequence_mut": "C", "comment": "No retinoblastoma protein binding. No effect on interaction with and repression of CEBPA.", "evidence": [ { "database": "UniProtKB", "id": "Q01094", "url": "https://www.uniprot.org/uniprotkb/Q01094" }, { "database": "PubMed", "id": "8413249", "url": "https://pubmed.ncbi.nlm.nih.gov/8413249" }, { "database": "PubMed", "id": "20176812", "url": "https://pubmed.ncbi.nlm.nih.gov/20176812" } ], "uniprot_canonical_ac": "Q01094-1" } ], "record_id": "pubmed.8413249", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the retinoblastoma binding proteins RBP1 and RBP2.", "journal": "Oncogene", "date": "1993", "authors": "Fattaey AR, Helin K, Dembski MS, Dyson N, Harlow E, Vuocolo GA, Hanobik MG, Haskell KM, Oliff A, Defeo-Jones D, et al.", "reference": { "type": "PubMed", "id": "8414517", "url": "https://pubmed.ncbi.nlm.nih.gov/8414517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29374-1", "protein_name": "AT-rich interactive domain-containing protein 4A", "gene_name": "ARID4A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P29375-1", "protein_name": "Lysine-specific demethylase 5A", "gene_name": "KDM5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8414517", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regions of the retinoblastoma gene product required for its interaction with the E2F transcription factor are necessary for E2 promoter repression and pRb-mediated growth suppression.", "journal": "Molecular and cellular biology", "date": "1993", "authors": "Hiebert SW", "reference": { "type": "PubMed", "id": "8497257", "url": "https://pubmed.ncbi.nlm.nih.gov/8497257" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8497257", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Germline mutations in the RB1 gene in patients with hereditary retinoblastoma.", "journal": "Genes, chromosomes & cancer", "date": "1995", "authors": "Liu Z, Song Y, Bia B, Cowell JK", "reference": { "type": "PubMed", "id": "8605116", "url": "https://pubmed.ncbi.nlm.nih.gov/8605116" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8605116", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of the cyclin E gene by transcription factor E2F1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Ohtani K, DeGregori J, Nevins JR", "reference": { "type": "PubMed", "id": "8618861", "url": "https://pubmed.ncbi.nlm.nih.gov/8618861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8618861", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential regulation of retinoblastoma protein function by specific Cdk phosphorylation sites.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Knudsen ES, Wang JY", "reference": { "type": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr252", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr356", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 373, "end_pos": 373, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr373", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 567, "end_pos": 567, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10207050", "url": "https://pubmed.ncbi.nlm.nih.gov/10207050" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser567", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 608, "end_pos": 608, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10207050", "url": "https://pubmed.ncbi.nlm.nih.gov/10207050" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser608", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 612, "end_pos": 612, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10207050", "url": "https://pubmed.ncbi.nlm.nih.gov/10207050" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser612", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 821, "end_pos": 821, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9315635", "url": "https://pubmed.ncbi.nlm.nih.gov/9315635" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr821", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 826, "end_pos": 826, "kinase_uniprot_canonical_ac": "P11802-1", "kinase_gene_name": "CDK4", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9315635", "url": "https://pubmed.ncbi.nlm.nih.gov/9315635" } ], "site_lbl": "Thr826", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 826, "end_pos": 826, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr826", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.8626527", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cdc25 cell-cycle phosphatase as a target of c-myc.", "journal": "Nature", "date": "1996", "authors": "Galaktionov K, Chen X, Beach D", "reference": { "type": "PubMed", "id": "8700224", "url": "https://pubmed.ncbi.nlm.nih.gov/8700224" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y243-1", "protein_name": "RAC-gamma serine/threonine-protein kinase", "gene_name": "AKT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11388-1", "protein_name": "DNA topoisomerase 2-alpha", "gene_name": "TOP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30291-1", "protein_name": "Wee1-like protein kinase", "gene_name": "WEE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31751-1", "protein_name": "RAC-beta serine/threonine-protein kinase", "gene_name": "AKT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TDN4-1", "protein_name": "CDK5 and ABL1 enzyme substrate 1", "gene_name": "CABLES1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8700224", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 33 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutational scanning of large genes by extensive PCR multiplexing and two-dimensional electrophoresis: application to the RB1 gene.", "journal": "Human molecular genetics", "date": "1996", "authors": "Van Orsouw NJ, Li D, van der Vlies P, Scheffer H, Eng C, Buys CH, Li FP, Vijg J", "reference": { "type": "PubMed", "id": "8776589", "url": "https://pubmed.ncbi.nlm.nih.gov/8776589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8776589", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human cytomegalovirus IE1-72 protein interacts with the cellular p107 protein and relieves p107-mediated transcriptional repression of an E2F-responsive promoter.", "journal": "Journal of virology", "date": "1996-11", "authors": "Poma E E, Kowalik T F, Zhu L, Sinclair J H, Huang E S", "reference": { "type": "PubMed", "id": "8892909", "url": "https://pubmed.ncbi.nlm.nih.gov/8892909" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8892909", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of the HsOrc1 gene, a human ORC1 homolog, is regulated by cell proliferation via the E2F transcription factor.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Ohtani K, DeGregori J, Leone G, Herendeen DR, Kelly TJ, Nevins JR", "reference": { "type": "PubMed", "id": "8943353", "url": "https://pubmed.ncbi.nlm.nih.gov/8943353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8943353", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The consensus motif for phosphorylation by cyclin D1-Cdk4 is different from that for phosphorylation by cyclin A/E-Cdk2.", "journal": "The EMBO journal", "date": "1996", "authors": "Kitagawa M, Higashi H, Jung HK, Suzuki-Takahashi I, Ikeda M, Tamai K, Kato J, Segawa K, Yoshida E, Nishimura S, Taya Y", "reference": { "type": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "P11802-1", "kinase_gene_name": "CDK4", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "23336272", "url": "https://pubmed.ncbi.nlm.nih.gov/23336272" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "P30279-1", "kinase_gene_name": "CCND2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 780, "end_pos": 780, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "11254678", "url": "https://pubmed.ncbi.nlm.nih.gov/11254678" }, { "database": "PubMed", "id": "16326706", "url": "https://pubmed.ncbi.nlm.nih.gov/16326706" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "9003781", "url": "https://pubmed.ncbi.nlm.nih.gov/9003781" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "10022898", "url": "https://pubmed.ncbi.nlm.nih.gov/10022898" }, { "database": "PubMed", "id": "10086343", "url": "https://pubmed.ncbi.nlm.nih.gov/10086343" }, { "database": "PubMed", "id": "11811957", "url": "https://pubmed.ncbi.nlm.nih.gov/11811957" }, { "database": "PubMed", "id": "12241561", "url": "https://pubmed.ncbi.nlm.nih.gov/12241561" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15489884", "url": "https://pubmed.ncbi.nlm.nih.gov/15489884" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "17621266", "url": "https://pubmed.ncbi.nlm.nih.gov/17621266" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "19551155", "url": "https://pubmed.ncbi.nlm.nih.gov/19551155" }, { "database": "PubMed", "id": "19638577", "url": "https://pubmed.ncbi.nlm.nih.gov/19638577" }, { "database": "PubMed", "id": "20080185", "url": "https://pubmed.ncbi.nlm.nih.gov/20080185" }, { "database": "PubMed", "id": "20372067", "url": "https://pubmed.ncbi.nlm.nih.gov/20372067" }, { "database": "PubMed", "id": "22493456", "url": "https://pubmed.ncbi.nlm.nih.gov/22493456" }, { "database": "PubMed", "id": "23505430", "url": "https://pubmed.ncbi.nlm.nih.gov/23505430" }, { "database": "PubMed", "id": "24169358", "url": "https://pubmed.ncbi.nlm.nih.gov/24169358" }, { "database": "PubMed", "id": "24454925", "url": "https://pubmed.ncbi.nlm.nih.gov/24454925" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25737734", "url": "https://pubmed.ncbi.nlm.nih.gov/25737734" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27849562", "url": "https://pubmed.ncbi.nlm.nih.gov/27849562" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "29526568", "url": "https://pubmed.ncbi.nlm.nih.gov/29526568" }, { "database": "PubMed", "id": "29541385", "url": "https://pubmed.ncbi.nlm.nih.gov/29541385" }, { "database": "PubMed", "id": "30519351", "url": "https://pubmed.ncbi.nlm.nih.gov/30519351" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" } ], "site_lbl": "Ser780", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.9003781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Monoclonal antibodies specific for underphosphorylated retinoblastoma protein identify a cell cycle regulated phosphorylation site targeted by CDKs.", "journal": "Oncogene", "date": "1997", "authors": "Zarkowska T, U S, Harlow E, Mittnacht S", "reference": { "type": "PubMed", "id": "9010227", "url": "https://pubmed.ncbi.nlm.nih.gov/9010227" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 608, "end_pos": 608, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "12895470", "url": "https://pubmed.ncbi.nlm.nih.gov/12895470" }, { "database": "PubMed", "id": "15081408", "url": "https://pubmed.ncbi.nlm.nih.gov/15081408" }, { "database": "PubMed", "id": "22322860", "url": "https://pubmed.ncbi.nlm.nih.gov/22322860" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "34042274", "url": "https://pubmed.ncbi.nlm.nih.gov/34042274" }, { "database": "PubMed", "id": "35732608", "url": "https://pubmed.ncbi.nlm.nih.gov/35732608" }, { "database": "PubMed", "id": "9010227", "url": "https://pubmed.ncbi.nlm.nih.gov/9010227" } ], "site_lbl": "Ser608", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.9010227", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Accumulation of E2F-4.DP-1 DNA binding complexes correlates with induction of dhfr gene expression during the G1 to S phase transition.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Wells JM, Illenye S, Magae J, Wu CL, Heintz NH", "reference": { "type": "PubMed", "id": "9020173", "url": "https://pubmed.ncbi.nlm.nih.gov/9020173" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9020173", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "New functional activities for the p21 family of CDK inhibitors.", "journal": "Genes & development", "date": "1997", "authors": "LaBaer J, Garrett MD, Stevenson LF, Slingerland JM, Sandhu C, Chou HS, Fattaey A, Harlow E", "reference": { "type": "PubMed", "id": "9106657", "url": "https://pubmed.ncbi.nlm.nih.gov/9106657" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9106657", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential phosphorylation of the retinoblastoma protein by G1/S cyclin-dependent kinases.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Zarkowska T, Mittnacht S", "reference": { "type": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "IEDB", "id": "P06400", "url": "https://www.iedb.org/epitope/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "27869121", "url": "https://pubmed.ncbi.nlm.nih.gov/27869121" }, { "database": "PubMed", "id": "31848261", "url": "https://pubmed.ncbi.nlm.nih.gov/31848261" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "29468545", "url": "https://pubmed.ncbi.nlm.nih.gov/29468545" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "21368870", "url": "https://pubmed.ncbi.nlm.nih.gov/21368870" }, { "database": "PubMed", "id": "22279936", "url": "https://pubmed.ncbi.nlm.nih.gov/22279936" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24815188", "url": "https://pubmed.ncbi.nlm.nih.gov/24815188" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "36274096", "url": "https://pubmed.ncbi.nlm.nih.gov/36274096" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr252", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "P11802-1", "kinase_gene_name": "CDK4", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" } ], "site_lbl": "Thr356", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "18220336", "url": "https://pubmed.ncbi.nlm.nih.gov/18220336" }, { "database": "IntAct", "id": "P06400", "url": "https://www.ebi.ac.uk/intact/interactors/id:P06400*" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "17380128", "url": "https://pubmed.ncbi.nlm.nih.gov/17380128" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "23304241", "url": "https://pubmed.ncbi.nlm.nih.gov/23304241" }, { "database": "PubMed", "id": "24466208", "url": "https://pubmed.ncbi.nlm.nih.gov/24466208" }, { "database": "PubMed", "id": "26265441", "url": "https://pubmed.ncbi.nlm.nih.gov/26265441" } ], "site_lbl": "Thr356", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 373, "end_pos": 373, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "34042274", "url": "https://pubmed.ncbi.nlm.nih.gov/34042274" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr373", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "P11802-1", "kinase_gene_name": "CDK4", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" } ], "site_lbl": "Thr5", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" } ], "site_lbl": "Thr5", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 788, "end_pos": 788, "kinase_uniprot_canonical_ac": "P11802-1", "kinase_gene_name": "CDK4", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" } ], "site_lbl": "Ser788", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 788, "end_pos": 788, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser788", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24274149", "url": "https://pubmed.ncbi.nlm.nih.gov/24274149" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK1 and CDK3", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15084261", "url": "https://pubmed.ncbi.nlm.nih.gov/15084261" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "15194426", "url": "https://pubmed.ncbi.nlm.nih.gov/15194426" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16236452", "url": "https://pubmed.ncbi.nlm.nih.gov/16236452" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "17568194", "url": "https://pubmed.ncbi.nlm.nih.gov/17568194" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "18938028", "url": "https://pubmed.ncbi.nlm.nih.gov/18938028" }, { "database": "PubMed", "id": "20703084", "url": "https://pubmed.ncbi.nlm.nih.gov/20703084" }, { "database": "PubMed", "id": "21115810", "url": "https://pubmed.ncbi.nlm.nih.gov/21115810" }, { "database": "PubMed", "id": "22787429", "url": "https://pubmed.ncbi.nlm.nih.gov/22787429" }, { "database": "PubMed", "id": "24401087", "url": "https://pubmed.ncbi.nlm.nih.gov/24401087" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25522274", "url": "https://pubmed.ncbi.nlm.nih.gov/25522274" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "26121043", "url": "https://pubmed.ncbi.nlm.nih.gov/26121043" }, { "database": "PubMed", "id": "27527160", "url": "https://pubmed.ncbi.nlm.nih.gov/27527160" }, { "database": "PubMed", "id": "28169375", "url": "https://pubmed.ncbi.nlm.nih.gov/28169375" }, { "database": "PubMed", "id": "28176922", "url": "https://pubmed.ncbi.nlm.nih.gov/28176922" }, { "database": "PubMed", "id": "28734226", "url": "https://pubmed.ncbi.nlm.nih.gov/28734226" }, { "database": "PubMed", "id": "29088742", "url": "https://pubmed.ncbi.nlm.nih.gov/29088742" }, { "database": "PubMed", "id": "31042625", "url": "https://pubmed.ncbi.nlm.nih.gov/31042625" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "33556114", "url": "https://pubmed.ncbi.nlm.nih.gov/33556114" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 821, "end_pos": 821, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9315635", "url": "https://pubmed.ncbi.nlm.nih.gov/9315635" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr821", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 826, "end_pos": 826, "kinase_uniprot_canonical_ac": "P11802-1", "kinase_gene_name": "CDK4", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9315635", "url": "https://pubmed.ncbi.nlm.nih.gov/9315635" } ], "site_lbl": "Thr826", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 826, "end_pos": 826, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK4", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "23737759", "url": "https://pubmed.ncbi.nlm.nih.gov/23737759" }, { "database": "PubMed", "id": "25695870", "url": "https://pubmed.ncbi.nlm.nih.gov/25695870" }, { "database": "PubMed", "id": "28105458", "url": "https://pubmed.ncbi.nlm.nih.gov/28105458" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" }, { "database": "PubMed", "id": "16360038", "url": "https://pubmed.ncbi.nlm.nih.gov/16360038" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Thr826", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.9139732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetics of retinoblastoma: a study.", "journal": "Cancer genetics and cytogenetics", "date": "1997", "authors": "Mateu E, Sanchez F, Najera C, Beneyto M, Castell V, Hernandez M, Serra I, Prieto F", "reference": { "type": "PubMed", "id": "9140452", "url": "https://pubmed.ncbi.nlm.nih.gov/9140452" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9140452", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The subcellular localization of E2F-4 is cell-cycle dependent.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Lindeman GJ, Gaubatz S, Livingston DM, Ginsberg D", "reference": { "type": "PubMed", "id": "9144196", "url": "https://pubmed.ncbi.nlm.nih.gov/9144196" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9144196", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural similarity between the pocket region of retinoblastoma tumour suppressor and the cyclin-box.", "journal": "Nat. Struct. Biol.", "date": "1997", "authors": "Kim H Y, Cho Y", "reference": { "type": "PubMed", "id": "9145110", "url": "https://pubmed.ncbi.nlm.nih.gov/9145110" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9145110", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cyclin D1/Cdk4 regulates retinoblastoma protein-mediated cell cycle arrest by site-specific phosphorylation.", "journal": "Molecular biology of the cell", "date": "1997", "authors": "Connell-Crowley L, Harper JW, Goodrich DW", "reference": { "type": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 249, "end_pos": 249, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser249", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 252, "end_pos": 252, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr252", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 356, "end_pos": 356, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr356", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 373, "end_pos": 373, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr373", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 567, "end_pos": 567, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10207050", "url": "https://pubmed.ncbi.nlm.nih.gov/10207050" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser567", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 608, "end_pos": 608, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10207050", "url": "https://pubmed.ncbi.nlm.nih.gov/10207050" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser608", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 612, "end_pos": 612, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10207050", "url": "https://pubmed.ncbi.nlm.nih.gov/10207050" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser612", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 788, "end_pos": 788, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser788", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "P11802-1", "kinase_gene_name": "CDK4", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "23336272", "url": "https://pubmed.ncbi.nlm.nih.gov/23336272" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 795, "end_pos": 795, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" }, { "database": "PubMed", "id": "15741232", "url": "https://pubmed.ncbi.nlm.nih.gov/15741232" }, { "database": "PubMed", "id": "15809340", "url": "https://pubmed.ncbi.nlm.nih.gov/15809340" }, { "database": "PubMed", "id": "22094256", "url": "https://pubmed.ncbi.nlm.nih.gov/22094256" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PRO", "id": "P06400", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P06400" }, { "database": "PubMed", "id": "10210318", "url": "https://pubmed.ncbi.nlm.nih.gov/10210318" }, { "database": "PubMed", "id": "12490153", "url": "https://pubmed.ncbi.nlm.nih.gov/12490153" }, { "database": "PubMed", "id": "12754735", "url": "https://pubmed.ncbi.nlm.nih.gov/12754735" }, { "database": "PubMed", "id": "14676836", "url": "https://pubmed.ncbi.nlm.nih.gov/14676836" }, { "database": "PubMed", "id": "14732295", "url": "https://pubmed.ncbi.nlm.nih.gov/14732295" }, { "database": "PubMed", "id": "15547725", "url": "https://pubmed.ncbi.nlm.nih.gov/15547725" }, { "database": "PubMed", "id": "15567975", "url": "https://pubmed.ncbi.nlm.nih.gov/15567975" }, { "database": "PubMed", "id": "15657897", "url": "https://pubmed.ncbi.nlm.nih.gov/15657897" }, { "database": "PubMed", "id": "15817163", "url": "https://pubmed.ncbi.nlm.nih.gov/15817163" }, { "database": "PubMed", "id": "15941859", "url": "https://pubmed.ncbi.nlm.nih.gov/15941859" }, { "database": "PubMed", "id": "16718685", "url": "https://pubmed.ncbi.nlm.nih.gov/16718685" }, { "database": "PubMed", "id": "17896003", "url": "https://pubmed.ncbi.nlm.nih.gov/17896003" }, { "database": "PubMed", "id": "18190706", "url": "https://pubmed.ncbi.nlm.nih.gov/18190706" }, { "database": "PubMed", "id": "18383818", "url": "https://pubmed.ncbi.nlm.nih.gov/18383818" }, { "database": "PubMed", "id": "18784806", "url": "https://pubmed.ncbi.nlm.nih.gov/18784806" }, { "database": "PubMed", "id": "22450712", "url": "https://pubmed.ncbi.nlm.nih.gov/22450712" }, { "database": "PubMed", "id": "24463355", "url": "https://pubmed.ncbi.nlm.nih.gov/24463355" }, { "database": "PubMed", "id": "25009665", "url": "https://pubmed.ncbi.nlm.nih.gov/25009665" }, { "database": "PubMed", "id": "26058606", "url": "https://pubmed.ncbi.nlm.nih.gov/26058606" }, { "database": "PubMed", "id": "26106036", "url": "https://pubmed.ncbi.nlm.nih.gov/26106036" }, { "database": "PubMed", "id": "26250117", "url": "https://pubmed.ncbi.nlm.nih.gov/26250117" }, { "database": "PubMed", "id": "27419601", "url": "https://pubmed.ncbi.nlm.nih.gov/27419601" }, { "database": "PubMed", "id": "27748766", "url": "https://pubmed.ncbi.nlm.nih.gov/27748766" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "33324635", "url": "https://pubmed.ncbi.nlm.nih.gov/33324635" } ], "site_lbl": "Ser795", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 807, "end_pos": 807, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20058876", "url": "https://pubmed.ncbi.nlm.nih.gov/20058876" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser807", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 811, "end_pos": 811, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Ser811", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 821, "end_pos": 821, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9315635", "url": "https://pubmed.ncbi.nlm.nih.gov/9315635" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr821", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 826, "end_pos": 826, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr826", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.9190208", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 47 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 13 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Constitutional RB1-gene mutations in patients with isolated unilateral retinoblastoma.", "journal": "American journal of human genetics", "date": "1997", "authors": "Lohmann DR, Gerick M, Brandt B, Oelschlager U, Lorenz B, Passarge E, Horsthemke B", "reference": { "type": "PubMed", "id": "9311732", "url": "https://pubmed.ncbi.nlm.nih.gov/9311732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9311732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dual mechanisms for the inhibition of E2F binding to RB by cyclin-dependent kinase-mediated RB phosphorylation.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Knudsen ES, Wang JY", "reference": { "type": "PubMed", "id": "9315635", "url": "https://pubmed.ncbi.nlm.nih.gov/9315635" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 821, "end_pos": 821, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9315635", "url": "https://pubmed.ncbi.nlm.nih.gov/9315635" }, { "database": "PubMed", "id": "10499802", "url": "https://pubmed.ncbi.nlm.nih.gov/10499802" }, { "database": "PubMed", "id": "1756735", "url": "https://pubmed.ncbi.nlm.nih.gov/1756735" }, { "database": "PubMed", "id": "9190208", "url": "https://pubmed.ncbi.nlm.nih.gov/9190208" } ], "site_lbl": "Thr821", "uniprot_canonical_ac": "P06400-1" }, { "start_pos": 826, "end_pos": 826, "kinase_uniprot_canonical_ac": "P11802-1", "kinase_gene_name": "CDK4", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P06400", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P06400" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "8626527", "url": "https://pubmed.ncbi.nlm.nih.gov/8626527" }, { "database": "PubMed", "id": "9139732", "url": "https://pubmed.ncbi.nlm.nih.gov/9139732" }, { "database": "PubMed", "id": "9315635", "url": "https://pubmed.ncbi.nlm.nih.gov/9315635" } ], "site_lbl": "Thr826", "uniprot_canonical_ac": "P06400-1" } ], "record_id": "pubmed.9315635", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential interaction of the cyclin-dependent kinase (Cdk) inhibitor p27Kip1 with cyclin A-Cdk2 and cyclin D2-Cdk4.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Blain SW, Montalvo E, Massague J", "reference": { "type": "PubMed", "id": "9325318", "url": "https://pubmed.ncbi.nlm.nih.gov/9325318" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61024-1", "protein_name": "Cyclin-dependent kinases regulatory subunit 1", "gene_name": "CKS1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13616-1", "protein_name": "Cullin-1", "gene_name": "CUL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60674-1", "protein_name": "Tyrosine-protein kinase JAK2", "gene_name": "JAK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13309-1", "protein_name": "S-phase kinase-associated protein 2", "gene_name": "SKP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62714-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform", "gene_name": "PPP2CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42771-1", "protein_name": "Cyclin-dependent kinase inhibitor 2A", "gene_name": "CDKN2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42772-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor B", "gene_name": "CDKN2B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5P8-1", "protein_name": "Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta", "gene_name": "PPP2R3B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51948-1", "protein_name": "CDK-activating kinase assembly factor MAT1", "gene_name": "MNAT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P51946-1", "protein_name": "Cyclin-H", "gene_name": "CCNH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63151-1", "protein_name": "Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform", "gene_name": "PPP2R2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P07948-1", "protein_name": "Tyrosine-protein kinase Lyn", "gene_name": "LYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P55273-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor D", "gene_name": "CDKN2D", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50613-1", "protein_name": "Cyclin-dependent kinase 7", "gene_name": "CDK7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24941-1", "protein_name": "Cyclin-dependent kinase 2", "gene_name": "CDK2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96020-1", "protein_name": "G1/S-specific cyclin-E2", "gene_name": "CCNE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42773-1", "protein_name": "Cyclin-dependent kinase 4 inhibitor C", "gene_name": "CDKN2C", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00716-1", "protein_name": "Transcription factor E2F3", "gene_name": "E2F3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14209-1", "protein_name": "Transcription factor E2F2", "gene_name": "E2F2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13882-1", "protein_name": "Protein-tyrosine kinase 6", "gene_name": "PTK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00519-1", "protein_name": "Tyrosine-protein kinase ABL1", "gene_name": "ABL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P63208-1", "protein_name": "S-phase kinase-associated protein 1", "gene_name": "SKP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30154-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform", "gene_name": "PPP2R1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30153-1", "protein_name": "Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform", "gene_name": "PPP2R1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P67775-1", "protein_name": "Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform", "gene_name": "PPP2CA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9325318", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deletion of RB exons 24 and 25 causes low-penetrance retinoblastoma.", "journal": "American journal of human genetics", "date": "1997", "authors": "Bremner R, Du DC, Connolly-Wilson MJ, Bridge P, Ahmad KF, Mostachfi H, Rushlow D, Dunn JM, Gallie BL", "reference": { "type": "PubMed", "id": "9326321", "url": "https://pubmed.ncbi.nlm.nih.gov/9326321" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P06400", "url": "https://www.uniprot.org/uniprotkb/P06400" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9326321", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]