[ { "title": "The ALG10 locus of Saccharomyces cerevisiae encodes the alpha-1,2 glucosyltransferase of the endoplasmic reticulum: the terminal glucose of the lipid-linked oligosaccharide is required for efficient N-linked glycosylation.", "journal": "Glycobiology", "date": "1998", "authors": "Burda P, Aebi M", "reference": { "type": "PubMed", "id": "9597543", "url": "https://pubmed.ncbi.nlm.nih.gov/9597543" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BVK2-1", "protein_name": "Dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase", "gene_name": "ALG8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT22-1", "protein_name": "Chitobiosyldiphosphodolichol beta-mannosyltransferase", "gene_name": "ALG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92685-1", "protein_name": "Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase", "gene_name": "ALG3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BV10-1", "protein_name": "Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase", "gene_name": "ALG12", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP73-1", "protein_name": "UDP-N-acetylglucosamine transferase subunit ALG13", "gene_name": "ALG13", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96F25-1", "protein_name": "UDP-N-acetylglucosamine transferase subunit ALG14", "gene_name": "ALG14", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H553-1", "protein_name": "Alpha-1,3/1,6-mannosyltransferase ALG2", "gene_name": "ALG2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75352-1", "protein_name": "Mannose-P-dolichol utilization defect 1 protein", "gene_name": "MPDU1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96AA3-1", "protein_name": "Man(5)GlcNAc(2)-PP-dolichol translocation protein RFT1", "gene_name": "RFT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5I7T1-1", "protein_name": "Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase B", "gene_name": "ALG10B", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y672-1", "protein_name": "Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase", "gene_name": "ALG6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q2TAA5-1", "protein_name": "GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase", "gene_name": "ALG11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H6U8-1", "protein_name": "Alpha-1,2-mannosyltransferase ALG9", "gene_name": "ALG9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H3H5-1", "protein_name": "UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase", "gene_name": "DPAGT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50076-1", "protein_name": "Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase", "gene_name": "DIE2", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "Q5BKT4-1", "protein_name": "Dol-P-Glc:Glc(2)Man(9)GlcNAc(2)-PP-Dol alpha-1,2-glucosyltransferase A", "gene_name": "ALG10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BVK2", "url": "https://www.uniprot.org/uniprotkb/Q9BVK2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9597543", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oxidative demethylation by Escherichia coli AlkB directly reverts DNA base damage.", "journal": "Nature", "date": "2002", "authors": "Trewick SC, Henshaw TF, Hausinger RP, Lindahl T, Sedgwick B", "reference": { "type": "PubMed", "id": "12226667", "url": "https://pubmed.ncbi.nlm.nih.gov/12226667" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1I8-1", "protein_name": "Activating signal cointegrator 1 complex subunit 2", "gene_name": "ASCC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9N2-1", "protein_name": "Activating signal cointegrator 1 complex subunit 1", "gene_name": "ASCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3C0-1", "protein_name": "Activating signal cointegrator 1 complex subunit 3", "gene_name": "ASCC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12226667", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reversal of DNA alkylation damage by two human dioxygenases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Duncan T, Trewick SC, Koivisto P, Bates PA, Lindahl T, Sedgwick B", "reference": { "type": "PubMed", "id": "12486230", "url": "https://pubmed.ncbi.nlm.nih.gov/12486230" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NS38-1", "protein_name": "DNA oxidative demethylase ALKBH2", "gene_name": "ALKBH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1I8-1", "protein_name": "Activating signal cointegrator 1 complex subunit 2", "gene_name": "ASCC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9N2-1", "protein_name": "Activating signal cointegrator 1 complex subunit 1", "gene_name": "ASCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3C0-1", "protein_name": "Activating signal cointegrator 1 complex subunit 3", "gene_name": "ASCC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12486230", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human and bacterial oxidative demethylases repair alkylation damage in both RNA and DNA.", "journal": "Nature", "date": "2003", "authors": "Aas PA, Otterlei M, Falnes PO, Vagbo CB, Skorpen F, Akbari M, Sundheim O, Bjoras M, Slupphaug G, Seeberg E, Krokan HE", "reference": { "type": "PubMed", "id": "12594517", "url": "https://pubmed.ncbi.nlm.nih.gov/12594517" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NS38-1", "protein_name": "DNA oxidative demethylase ALKBH2", "gene_name": "ALKBH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1I8-1", "protein_name": "Activating signal cointegrator 1 complex subunit 2", "gene_name": "ASCC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9N2-1", "protein_name": "Activating signal cointegrator 1 complex subunit 1", "gene_name": "ASCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3C0-1", "protein_name": "Activating signal cointegrator 1 complex subunit 3", "gene_name": "ASCC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12594517", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Repair of methylation damage in DNA and RNA by mammalian AlkB homologues.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Lee DH, Jin SG, Cai S, Chen Y, Pfeifer GP, O'Connor TR", "reference": { "type": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NS38-1", "protein_name": "DNA oxidative demethylase ALKBH2", "gene_name": "ALKBH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8K1E6-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "Alkbh3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6P6J4-1", "protein_name": "DNA oxidative demethylase ALKBH2", "gene_name": "Alkbh2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 193, "end_pos": 193, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "26863196", "url": "https://pubmed.ncbi.nlm.nih.gov/26863196" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 257, "end_pos": 257, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreases activity by about 65%.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "22055184", "url": "https://pubmed.ncbi.nlm.nih.gov/22055184" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 173, "end_pos": 173, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity associated with decreased rDNA transcription.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "23972994", "url": "https://pubmed.ncbi.nlm.nih.gov/23972994" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q6NS38-1" }, { "start_pos": 236, "end_pos": 236, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreases activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q6NS38-1" }, { "start_pos": 193, "end_pos": 193, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8K1E6", "url": "https://www.uniprot.org/uniprotkb/Q8K1E6" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q8K1E6-1" }, { "start_pos": 257, "end_pos": 257, "sequence_org": "H", "sequence_mut": "A", "comment": "Reduced activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8K1E6", "url": "https://www.uniprot.org/uniprotkb/Q8K1E6" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q8K1E6-1" }, { "start_pos": 151, "end_pos": 151, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P6J4", "url": "https://www.uniprot.org/uniprotkb/Q6P6J4" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q6P6J4-1" }, { "start_pos": 214, "end_pos": 214, "sequence_org": "H", "sequence_mut": "A", "comment": "Reduces activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6P6J4", "url": "https://www.uniprot.org/uniprotkb/Q6P6J4" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q6P6J4-1" } ], "record_id": "pubmed.16174769", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human ABH3 structure and key residues for oxidative demethylation to reverse DNA/RNA damage.", "journal": "The EMBO journal", "date": "2006", "authors": "Sundheim O, Vagbo CB, Bjoras M, Sousa MM, Talstad V, Aas PA, Drablos F, Krokan HE, Tainer JA, Slupphaug G", "reference": { "type": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1I8-1", "protein_name": "Activating signal cointegrator 1 complex subunit 2", "gene_name": "ASCC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9N2-1", "protein_name": "Activating signal cointegrator 1 complex subunit 1", "gene_name": "ASCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3C0-1", "protein_name": "Activating signal cointegrator 1 complex subunit 3", "gene_name": "ASCC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 122, "end_pos": 122, "sequence_org": "R", "sequence_mut": "A", "comment": "Decreases activity towards ssDNA by 25%. Loss of activity towards dsDNA.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 123, "end_pos": 123, "sequence_org": "E", "sequence_mut": "A", "comment": "Strongly increases activity towards dsDNA, possibly by facilitating access to the active site.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 131, "end_pos": 131, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 177, "end_pos": 177, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of activity against N1-methyladenine.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 177, "end_pos": 177, "sequence_org": "L", "sequence_mut": "E", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 177, "end_pos": 177, "sequence_org": "L", "sequence_mut": "I", "comment": "Decreases activity against N1-methyladenine.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 177, "end_pos": 177, "sequence_org": "L", "sequence_mut": "M", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 177, "end_pos": 177, "sequence_org": "L", "sequence_mut": "N", "comment": "Loss of activity against N1-methyladenine.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 177, "end_pos": 177, "sequence_org": "L", "sequence_mut": "Q", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 179, "end_pos": 179, "sequence_org": "N", "sequence_mut": "A", "comment": "Decreases activity by about 60%.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 181, "end_pos": 181, "sequence_org": "Y", "sequence_mut": "A", "comment": "Strong decrease of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 189, "end_pos": 189, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly increases activity towards dsDNA, possibly by facilitating access to the active site.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 191, "end_pos": 191, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 269, "end_pos": 269, "sequence_org": "R", "sequence_mut": "A", "comment": "Strong decrease of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 271, "end_pos": 271, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 275, "end_pos": 275, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "16858410", "url": "https://pubmed.ncbi.nlm.nih.gov/16858410" } ], "uniprot_canonical_ac": "Q96Q83-1" } ], "record_id": "pubmed.16858410", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prostate cancer antigen-1 as a potential novel marker for prostate cancer.", "journal": "Asian journal of andrology", "date": "2007", "authors": "Liu BQ, Wu YD, Li PH, Wei JX, Zhang T, Liu RL", "reference": { "type": "PubMed", "id": "17968469", "url": "https://pubmed.ncbi.nlm.nih.gov/17968469" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17968469", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and sub-cellular localization of human ABH family molecules.", "journal": "J. Cell. Mol. Med.", "date": "2007", "authors": "Tsujikawa K, Koike K, Kitae K, Shinkawa A, Arima H, Suzuki T, Tsuchiya M, Makino Y, Furukawa T, Konishi N, Yamamoto H", "reference": { "type": "PubMed", "id": "17979886", "url": "https://pubmed.ncbi.nlm.nih.gov/17979886" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NS38-1", "protein_name": "DNA oxidative demethylase ALKBH2", "gene_name": "ALKBH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13686-1", "protein_name": "Nucleic acid dioxygenase ALKBH1", "gene_name": "ALKBH1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXW9-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4", "gene_name": "ALKBH4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3KRA9-1", "protein_name": "Probable RNA/DNA demethylase ALKBH6", "gene_name": "ALKBH6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BT30-1", "protein_name": "RNA demethylase ALKBH7, mitochondrial", "gene_name": "ALKBH7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P6C2-2", "protein_name": "RNA demethylase ALKBH5", "gene_name": "ALKBH5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96BT7-1", "protein_name": "tRNA (carboxymethyluridine(34)-5-O)-methyltransferase ALKBH8", "gene_name": "ALKBH8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17979886", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanistic insight into the recognition of single-stranded and double-stranded DNA substrates by ABH2 and ABH3.", "journal": "Molecular bioSystems", "date": "2010", "authors": "Chen B, Liu H, Sun X, Yang CG", "reference": { "type": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NS38-1", "protein_name": "DNA oxidative demethylase ALKBH2", "gene_name": "ALKBH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1I8-1", "protein_name": "Activating signal cointegrator 1 complex subunit 2", "gene_name": "ASCC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9N2-1", "protein_name": "Activating signal cointegrator 1 complex subunit 1", "gene_name": "ASCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3C0-1", "protein_name": "Activating signal cointegrator 1 complex subunit 3", "gene_name": "ASCC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 122, "end_pos": 124, "sequence_org": "RED", "sequence_mut": "VGF", "comment": "Acquires the capacity to efficiently repair N1-methyladenine adduct in dsDNA.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 101, "end_pos": 101, "sequence_org": "V", "sequence_mut": "A", "comment": "Decreases activity toward N1-methyladenine adduct in ssDNA. Has no effect on lesion repair in dsDNA.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" } ], "uniprot_canonical_ac": "Q6NS38-1" }, { "start_pos": 101, "end_pos": 103, "sequence_org": "VFG", "sequence_mut": "RED", "comment": "Strong decrease of activity toward N1-methyladenine adduct in both ssDNA and dsDNA substrates.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" } ], "uniprot_canonical_ac": "Q6NS38-1" }, { "start_pos": 102, "end_pos": 102, "sequence_org": "F", "sequence_mut": "A", "comment": "Strong decrease of activity toward N1-methyladenine adduct. Loss of activity toward N1-methyladenine adduct in either ssDNA or dsDNA; when associated with G-101.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "22659876", "url": "https://pubmed.ncbi.nlm.nih.gov/22659876" }, { "database": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" } ], "uniprot_canonical_ac": "Q6NS38-1" }, { "start_pos": 110, "end_pos": 110, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of activity toward N1-methyladenine adduct in either ssDNA or dsDNA.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" } ], "uniprot_canonical_ac": "Q6NS38-1" }, { "start_pos": 122, "end_pos": 122, "sequence_org": "Y", "sequence_mut": "A", "comment": "Decreases activity toward N1-methyladenine adduct in either ssDNA or dsDNA.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" } ], "uniprot_canonical_ac": "Q6NS38-1" }, { "start_pos": 124, "end_pos": 124, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of activity toward N1-methyladenine adduct in either ssDNA or dsDNA.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" } ], "uniprot_canonical_ac": "Q6NS38-1" }, { "start_pos": 125, "end_pos": 125, "sequence_org": "S", "sequence_mut": "A", "comment": "Strong decrease of activity toward N1-methyladenine adduct in ssDNA. Has no effect on lesion repair in dsDNA.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" } ], "uniprot_canonical_ac": "Q6NS38-1" }, { "start_pos": 175, "end_pos": 175, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6NS38", "url": "https://www.uniprot.org/uniprotkb/Q6NS38" }, { "database": "PubMed", "id": "20714506", "url": "https://pubmed.ncbi.nlm.nih.gov/20714506" } ], "uniprot_canonical_ac": "Q6NS38-1" } ], "record_id": "pubmed.20714506", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation.", "journal": "Molecular cell", "date": "2011", "authors": "Dango S, Mosammaparast N, Sowa ME, Xiong LJ, Wu F, Park K, Rubin M, Gygi S, Harper JW, Shi Y", "reference": { "type": "PubMed", "id": "22055184", "url": "https://pubmed.ncbi.nlm.nih.gov/22055184" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1I8-1", "protein_name": "Activating signal cointegrator 1 complex subunit 2", "gene_name": "ASCC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9N2-1", "protein_name": "Activating signal cointegrator 1 complex subunit 1", "gene_name": "ASCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3C0-1", "protein_name": "Activating signal cointegrator 1 complex subunit 3", "gene_name": "ASCC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 257, "end_pos": 257, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreases activity by about 65%.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "22055184", "url": "https://pubmed.ncbi.nlm.nih.gov/22055184" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q96Q83-1" }, { "start_pos": 1354, "end_pos": 1354, "sequence_org": "G", "sequence_mut": "D", "comment": "Abolishes 3'-5' DNA helicase activity and ability to promote DNA repair.", "evidence": [ { "database": "UniProtKB", "id": "Q8N3C0", "url": "https://www.uniprot.org/uniprotkb/Q8N3C0" }, { "database": "PubMed", "id": "22055184", "url": "https://pubmed.ncbi.nlm.nih.gov/22055184" } ], "uniprot_canonical_ac": "Q8N3C0-1" } ], "record_id": "pubmed.22055184", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential repair of etheno-DNA adducts by bacterial and human AlkB proteins.", "journal": "DNA repair", "date": "2015", "authors": "Zdzalik D, Domanska A, Prorok P, Kosicki K, van den Born E, Falnes PO, Rizzo CJ, Guengerich FP, Tudek B", "reference": { "type": "PubMed", "id": "25797601", "url": "https://pubmed.ncbi.nlm.nih.gov/25797601" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6NS38-1", "protein_name": "DNA oxidative demethylase ALKBH2", "gene_name": "ALKBH2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25797601", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Noncanonical regulation of alkylation damage resistance by the OTUD4 deubiquitinase.", "journal": "The EMBO journal", "date": "2015", "authors": "Zhao Y, Majid MC, Soll JM, Brickner JR, Dango S, Mosammaparast N", "reference": { "type": "PubMed", "id": "25944111", "url": "https://pubmed.ncbi.nlm.nih.gov/25944111" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93009-1", "protein_name": "Ubiquitin C-terminal hydrolase 7", "gene_name": "USP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q93008-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 9X", "gene_name": "USP9X", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01804-1", "protein_name": "OTU domain-containing protein 4", "gene_name": "OTUD4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 223, "end_pos": 223, "sequence_org": "C", "sequence_mut": "S", "comment": "Catalytically inactive mutant. No effect on p53/TP53 and PTEN binding but is defective in deubiquitinating p53/TP53 and PTEN. Partial loss of KMT2E/mml5 deubiquitination. Decreases deubiquitinase activity toward 'Lys-48'-polyubiquitinated ALKBH3. Reduced deubiquitination of REST. Reduced deubiquitination of TRIM27 and WASHC1.", "evidence": [ { "database": "UniProtKB", "id": "Q93009", "url": "https://www.uniprot.org/uniprotkb/Q93009" }, { "database": "PubMed", "id": "11923872", "url": "https://pubmed.ncbi.nlm.nih.gov/11923872" }, { "database": "PubMed", "id": "22411829", "url": "https://pubmed.ncbi.nlm.nih.gov/22411829" }, { "database": "PubMed", "id": "16964248", "url": "https://pubmed.ncbi.nlm.nih.gov/16964248" }, { "database": "PubMed", "id": "18716620", "url": "https://pubmed.ncbi.nlm.nih.gov/18716620" }, { "database": "PubMed", "id": "21745816", "url": "https://pubmed.ncbi.nlm.nih.gov/21745816" }, { "database": "PubMed", "id": "26365382", "url": "https://pubmed.ncbi.nlm.nih.gov/26365382" }, { "database": "PubMed", "id": "25944111", "url": "https://pubmed.ncbi.nlm.nih.gov/25944111" }, { "database": "PubMed", "id": "21258371", "url": "https://pubmed.ncbi.nlm.nih.gov/21258371" }, { "database": "PubMed", "id": "26678539", "url": "https://pubmed.ncbi.nlm.nih.gov/26678539" }, { "database": "PubMed", "id": "28655758", "url": "https://pubmed.ncbi.nlm.nih.gov/28655758" }, { "database": "PubMed", "id": "12507430", "url": "https://pubmed.ncbi.nlm.nih.gov/12507430" }, { "database": "PubMed", "id": "15053880", "url": "https://pubmed.ncbi.nlm.nih.gov/15053880" } ], "uniprot_canonical_ac": "Q93009-1" }, { "start_pos": 181, "end_pos": 550, "sequence_org": "VSKIVMELDTLEVADEDNSEISDSEDDSCKSKTAAAAADVNGFKPLSGNEQLKNNGNSTSLPLSRKVLKSLNPAVYRNVEYEIWLKSKQAQQKRDYSIAAGLQYEVGDKCQVRLDHNGKFLNADVQGIHSENGPVLVEELGKKHTSKNLKAPPPESWNTVSGKKMKKPSTSGQNFHSDVDYRGPKNPSKPIKAPSALPPRLQHPSGVRQHAFSSHSSGSQSQKFSSEHKNLSRTPSQIIRKPDRERVEDFDHTSRESNYFGLSPEERREKQAIEESRLLYEIQNRDEQAFPALSSSSVNQSASQSSNPCVQRKSSHVGDRKGSRRRMDTEERKDKDSIHGHSQLDKRPEPSTLENITDDKYATVSSPSKS", "sequence_mut": "", "comment": "Abolishes interaction with USP7 and USP9X deubiquitinases.", "evidence": [ { "database": "UniProtKB", "id": "Q01804", "url": "https://www.uniprot.org/uniprotkb/Q01804" }, { "database": "PubMed", "id": "25944111", "url": "https://pubmed.ncbi.nlm.nih.gov/25944111" } ], "uniprot_canonical_ac": "Q01804-1" }, { "start_pos": 45, "end_pos": 45, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes 'Lys-48'- and 'Lys-63'-specific deubiquitinase activity. Impairs 'Lys-63'-specific deubiquitinase activity toward MYD88 substrate.", "evidence": [ { "database": "UniProtKB", "id": "Q01804", "url": "https://www.uniprot.org/uniprotkb/Q01804" }, { "database": "PubMed", "id": "23827681", "url": "https://pubmed.ncbi.nlm.nih.gov/23827681" }, { "database": "PubMed", "id": "29395066", "url": "https://pubmed.ncbi.nlm.nih.gov/29395066" }, { "database": "PubMed", "id": "25944111", "url": "https://pubmed.ncbi.nlm.nih.gov/25944111" } ], "uniprot_canonical_ac": "Q01804-1" } ], "record_id": "pubmed.25944111", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The dynamic N(1)-methyladenosine methylome in eukaryotic messenger RNA.", "journal": "Nature", "date": "2016", "authors": "Dominissini D, Nachtergaele S, Moshitch-Moshkovitz S, Peer E, Kol N, Ben-Haim MS, Dai Q, Di Segni A, Salmon-Divon M, Clark WC, Zheng G, Pan T, Solomon O, Eyal E, Hershkovitz V, Han D, Dore LC, Amariglio N, Rechavi G, He C", "reference": { "type": "PubMed", "id": "26863196", "url": "https://pubmed.ncbi.nlm.nih.gov/26863196" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 193, "end_pos": 193, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" }, { "database": "PubMed", "id": "26863196", "url": "https://pubmed.ncbi.nlm.nih.gov/26863196" }, { "database": "PubMed", "id": "16174769", "url": "https://pubmed.ncbi.nlm.nih.gov/16174769" } ], "uniprot_canonical_ac": "Q96Q83-1" } ], "record_id": "pubmed.26863196", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptome-wide mapping reveals reversible and dynamic N(1)-methyladenosine methylome.", "journal": "Nature chemical biology", "date": "2016", "authors": "Li X, Xiong X, Wang K, Wang L, Shu X, Ma S, Yi C", "reference": { "type": "PubMed", "id": "26863410", "url": "https://pubmed.ncbi.nlm.nih.gov/26863410" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26863410", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A ubiquitin-dependent signalling axis specific for ALKBH-mediated DNA dealkylation repair.", "journal": "Nature", "date": "2017", "authors": "Brickner JR, Soll JM, Lombardi PM, Vagbo CB, Mudge MC, Oyeniran C, Rabe R, Jackson J, Sullender ME, Blazosky E, Byrum AK, Zhao Y, Corbett MA, Gecz J, Field M, Vindigni A, Slupphaug G, Wolberger C, Mosammaparast N", "reference": { "type": "PubMed", "id": "29144457", "url": "https://pubmed.ncbi.nlm.nih.gov/29144457" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H1I8-1", "protein_name": "Activating signal cointegrator 1 complex subunit 2", "gene_name": "ASCC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N9N2-1", "protein_name": "Activating signal cointegrator 1 complex subunit 1", "gene_name": "ASCC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15541-1", "protein_name": "E3 ubiquitin-protein ligase RNF113A", "gene_name": "RNF113A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N3C0-1", "protein_name": "Activating signal cointegrator 1 complex subunit 3", "gene_name": "ASCC3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 478, "end_pos": 479, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Loss of ubiquitin binding.", "evidence": [ { "database": "UniProtKB", "id": "Q9H1I8", "url": "https://www.uniprot.org/uniprotkb/Q9H1I8" }, { "database": "PubMed", "id": "29144457", "url": "https://pubmed.ncbi.nlm.nih.gov/29144457" } ], "uniprot_canonical_ac": "Q9H1I8-1" }, { "start_pos": 506, "end_pos": 506, "sequence_org": "L", "sequence_mut": "A", "comment": "Loss of ubiquitin binding.", "evidence": [ { "database": "UniProtKB", "id": "Q9H1I8", "url": "https://www.uniprot.org/uniprotkb/Q9H1I8" }, { "database": "PubMed", "id": "29144457", "url": "https://pubmed.ncbi.nlm.nih.gov/29144457" } ], "uniprot_canonical_ac": "Q9H1I8-1" }, { "start_pos": 264, "end_pos": 264, "sequence_org": "I", "sequence_mut": "A", "comment": "Strongly reduced E3 ubiquitin ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "O15541", "url": "https://www.uniprot.org/uniprotkb/O15541" }, { "database": "PubMed", "id": "29144457", "url": "https://pubmed.ncbi.nlm.nih.gov/29144457" } ], "uniprot_canonical_ac": "O15541-1" }, { "start_pos": 2, "end_pos": 60, "sequence_org": "AEQLSPGKAVDQVCTFLFKKPGRKGAAGRRKRPACDPEPGESGSSSDEGCTVVRPEKKR", "sequence_mut": "", "comment": "Strongly decreased interaction with SNRNP200/BRR2.", "evidence": [ { "database": "UniProtKB", "id": "O15541", "url": "https://www.uniprot.org/uniprotkb/O15541" }, { "database": "PubMed", "id": "29144457", "url": "https://pubmed.ncbi.nlm.nih.gov/29144457" } ], "uniprot_canonical_ac": "O15541-1" }, { "start_pos": 301, "end_pos": 343, "sequence_org": "QQTNGVFNPAKELIAKLEKHRATGEGGASDLPEDPDEDAIPIT", "sequence_mut": "", "comment": "Cells are hypersensitive to DNA damage by alkylating agents.", "evidence": [ { "database": "UniProtKB", "id": "O15541", "url": "https://www.uniprot.org/uniprotkb/O15541" }, { "database": "PubMed", "id": "29144457", "url": "https://pubmed.ncbi.nlm.nih.gov/29144457" } ], "uniprot_canonical_ac": "O15541-1" } ], "record_id": "pubmed.29144457", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LncRNA ALKBH3-AS1 enhances ALKBH3 mRNA stability to promote hepatocellular carcinoma cell proliferation and invasion.", "journal": "Journal of cellular and molecular medicine", "date": "2022-10", "authors": "Lu Qiliang, Wang Hao, Lei Xiangxiang, Ma Qiancheng, Zhao Jie, Sun Wen, Guo Cheng, Huang Dongsheng, Xu Qiuran", "reference": { "type": "PubMed", "id": "36098205", "url": "https://pubmed.ncbi.nlm.nih.gov/36098205" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36098205", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Histone lactylation-boosted ALKBH3 potentiates tumor progression and diminished promyelocytic leukemia protein nuclear condensates by m1A demethylation of SP100A.", "journal": "Nucleic acids research", "date": "2023-12-20", "authors": "Gu Xiang, Zhuang Ai, Yu Jie, Yang Ludi, Ge Shengfang, Ruan Jing, Jia Renbing, Fan Xianqun, Chai Peiwei", "reference": { "type": "PubMed", "id": "38118002", "url": "https://pubmed.ncbi.nlm.nih.gov/38118002" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23497-1", "protein_name": "Nuclear autoantigen Sp-100", "gene_name": "SP100", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38118002", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Molecular Basis of Human ALKBH3 Mediated RNA N1 -methyladenosine (m1 A) Demethylation.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2024-02-12", "authors": "Zhang Lin, Duan Hong-Chao, Paduch Marcin, Hu Jingyan, Zhang Chi, Mu Yajuan, Lin Houwen, He Chuan, Kossiakoff Anthony A, Jia Guifang, Zhang Liang", "reference": { "type": "PubMed", "id": "38158383", "url": "https://pubmed.ncbi.nlm.nih.gov/38158383" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38158383", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Role of Key Amino Acids of the Human Fe(II)/2OG-Dependent Dioxygenase ALKBH3 in Structural Dynamics and Repair Activity toward Methylated DNA.", "journal": "International journal of molecular sciences", "date": "2024-01-17", "authors": "Kanazhevskaya Lyubov Yu, Gorbunov Alexey A, Lukina Maria V, Smyshliaev Denis A, Zhdanova Polina V, Lomzov Alexander A, Koval Vladimir V", "reference": { "type": "PubMed", "id": "38256217", "url": "https://pubmed.ncbi.nlm.nih.gov/38256217" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38256217", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PUS7-dependent pseudouridylation of ALKBH3 mRNA inhibits gastric cancer progression.", "journal": "Clinical and translational medicine", "date": "2024-08", "authors": "Chang Yongxia, Jin Hao, Cui Yun, Yang Feng, Chen Kanghua, Kuang Wenjun, Huo Chunxiao, Xu Zhangqi, Li Ya, Lin Aifu, Yang Bo, Liu Wei, Xie Shanshan, Zhou Tianhua", "reference": { "type": "PubMed", "id": "39175405", "url": "https://pubmed.ncbi.nlm.nih.gov/39175405" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96Q83-1", "protein_name": "Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3", "gene_name": "ALKBH3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PZ0-1", "protein_name": "Pseudouridylate synthase 7 homolog", "gene_name": "PUS7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96Q83", "url": "https://www.uniprot.org/uniprotkb/Q96Q83" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39175405", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression and function of epithelial anoctamins.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Schreiber R, Uliyakina I, Kongsuphol P, Warth R, Mirza M, Martins JR, Kunzelmann K", "reference": { "type": "PubMed", "id": "20056604", "url": "https://pubmed.ncbi.nlm.nih.gov/20056604" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75UR0-1", "protein_name": "Anoctamin-5", "gene_name": "Ano5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BHY3-1", "protein_name": "Anoctamin-1", "gene_name": "Ano1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q14AT5-1", "protein_name": "Anoctamin-7", "gene_name": "Ano7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8C5H1-1", "protein_name": "Anoctamin-4", "gene_name": "Ano4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6PB70-1", "protein_name": "Anoctamin-8", "gene_name": "Ano8", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A2AHL1-1", "protein_name": "Anoctamin-3", "gene_name": "Ano3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P86044-1", "protein_name": "Anoctamin-9", "gene_name": "Ano9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BH79-1", "protein_name": "Anoctamin-10", "gene_name": "Ano10", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8CFW1-1", "protein_name": "Anoctamin-2", "gene_name": "Ano2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20056604", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 18 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Targeted next-generation sequencing of a 12.5 Mb homozygous region reveals ANO10 mutations in patients with autosomal-recessive cerebellar ataxia.", "journal": "American journal of human genetics", "date": "2010", "authors": "Vermeer S, Hoischen A, Meijer RP, Gilissen C, Neveling K, Wieskamp N, de Brouwer A, Koenig M, Anheim M, Assoum M, Drouot N, Todorovic S, Milic-Rasic V, Lochmuller H, Stevanin G, Goizet C, David A, Durr A, Brice A, Kremer B, van de Warrenburg BP, Schijvenaars MM, Heister A, Kwint M, Arts P, van der Wijst J, Veltman J, Kamsteeg EJ, Scheffer H, Knoers N", "reference": { "type": "PubMed", "id": "21092923", "url": "https://pubmed.ncbi.nlm.nih.gov/21092923" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21092923", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Anoctamins.", "journal": "Pflugers Arch.", "date": "2011", "authors": "Kunzelmann Karl, Tian Yuemin, Martins Joana Raquel, Faria Diana, Kongsuphol Patthara, Ousingsawat Jiraporn, Thevenod Frank, Roussa Eleni, Rock Jason, Schreiber Rainer", "reference": { "type": "PubMed", "id": "21607626", "url": "https://pubmed.ncbi.nlm.nih.gov/21607626" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21607626", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Physiological roles and diseases of Tmem16/Anoctamin proteins: are they all chloride channels?", "journal": "Acta Pharmacol. Sin.", "date": "2011", "authors": "Duran Charity, Hartzell H Criss", "reference": { "type": "PubMed", "id": "21642943", "url": "https://pubmed.ncbi.nlm.nih.gov/21642943" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21642943", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ANOs 3-7 in the anoctamin/Tmem16 Cl- channel family are intracellular proteins.", "journal": "Am. J. Physiol.", "date": "2012", "authors": "Duran Charity, Qu Zhiqiang, Osunkoya Adeboye O, Cui Yuanyuan, Hartzell H Criss", "reference": { "type": "PubMed", "id": "22075693", "url": "https://pubmed.ncbi.nlm.nih.gov/22075693" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BHY3-1", "protein_name": "Anoctamin-1", "gene_name": "Ano1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8C5H1-1", "protein_name": "Anoctamin-4", "gene_name": "Ano4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8CFW1-1", "protein_name": "Anoctamin-2", "gene_name": "Ano2", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22075693", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The anoctamin (TMEM16) gene family: calcium-activated chloride channels come of age.", "journal": "Exp. Physiol.", "date": "2012", "authors": "Winpenny John P, Gray Michael A", "reference": { "type": "PubMed", "id": "22302790", "url": "https://pubmed.ncbi.nlm.nih.gov/22302790" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75UR0-1", "protein_name": "Anoctamin-5", "gene_name": "Ano5", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6P9J9-1", "protein_name": "Anoctamin-6", "gene_name": "Ano6", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q14AT5-1", "protein_name": "Anoctamin-7", "gene_name": "Ano7", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8C5H1-1", "protein_name": "Anoctamin-4", "gene_name": "Ano4", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q6PB70-1", "protein_name": "Anoctamin-8", "gene_name": "Ano8", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "A2AHL1-1", "protein_name": "Anoctamin-3", "gene_name": "Ano3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P86044-1", "protein_name": "Anoctamin-9", "gene_name": "Ano9", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q8BH79-1", "protein_name": "Anoctamin-10", "gene_name": "Ano10", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22302790", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cognitive characterization of SCAR10 caused by a homozygous c.132dupA mutation in the ANO10 gene.", "journal": "Neurocase", "date": "2019", "authors": "Nieto A, Perez-Flores J, Corral-Juan M, Matilla-Duenas A, Martinez-Burgallo F, Monton F", "reference": { "type": "PubMed", "id": "31423897", "url": "https://pubmed.ncbi.nlm.nih.gov/31423897" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31423897", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.", "journal": "Nature communications", "date": "2019", "authors": "Bushell SR, Pike ACW, Falzone ME, Rorsman NJG, Ta CM, Corey RA, Newport TD, Christianson JC, Scofano LF, Shintre CA, Tessitore A, Chu A, Wang Q, Shrestha L, Mukhopadhyay SMM, Love JD, Burgess-Brown NA, Sitsapesan R, Stansfeld PJ, Huiskonen JT, Tammaro P, Accardi A, Carpenter EP", "reference": { "type": "PubMed", "id": "31477691", "url": "https://pubmed.ncbi.nlm.nih.gov/31477691" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31477691", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TMEM16K is an interorganelle regulator of endosomal sorting.", "journal": "Nature communications", "date": "2020", "authors": "Petkovic M, Oses-Prieto J, Burlingame A, Jan LY, Jan YN", "reference": { "type": "PubMed", "id": "32620747", "url": "https://pubmed.ncbi.nlm.nih.gov/32620747" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BH79-1", "protein_name": "Anoctamin-10", "gene_name": "Ano10", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32620747", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanistic insights of host cell fusion of SARS-CoV-1 and SARS-CoV-2 from atomic resolution structure and membrane dynamics.", "journal": "Biophysical chemistry", "date": "2020", "authors": "Chakraborty H, Bhattacharjya S", "reference": { "type": "PubMed", "id": "32721790", "url": "https://pubmed.ncbi.nlm.nih.gov/32721790" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32721790", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Receptor binding and priming of the spike protein of SARS-CoV-2 for membrane fusion.", "journal": "Nature", "date": "2020", "authors": "Benton DJ, Wrobel AG, Xu P, Roustan C, Martin SR, Rosenthal PB, Skehel JJ, Gamblin SJ", "reference": { "type": "PubMed", "id": "32942285", "url": "https://pubmed.ncbi.nlm.nih.gov/32942285" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32942285", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Syncytia formation by SARS-CoV-2-infected cells.", "journal": "The EMBO journal", "date": "2020", "authors": "Buchrieser J, Dufloo J, Hubert M, Monel B, Planas D, Rajah MM, Planchais C, Porrot F, Guivel-Benhassine F, Van der Werf S, Casartelli N, Mouquet H, Bruel T, Schwartz O", "reference": { "type": "PubMed", "id": "33051876", "url": "https://pubmed.ncbi.nlm.nih.gov/33051876" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P13164-1", "protein_name": "Interferon-induced transmembrane protein 1", "gene_name": "IFITM1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33051876", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Flagging fusion: Phosphatidylserine signaling in cell-cell fusion.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Whitlock JM, Chernomordik LV", "reference": { "type": "PubMed", "id": "33581114", "url": "https://pubmed.ncbi.nlm.nih.gov/33581114" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33581114", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Drugs that inhibit TMEM16 proteins block SARS-CoV-2 spike-induced syncytia.", "journal": "Nature", "date": "2021", "authors": "Braga L, Ali H, Secco I, Chiavacci E, Neves G, Goldhill D, Penn R, Jimenez-Guardeno JM, Ortega-Prieto AM, Bussani R, Cannata A, Rizzari G, Collesi C, Schneider E, Arosio D, Shah AM, Barclay WS, Malim MH, Burrone J, Giacca M", "reference": { "type": "PubMed", "id": "33827113", "url": "https://pubmed.ncbi.nlm.nih.gov/33827113" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33827113", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SARS-CoV-2 requires cholesterol for viral entry and pathological syncytia formation.", "journal": "eLife", "date": "2021", "authors": "Sanders DW, Jumper CC, Ackerman PJ, Bracha D, Donlic A, Kim H, Kenney D, Castello-Serrano I, Suzuki S, Tamura T, Tavares AH, Saeed M, Holehouse AS, Ploss A, Levental I, Douam F, Padera RF, Levy BD, Brangwynne CP", "reference": { "type": "PubMed", "id": "33890572", "url": "https://pubmed.ncbi.nlm.nih.gov/33890572" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33890572", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure-function relations of the SARS-CoV-2 spike protein and impact of mutations in the variants of concern.", "journal": "Comptes rendus biologies", "date": "2021", "authors": "Rey F", "reference": { "type": "PubMed", "id": "34213849", "url": "https://pubmed.ncbi.nlm.nih.gov/34213849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34213849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequences in the cytoplasmic tail of SARS-CoV-2 Spike facilitate expression at the cell surface and syncytia formation.", "journal": "Nature communications", "date": "2021", "authors": "Cattin-Ortola J, Welch LG, Maslen SL, Papa G, James LC, Munro S", "reference": { "type": "PubMed", "id": "34504087", "url": "https://pubmed.ncbi.nlm.nih.gov/34504087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DTC2-1", "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_name": "2019-nCoV" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1269, "end_pos": 1269, "sequence_org": "K", "sequence_mut": "A", "comment": "Complete loss of COPI binding and increase in cell fusion.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "34504087", "url": "https://pubmed.ncbi.nlm.nih.gov/34504087" } ], "uniprot_canonical_ac": "P0DTC2-1" }, { "start_pos": 1271, "end_pos": 1271, "sequence_org": "H", "sequence_mut": "K", "comment": "Improved COPI binding, reduced cell fusion and reduced levels of S1/S2 cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P0DTC2", "url": "https://www.uniprot.org/uniprotkb/P0DTC2" }, { "database": "PubMed", "id": "34504087", "url": "https://pubmed.ncbi.nlm.nih.gov/34504087" } ], "uniprot_canonical_ac": "P0DTC2-1" } ], "record_id": "pubmed.34504087", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Highly Efficient SARS-CoV-2 Infection of Human Cardiomyocytes: Spike Protein-Mediated Cell Fusion and Its Inhibition.", "journal": "Journal of virology", "date": "2021", "authors": "Navaratnarajah CK, Pease DR, Halfmann PJ, Taye B, Barkhymer A, Howell KG, Charlesworth JE, Christensen TA, Kawaoka Y, Cattaneo R, Schneider JW", "reference": { "type": "PubMed", "id": "34613786", "url": "https://pubmed.ncbi.nlm.nih.gov/34613786" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KMQ2-1", "protein_name": "Anoctamin-6", "gene_name": "ANO6", "tax_name": "Human" }, { "uniprot_canonical_ac": "A1A5B4-1", "protein_name": "Anoctamin-9", "gene_name": "ANO9", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q32M45-1", "protein_name": "Anoctamin-4", "gene_name": "ANO4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6IWH7-1", "protein_name": "Anoctamin-7", "gene_name": "ANO7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75V66-1", "protein_name": "Anoctamin-5", "gene_name": "ANO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYT9-1", "protein_name": "Anoctamin-3", "gene_name": "ANO3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HCE9-1", "protein_name": "Anoctamin-8", "gene_name": "ANO8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09958-1", "protein_name": "Furin", "gene_name": "FURIN", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5XXA6-1", "protein_name": "Anoctamin-1", "gene_name": "ANO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NQ90-4", "protein_name": "Anoctamin-2", "gene_name": "ANO2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34613786", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Rare forms of autosomal recessive spinocerebellar ataxia associated with mutations in the ANO10 (ATX-ANO10) and SYNE1 (ATX-SYNE1) genes].", "journal": "Zhurnal nevrologii i psikhiatrii imeni S.S. Korsakova", "date": "2024", "authors": "Nuzhnyi E P, Protopopova A O, Abramycheva N Yu, Protsenko A R, Illarioshkin S N", "reference": { "type": "PubMed", "id": "39269294", "url": "https://pubmed.ncbi.nlm.nih.gov/39269294" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NW15-1", "protein_name": "Anoctamin-10", "gene_name": "ANO10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NF91-1", "protein_name": "Nesprin-1", "gene_name": "SYNE1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NW15", "url": "https://www.uniprot.org/uniprotkb/Q9NW15" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39269294", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a novel 130-kDa cytoplasmic protein, Ankhzn, containing Ankyrin repeats hooked to a zinc finger motif.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Ito K, Ishii N, Miyashita A, Tominaga K, Kuriyama H, Maruyama H, Shirai M, Naito M, Arakawa M, Kuwano R", "reference": { "type": "PubMed", "id": "10092534", "url": "https://pubmed.ncbi.nlm.nih.gov/10092534" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P2R3-1", "protein_name": "Ankyrin repeat and FYVE domain-containing protein 1", "gene_name": "ANKFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q810B6-1", "protein_name": "Ankyrin repeat and FYVE domain-containing protein 1", "gene_name": "Ankfy1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P2R3", "url": "https://www.uniprot.org/uniprotkb/Q9P2R3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10092534", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization and chromosomal mapping of a novel human gene, ANKHZN.", "journal": "Gene", "date": "2000", "authors": "Kuriyama H, Asakawa S, Minoshima S, Maruyama H, Ishii N, Ito K, Gejyo F, Arakawa M, Shimizu N, Kuwano R", "reference": { "type": "PubMed", "id": "10940552", "url": "https://pubmed.ncbi.nlm.nih.gov/10940552" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P2R3-1", "protein_name": "Ankyrin repeat and FYVE domain-containing protein 1", "gene_name": "ANKFY1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P2R3", "url": "https://www.uniprot.org/uniprotkb/Q9P2R3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10940552", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Rab5 effector Rabankyrin-5 regulates and coordinates different endocytic mechanisms.", "journal": "PLoS biology", "date": "2004", "authors": "Schnatwinkel C, Christoforidis S, Lindsay MR, Uttenweiler-Joseph S, Wilm M, Parton RG, Zerial M", "reference": { "type": "PubMed", "id": "15328530", "url": "https://pubmed.ncbi.nlm.nih.gov/15328530" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P2R3-1", "protein_name": "Ankyrin repeat and FYVE domain-containing protein 1", "gene_name": "ANKFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q810B6-1", "protein_name": "Ankyrin repeat and FYVE domain-containing protein 1", "gene_name": "Ankfy1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P2R3", "url": "https://www.uniprot.org/uniprotkb/Q9P2R3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15328530", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rabankyrin-5 interacts with EHD1 and Vps26 to regulate endocytic trafficking and retromer function.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Zhang J, Reiling C, Reinecke JB, Prislan I, Marky LA, Sorgen PL, Naslavsky N, Caplan S", "reference": { "type": "PubMed", "id": "22284051", "url": "https://pubmed.ncbi.nlm.nih.gov/22284051" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P2R3-1", "protein_name": "Ankyrin repeat and FYVE domain-containing protein 1", "gene_name": "ANKFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H4M9-1", "protein_name": "EH domain-containing protein 1", "gene_name": "EHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P2R3", "url": "https://www.uniprot.org/uniprotkb/Q9P2R3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 421, "end_pos": 423, "sequence_org": "NPF", "sequence_mut": "APA", "comment": "Disrupts interaction with EHD1.", "evidence": [ { "database": "UniProtKB", "id": "Q9P2R3", "url": "https://www.uniprot.org/uniprotkb/Q9P2R3" }, { "database": "PubMed", "id": "22284051", "url": "https://pubmed.ncbi.nlm.nih.gov/22284051" } ], "uniprot_canonical_ac": "Q9P2R3-1" }, { "start_pos": 424, "end_pos": 425, "sequence_org": "ED", "sequence_mut": "AA", "comment": "Decreases interaction with EHD1.", "evidence": [ { "database": "UniProtKB", "id": "Q9P2R3", "url": "https://www.uniprot.org/uniprotkb/Q9P2R3" }, { "database": "PubMed", "id": "22284051", "url": "https://pubmed.ncbi.nlm.nih.gov/22284051" } ], "uniprot_canonical_ac": "Q9P2R3-1" } ], "record_id": "pubmed.22284051", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GAPVD1 and ANKFY1 Mutations Implicate RAB5 Regulation in Nephrotic Syndrome.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2018-08", "authors": "Hermle Tobias, Schneider Ronen, Schapiro David, Braun Daniela A, van der Ven Amelie T, Warejko Jillian K, Daga Ankana, Widmeier Eugen, Nakayama Makiko, Jobst-Schwan Tilman, Majmundar Amar J, Ashraf Shazia, Rao Jia, Finn Laura S, Tasic Velibor, Hernandez Joel D, Bagga Arvind, Jalalah Sawsan M, El Desoky Sherif, Kari Jameela A, Laricchia Kristen M, Lek Monkol, Rehm Heidi L, MacArthur Daniel G, Mane Shrikant, Lifton Richard P, Shril Shirlee, Hildebrandt Friedhelm", "reference": { "type": "PubMed", "id": "29959197", "url": "https://pubmed.ncbi.nlm.nih.gov/29959197" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P2R3-1", "protein_name": "Ankyrin repeat and FYVE domain-containing protein 1", "gene_name": "ANKFY1", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A8I5ZT12-1", "protein_name": "GTPase-activating protein and VPS9 domain-containing protein 1", "gene_name": "Gapvd1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9R044-1", "protein_name": "Adhesion molecule nephrin", "gene_name": "Nphs1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9VZ08-1", "protein_name": "GTPase-activating protein and VPS9 domain-containing protein 1", "gene_name": "Gapvd1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P2R3", "url": "https://www.uniprot.org/uniprotkb/Q9P2R3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29959197", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ANKFY1 is essential for retinal endothelial cell proliferation and migration via VEGFR2/Akt/eNOS pathway.", "journal": "Biochemical and biophysical research communications", "date": "2020", "authors": "Tanaka M, Nakamura S, Maekawa M, Higashiyama S, Hara H", "reference": { "type": "PubMed", "id": "33092793", "url": "https://pubmed.ncbi.nlm.nih.gov/33092793" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P2R3-1", "protein_name": "Ankyrin repeat and FYVE domain-containing protein 1", "gene_name": "ANKFY1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P2R3", "url": "https://www.uniprot.org/uniprotkb/Q9P2R3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33092793", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role for the mortality factors MORF4, MRGX, and MRG15 in transcriptional repression via associations with Pf1, mSin3A, and transducin-like enhancer of Split.", "journal": "Mol. Cell. Biol.", "date": "2002", "authors": "Yochum GS, Ayer DE", "reference": { "type": "PubMed", "id": "12391155", "url": "https://pubmed.ncbi.nlm.nih.gov/12391155" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15014-1", "protein_name": "Mortality factor 4-like protein 2", "gene_name": "MORF4L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBU8-1", "protein_name": "Mortality factor 4-like protein 1", "gene_name": "MORF4L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15014", "url": "https://www.uniprot.org/uniprotkb/Q15014" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12391155", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of new subunits of the multiprotein mammalian TRRAP/TIP60-containing histone acetyltransferase complex.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Cai Y, Jin J, Tomomori-Sato C, Sato S, Sorokina I, Parmely TJ, Conaway RC, Conaway JW", "reference": { "type": "PubMed", "id": "12963728", "url": "https://pubmed.ncbi.nlm.nih.gov/12963728" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15014-1", "protein_name": "Mortality factor 4-like protein 2", "gene_name": "MORF4L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92993-1", "protein_name": "Histone acetyltransferase KAT5", "gene_name": "KAT5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBU8-1", "protein_name": "Mortality factor 4-like protein 1", "gene_name": "MORF4L1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NXR8-1", "protein_name": "Inhibitor of growth protein 3", "gene_name": "ING3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NV56-1", "protein_name": "MRG/MORF4L-binding protein", "gene_name": "MRGBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NPF5-1", "protein_name": "DNA methyltransferase 1-associated protein 1", "gene_name": "DMAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y265-1", "protein_name": "RuvB-like 1", "gene_name": "RUVBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O95619-1", "protein_name": "YEATS domain-containing protein 4", "gene_name": "YEATS4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAF1-1", "protein_name": "Chromatin modification-related protein MEAF6", "gene_name": "MEAF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H0E9-1", "protein_name": "Bromodomain-containing protein 8", "gene_name": "BRD8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y230-1", "protein_name": "RuvB-like 2", "gene_name": "RUVBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96L91-1", "protein_name": "E1A-binding protein p400", "gene_name": "EP400", "tax_name": "Human" }, { "uniprot_canonical_ac": "O96019-1", "protein_name": "Actin-like protein 6A", "gene_name": "ACTL6A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15014", "url": "https://www.uniprot.org/uniprotkb/Q15014" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12963728", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MRGX is a novel transcriptional regulator that exhibits activation or repression of the B-myb promoter in a cell type-dependent manner.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tominaga K, Leung JK, Rookard P, Echigo J, Smith JR, Pereira-Smith OM", "reference": { "type": "PubMed", "id": "14506250", "url": "https://pubmed.ncbi.nlm.nih.gov/14506250" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15014-1", "protein_name": "Mortality factor 4-like protein 2", "gene_name": "MORF4L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y605-1", "protein_name": "MORF4 family-associated protein 1", "gene_name": "MRFAP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15014", "url": "https://www.uniprot.org/uniprotkb/Q15014" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 132, "end_pos": 136, "sequence_org": "WLVED", "sequence_mut": "", "comment": "Abrogates both transcriptional activation and repression by MORF4L2.", "evidence": [ { "database": "UniProtKB", "id": "Q15014", "url": "https://www.uniprot.org/uniprotkb/Q15014" }, { "database": "PubMed", "id": "14506250", "url": "https://pubmed.ncbi.nlm.nih.gov/14506250" } ], "uniprot_canonical_ac": "Q15014-1" }, { "start_pos": 263, "end_pos": 263, "sequence_org": "L", "sequence_mut": "A", "comment": "Abrogates both transcriptional activation and repression by MORF4L2.", "evidence": [ { "database": "UniProtKB", "id": "Q15014", "url": "https://www.uniprot.org/uniprotkb/Q15014" }, { "database": "PubMed", "id": "14506250", "url": "https://pubmed.ncbi.nlm.nih.gov/14506250" } ], "uniprot_canonical_ac": "Q15014-1" } ], "record_id": "pubmed.14506250", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miR-3156-5p is downregulated in serum of MEN1 patients and regulates expression of MORF4L2.", "journal": "Endocrine-related cancer", "date": "2022", "authors": "Kooblall KG, Stokes VJ, Shariq OA, English KA, Stevenson M, Broxholme J, Wright B, Lockstone HE, Buck D, Grozinsky-Glasberg S, Yates CJ, Thakker RV, Lines KE", "reference": { "type": "PubMed", "id": "35900839", "url": "https://pubmed.ncbi.nlm.nih.gov/35900839" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15014-1", "protein_name": "Mortality factor 4-like protein 2", "gene_name": "MORF4L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15014", "url": "https://www.uniprot.org/uniprotkb/Q15014" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35900839", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a gene that reverses the immortal phenotype of a subset of cells and is a member of a novel family of transcription factor-like genes.", "journal": "Mol. Cell. Biol.", "date": "1999", "authors": "Bertram M J, B\u00e9rub\u00e9 N G, Hang-Swanson X, Ran Q, Leung J K, Bryce S, Spurgers K, Bick R J, Baldini A, Ning Y, Clark L J, Parkinson E K, Barrett J C, Smith J R, Pereira-Smith O M", "reference": { "type": "PubMed", "id": "9891081", "url": "https://pubmed.ncbi.nlm.nih.gov/9891081" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q15014-1", "protein_name": "Mortality factor 4-like protein 2", "gene_name": "MORF4L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBU8-1", "protein_name": "Mortality factor 4-like protein 1", "gene_name": "MORF4L1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q15014", "url": "https://www.uniprot.org/uniprotkb/Q15014" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9891081", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The E2F6 transcription factor is a component of the mammalian Bmi1-containing polycomb complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Trimarchi JM, Fairchild B, Wen J, Lees JA", "reference": { "type": "PubMed", "id": "11171983", "url": "https://pubmed.ncbi.nlm.nih.gov/11171983" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11171983", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of h-l(3)mbt-like: a new member of the human mbt family.", "journal": "FEBS Lett.", "date": "2001", "authors": "Wismar J", "reference": { "type": "PubMed", "id": "11682070", "url": "https://pubmed.ncbi.nlm.nih.gov/11682070" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11682070", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in G0 cells.", "journal": "Science", "date": "2002", "authors": "Ogawa H, Ishiguro K, Gaubatz S, Livingston DM, Nakatani Y", "reference": { "type": "PubMed", "id": "12004135", "url": "https://pubmed.ncbi.nlm.nih.gov/12004135" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12004135", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E2F6 negatively regulates BRCA1 in human cancer cells without methylation of histone H3 on lysine 9.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Oberley MJ, Inman DR, Farnham PJ", "reference": { "type": "PubMed", "id": "12909625", "url": "https://pubmed.ncbi.nlm.nih.gov/12909625" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12909625", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Combinatorial gene control involving E2F and E Box family members.", "journal": "The EMBO journal", "date": "2004", "authors": "Giangrande PH, Zhu W, Rempel RE, Laakso N, Nevins JR", "reference": { "type": "PubMed", "id": "15014447", "url": "https://pubmed.ncbi.nlm.nih.gov/15014447" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15014447", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 65 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel repressive E2F6 complex containing the polycomb group protein, EPC1, that interacts with EZH2 in a proliferation-specific manner.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Attwooll C, Oddi S, Cartwright P, Prosperini E, Agger K, Steensgaard P, Wagener C, Sardet C, Moroni MC, Helin K", "reference": { "type": "PubMed", "id": "15536069", "url": "https://pubmed.ncbi.nlm.nih.gov/15536069" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15536069", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PHC3, a component of the hPRC-H complex, associates with E2F6 during G0 and is lost in osteosarcoma tumors.", "journal": "Oncogene", "date": "2007", "authors": "Deshpande AM, Akunowicz JD, Reveles XT, Patel BB, Saria EA, Gorlick RG, Naylor SL, Leach RJ, Hansen MF", "reference": { "type": "PubMed", "id": "17001316", "url": "https://pubmed.ncbi.nlm.nih.gov/17001316" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17001316", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E2F-6 suppresses growth-associated apoptosis of human hematopoietic progenitor cells by counteracting proapoptotic activity of E2F-1.", "journal": "Stem cells (Dayton, Ohio)", "date": "2007", "authors": "Kikuchi J, Shimizu R, Wada T, Ando H, Nakamura M, Ozawa K, Furukawa Y", "reference": { "type": "PubMed", "id": "17600109", "url": "https://pubmed.ncbi.nlm.nih.gov/17600109" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17600109", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E2F6 inhibits cobalt chloride-mimetic hypoxia-induced apoptosis through E2F1.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Yang WW, Shu B, Zhu Y, Yang HT", "reference": { "type": "PubMed", "id": "18562691", "url": "https://pubmed.ncbi.nlm.nih.gov/18562691" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18562691", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Methylation-state-specific recognition of histones by the MBT repeat protein L3MBTL2.", "journal": "Nucleic acids research", "date": "2009", "authors": "Guo Y, Nady N, Qi C, Allali-Hassani A, Zhu H, Pan P, Adams-Cioaba MA, Amaya MF, Dong A, Vedadi M, Schapira M, Read RJ, Arrowsmith CH, Min J", "reference": { "type": "PubMed", "id": "19233876", "url": "https://pubmed.ncbi.nlm.nih.gov/19233876" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19233876", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Solution structure of the FCS zinc finger domain of the human polycomb group protein L(3)mbt-like 2.", "journal": "Protein Sci.", "date": "2009", "authors": "Lechtenberg Bernhard C, Allen Mark D, Rutherford Trevor J, Freund Stefan M V, Bycroft Mark", "reference": { "type": "PubMed", "id": "19241375", "url": "https://pubmed.ncbi.nlm.nih.gov/19241375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19241375", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "L3MBTL2 protein acts in concert with PcG protein-mediated monoubiquitination of H2A to establish a repressive chromatin structure.", "journal": "Molecular cell", "date": "2011", "authors": "Trojer P, Cao AR, Gao Z, Li Y, Zhang J, Xu X, Li G, Losson R, Erdjument-Bromage H, Tempst P, Farnham PJ, Reinberg D", "reference": { "type": "PubMed", "id": "21596310", "url": "https://pubmed.ncbi.nlm.nih.gov/21596310" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21596310", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chk1 inhibits E2F6 repressor function in response to replication stress to maintain cell-cycle transcription.", "journal": "Current biology : CB", "date": "2013", "authors": "Bertoli C, Klier S, McGowan C, Wittenberg C, de Bruin RA", "reference": { "type": "PubMed", "id": "23954429", "url": "https://pubmed.ncbi.nlm.nih.gov/23954429" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23954429", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dynamic regulation of Rad51 by E2F1 and p53 in prostate cancer cells upon drug-induced DNA damage under hypoxia.", "journal": "Molecular pharmacology", "date": "2014", "authors": "Wu M, Wang X, McGregor N, Pienta KJ, Zhang J", "reference": { "type": "PubMed", "id": "24627085", "url": "https://pubmed.ncbi.nlm.nih.gov/24627085" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24627085", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "L3MBTL2 orchestrates ubiquitin signalling by dictating the sequential recruitment of RNF8 and RNF168 after DNA damage.", "journal": "Nature cell biology", "date": "2018", "authors": "Nowsheen S, Aziz K, Aziz A, Deng M, Qin B, Luo K, Jeganathan KB, Zhang H, Liu T, Yu J, Deng Y, Yuan J, Ding W, van Deursen JM, Lou Z", "reference": { "type": "PubMed", "id": "29581593", "url": "https://pubmed.ncbi.nlm.nih.gov/29581593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 158, "end_pos": 158, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q969R5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q969R5" }, { "database": "PubMed", "id": "29581593", "url": "https://pubmed.ncbi.nlm.nih.gov/29581593" } ], "site_lbl": "Ser158", "uniprot_canonical_ac": "Q969R5-1" }, { "start_pos": 335, "end_pos": 335, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q969R5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q969R5" }, { "database": "PubMed", "id": "29581593", "url": "https://pubmed.ncbi.nlm.nih.gov/29581593" } ], "site_lbl": "Ser335", "uniprot_canonical_ac": "Q969R5-1" } ], "record_id": "pubmed.29581593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Augmenting L3MBTL2-induced condensates suppresses tumor growth in osteosarcoma.", "journal": "Science advances", "date": "2023-11-24", "authors": "Zhong Li, Wang Jingxuan, Chen Wanqi, Lv Dongming, Zhang Ruhua, Wang Xin, Zeng Cuiling, He Xiaobo, Zheng Lisi, Gao Ying, Wang Shang, Li Miao, Wu Yuanzhong, Yin Junqiang, Kang Tiebang, Liao Dan", "reference": { "type": "PubMed", "id": "37992172", "url": "https://pubmed.ncbi.nlm.nih.gov/37992172" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37992172", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cellular targets for activation by the E2F1 transcription factor include DNA synthesis- and G1/S-regulatory genes.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "DeGregori J, Kowalik T, Nevins JR", "reference": { "type": "PubMed", "id": "7623816", "url": "https://pubmed.ncbi.nlm.nih.gov/7623816" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06400-1", "protein_name": "Retinoblastoma-associated protein", "gene_name": "RB1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11388-1", "protein_name": "DNA topoisomerase 2-alpha", "gene_name": "TOP2A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13547-1", "protein_name": "Histone deacetylase 1", "gene_name": "HDAC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13415-1", "protein_name": "Origin recognition complex subunit 1", "gene_name": "ORC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q52LA3-1", "protein_name": "Protein lin-52 homolog", "gene_name": "LIN52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6MZP7-1", "protein_name": "Protein lin-54 homolog", "gene_name": "LIN54", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H211-1", "protein_name": "DNA replication factor Cdt1", "gene_name": "CDT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30281-1", "protein_name": "G1/S-specific cyclin-D3", "gene_name": "CCND3", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06493-1", "protein_name": "Cyclin-dependent kinase 1", "gene_name": "CDK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78396-1", "protein_name": "Cyclin-A1", "gene_name": "CCNA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96GY3-1", "protein_name": "Protein lin-37 homolog", "gene_name": "LIN37", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08999-1", "protein_name": "Retinoblastoma-like protein 2", "gene_name": "RBL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75419-1", "protein_name": "Cell division control protein 45 homolog", "gene_name": "CDC45", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04183-1", "protein_name": "Thymidine kinase, cytosolic", "gene_name": "TK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24385-1", "protein_name": "G1/S-specific cyclin-D1", "gene_name": "CCND1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46527-1", "protein_name": "Cyclin-dependent kinase inhibitor 1B", "gene_name": "CDKN1B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24864-1", "protein_name": "G1/S-specific cyclin-E1", "gene_name": "CCNE1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P01106-2", "protein_name": "Myc proto-oncogene protein", "gene_name": "MYC", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TKA1-1", "protein_name": "Protein lin-9 homolog", "gene_name": "LIN9", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15329-1", "protein_name": "Transcription factor E2F5", "gene_name": "E2F5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16254-1", "protein_name": "Transcription factor E2F4", "gene_name": "E2F4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00374-1", "protein_name": "Dihydrofolate reductase", "gene_name": "DHFR", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P28749-1", "protein_name": "Retinoblastoma-like protein 1", "gene_name": "RBL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P11802-1", "protein_name": "Cyclin-dependent kinase 4", "gene_name": "CDK4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30279-1", "protein_name": "G1/S-specific cyclin-D2", "gene_name": "CCND2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38936-1", "protein_name": "Cyclin-dependent kinase inhibitor 1", "gene_name": "CDKN1A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49918-1", "protein_name": "Cyclin-dependent kinase inhibitor 1C", "gene_name": "CDKN1C", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UKT4-1", "protein_name": "F-box only protein 5", "gene_name": "FBXO5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q00534-1", "protein_name": "Cyclin-dependent kinase 6", "gene_name": "CDK6", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99741-1", "protein_name": "DNA replication factor CDC6", "gene_name": "CDC6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P09884-1", "protein_name": "DNA polymerase alpha catalytic subunit", "gene_name": "POLA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04818-1", "protein_name": "Thymidylate synthase", "gene_name": "TYMS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P30304-1", "protein_name": "M-phase inducer phosphatase 1", "gene_name": "CDC25A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7623816", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 68 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E2F-6, a member of the E2F family that can behave as a transcriptional repressor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Trimarchi JM, Fairchild B, Verona R, Moberg K, Andon N, Lees JA", "reference": { "type": "PubMed", "id": "9501179", "url": "https://pubmed.ncbi.nlm.nih.gov/9501179" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9501179", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unusual proliferation arrest and transcriptional control properties of a newly discovered E2F family member, E2F-6.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Gaubatz S, Wood JG, Livingston DM", "reference": { "type": "PubMed", "id": "9689056", "url": "https://pubmed.ncbi.nlm.nih.gov/9689056" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 68, "end_pos": 68, "sequence_org": "L", "sequence_mut": "E", "comment": "Reduction in repressor activity, little effect on S-phase entry.", "evidence": [ { "database": "UniProtKB", "id": "O75461", "url": "https://www.uniprot.org/uniprotkb/O75461" }, { "database": "PubMed", "id": "9689056", "url": "https://pubmed.ncbi.nlm.nih.gov/9689056" } ], "uniprot_canonical_ac": "O75461-1" } ], "record_id": "pubmed.9689056", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E2F-6: a novel member of the E2F family is an inhibitor of E2F-dependent transcription.", "journal": "Oncogene", "date": "1998", "authors": "Cartwright P, Muller H, Wagener C, Holm K, Helin K", "reference": { "type": "PubMed", "id": "9704927", "url": "https://pubmed.ncbi.nlm.nih.gov/9704927" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q969R5-1", "protein_name": "Lethal(3)malignant brain tumor-like protein 2", "gene_name": "L3MBTL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01094-1", "protein_name": "Transcription factor E2F1", "gene_name": "E2F1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06609-1", "protein_name": "DNA repair protein RAD51 homolog 1", "gene_name": "RAD51", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IY57-1", "protein_name": "YY1-associated factor 2", "gene_name": "YAF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31350-1", "protein_name": "Ribonucleoside-diphosphate reductase subunit M2", "gene_name": "RRM2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q16576-1", "protein_name": "Histone-binding protein RBBP7", "gene_name": "RBBP7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H2F5-1", "protein_name": "Enhancer of polycomb homolog 1", "gene_name": "EPC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NDX5-1", "protein_name": "Polyhomeotic-like protein 3", "gene_name": "PHC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75530-1", "protein_name": "Polycomb protein EED", "gene_name": "EED", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15910-1", "protein_name": "Histone-lysine N-methyltransferase EZH2", "gene_name": "EZH2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00311-1", "protein_name": "Cell division cycle 7-related protein kinase", "gene_name": "CDC7", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96KQ7-1", "protein_name": "Histone-lysine N-methyltransferase EHMT2", "gene_name": "EHMT2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q09028-1", "protein_name": "Histone-binding protein RBBP4", "gene_name": "RBBP4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWI9-4", "protein_name": "MAX gene-associated protein", "gene_name": "MGA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13185-1", "protein_name": "Chromobox protein homolog 3", "gene_name": "CBX3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14757-1", "protein_name": "Serine/threonine-protein kinase Chk1", "gene_name": "CHEK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61244-1", "protein_name": "Protein max", "gene_name": "MAX", "tax_name": "Human" }, { "uniprot_canonical_ac": "P45973-1", "protein_name": "Chromobox protein homolog 5", "gene_name": "CBX5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35226-1", "protein_name": "Polycomb complex protein BMI-1", "gene_name": "BMI1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P78364-1", "protein_name": "Polyhomeotic-like protein 1", "gene_name": "PHC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99496-1", "protein_name": "E3 ubiquitin-protein ligase RING2", "gene_name": "RNF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q06587-1", "protein_name": "E3 ubiquitin-protein ligase RING1", "gene_name": "RING1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14188-1", "protein_name": "Transcription factor Dp-2", "gene_name": "TFDP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O75461-1", "protein_name": "Transcription factor E2F6", "gene_name": "E2F6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9H9B1-1", "protein_name": "Histone-lysine N-methyltransferase EHMT1", "gene_name": "EHMT1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35227-1", "protein_name": "Polycomb group RING finger protein 2", "gene_name": "PCGF2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BYE7-1", "protein_name": "Polycomb group RING finger protein 6", "gene_name": "PCGF6", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q14186-1", "protein_name": "Transcription factor Dp-1", "gene_name": "TFDP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK9-1", "protein_name": "Protein UXT", "gene_name": "UXT", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8N488-1", "protein_name": "RING1 and YY1-binding protein", "gene_name": "RYBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15022-1", "protein_name": "Polycomb protein SUZ12", "gene_name": "SUZ12", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14727-1", "protein_name": "Apoptotic protease-activating factor 1", "gene_name": "APAF1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q969R5", "url": "https://www.uniprot.org/uniprotkb/Q969R5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9704927", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cep76, a centrosomal protein that specifically restrains centriole reduplication.", "journal": "Developmental cell", "date": "2009", "authors": "Tsang WY, Spektor A, Vijayakumar S, Bista BR, Li J, Sanchez I, Duensing S, Dynlacht BD", "reference": { "type": "PubMed", "id": "19460342", "url": "https://pubmed.ncbi.nlm.nih.gov/19460342" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TAP6-1", "protein_name": "Centrosomal protein of 76 kDa", "gene_name": "CEP76", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43303-1", "protein_name": "Centriolar coiled-coil protein of 110 kDa", "gene_name": "CCP110", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IW35-1", "protein_name": "Centrosomal protein of 97 kDa", "gene_name": "CEP97", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TAP6", "url": "https://www.uniprot.org/uniprotkb/Q8TAP6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19460342", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Opposing post-translational modifications regulate Cep76 function to suppress centriole amplification.", "journal": "Oncogene", "date": "2016", "authors": "Barbelanne M, Chiu A, Qian J, Tsang WY", "reference": { "type": "PubMed", "id": "27065328", "url": "https://pubmed.ncbi.nlm.nih.gov/27065328" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TAP6-1", "protein_name": "Centrosomal protein of 76 kDa", "gene_name": "CEP76", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TAP6", "url": "https://www.uniprot.org/uniprotkb/Q8TAP6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 83, "end_pos": 83, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q8TAP6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8TAP6" }, { "database": "PubMed", "id": "27065328", "url": "https://pubmed.ncbi.nlm.nih.gov/27065328" } ], "site_lbl": "Ser83", "uniprot_canonical_ac": "Q8TAP6-1" } ], "record_id": "pubmed.27065328", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The centriole protein CEP76 negatively regulates PLK1 activity in the cytoplasm for proper mitotic progression.", "journal": "Journal of cell science", "date": "2020", "authors": "Takeda Y, Yamazaki K, Hashimoto K, Watanabe K, Chinen T, Kitagawa D", "reference": { "type": "PubMed", "id": "32878946", "url": "https://pubmed.ncbi.nlm.nih.gov/32878946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TAP6-1", "protein_name": "Centrosomal protein of 76 kDa", "gene_name": "CEP76", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TAP6", "url": "https://www.uniprot.org/uniprotkb/Q8TAP6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32878946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nephrin is specifically located at the slit diaphragm of glomerular podocytes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Ruotsalainen V, Ljungberg P, Wartiovaara J, Lenkkeri U, Kestila M, Jalanko H, Holmberg C, Tryggvason K", "reference": { "type": "PubMed", "id": "10393930", "url": "https://pubmed.ncbi.nlm.nih.gov/10393930" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10393930", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unraveling the mechanisms of glomerular ultrafiltration: nephrin, a key component of the slit diaphragm.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "1999", "authors": "Tryggvason K", "reference": { "type": "PubMed", "id": "10541305", "url": "https://pubmed.ncbi.nlm.nih.gov/10541305" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10541305", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Gastric hyperplasia in mice lacking the putative Cdc42 effector IQGAP1.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Li S, Wang Q, Chakladar A, Bronson RT, Bernards A", "reference": { "type": "PubMed", "id": "10611248", "url": "https://pubmed.ncbi.nlm.nih.gov/10611248" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10611248", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for regulation of the PTEN tumor suppressor by a membrane-localized multi-PDZ domain containing scaffold protein MAGI-2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000-04-11", "authors": "Wu X, Hepner K, Castelino-Prabhu S, Do D, Kaye M B, Yuan X J, Wood J, Ross C, Sawyers C L, Whang Y E", "reference": { "type": "PubMed", "id": "10760291", "url": "https://pubmed.ncbi.nlm.nih.gov/10760291" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10760291", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction with podocin facilitates nephrin signaling.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Huber TB, Kottgen M, Schilling B, Walz G, Benzing T", "reference": { "type": "PubMed", "id": "11562357", "url": "https://pubmed.ncbi.nlm.nih.gov/11562357" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91X05-1", "protein_name": "Podocin", "gene_name": "Nphs2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11562357", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphorylation of the PTEN tail acts as an inhibitory switch by preventing its recruitment into a protein complex.", "journal": "J. Biol. Chem.", "date": "2001", "authors": "Vazquez F, Grossman SR, Takahashi Y, Rokas MV, Nakamura N, Sellers WR", "reference": { "type": "PubMed", "id": "11707428", "url": "https://pubmed.ncbi.nlm.nih.gov/11707428" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P60484-1", "protein_name": "Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN", "gene_name": "PTEN", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11707428", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Podocin, a raft-associated component of the glomerular slit diaphragm, interacts with CD2AP and nephrin.", "journal": "The Journal of clinical investigation", "date": "2001", "authors": "Schwarz K, Simons M, Reiser J, Saleem MA, Faul C, Kriz W, Shaw AS, Holzman LB, Mundel P", "reference": { "type": "PubMed", "id": "11733557", "url": "https://pubmed.ncbi.nlm.nih.gov/11733557" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9JLQ0-1", "protein_name": "CD2-associated protein", "gene_name": "Cd2ap", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q91X05-1", "protein_name": "Podocin", "gene_name": "Nphs2", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QZS7-1", "protein_name": "Nephrin", "gene_name": "Nphs1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11733557", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 26 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homodimerization and heterodimerization of the glomerular podocyte proteins nephrin and NEPH1.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2003", "authors": "Gerke P, Huber TB, Sellin L, Benzing T, Walz G", "reference": { "type": "PubMed", "id": "12660326", "url": "https://pubmed.ncbi.nlm.nih.gov/12660326" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80W68-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "Kirrel1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QZS7-1", "protein_name": "Nephrin", "gene_name": "Nphs1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12660326", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fyn binds to and phosphorylates the kidney slit diaphragm component Nephrin.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Verma R, Wharram B, Kovari I, Kunkel R, Nihalani D, Wary KK, Wiggins RC, Killen P, Holzman LB", "reference": { "type": "PubMed", "id": "12668668", "url": "https://pubmed.ncbi.nlm.nih.gov/12668668" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12668668", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Clustering-induced tyrosine phosphorylation of nephrin by Src family kinases.", "journal": "Kidney international", "date": "2003", "authors": "Lahdenpera J, Kilpelainen P, Liu XL, Pikkarainen T, Reponen P, Ruotsalainen V, Tryggvason K", "reference": { "type": "PubMed", "id": "12846735", "url": "https://pubmed.ncbi.nlm.nih.gov/12846735" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12846735", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neph1 and nephrin interaction in the slit diaphragm is an important determinant of glomerular permeability.", "journal": "The Journal of clinical investigation", "date": "2003", "authors": "Liu G, Kaw B, Kurfis J, Rahmanuddin S, Kanwar YS, Chugh SS", "reference": { "type": "PubMed", "id": "12865409", "url": "https://pubmed.ncbi.nlm.nih.gov/12865409" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q80W68-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "Kirrel1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6X936-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "Kirrel1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12865409", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis of the functional podocin-nephrin complex: mutations in the NPHS2 gene disrupt nephrin targeting to lipid raft microdomains.", "journal": "Human molecular genetics", "date": "2003", "authors": "Huber TB, Simons M, Hartleben B, Sernetz L, Schmidts M, Gundlach E, Saleem MA, Walz G, Benzing T", "reference": { "type": "PubMed", "id": "14570703", "url": "https://pubmed.ncbi.nlm.nih.gov/14570703" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14570703", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nephrin promotes cell-cell adhesion through homophilic interactions.", "journal": "The American journal of pathology", "date": "2003", "authors": "Khoshnoodi J, Sigmundsson K, Ofverstedt LG, Skoglund U, Obrink B, Wartiovaara J, Tryggvason K", "reference": { "type": "PubMed", "id": "14633607", "url": "https://pubmed.ncbi.nlm.nih.gov/14633607" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14633607", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nephrin forms a complex with adherens junction proteins and CASK in podocytes and in Madin-Darby canine kidney cells expressing nephrin.", "journal": "The American journal of pathology", "date": "2004", "authors": "Lehtonen S, Lehtonen E, Kudlicka K, Holthofer H, Farquhar MG", "reference": { "type": "PubMed", "id": "15331416", "url": "https://pubmed.ncbi.nlm.nih.gov/15331416" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15331416", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nephrin strands contribute to a porous slit diaphragm scaffold as revealed by electron tomography.", "journal": "The Journal of clinical investigation", "date": "2004", "authors": "Wartiovaara J, Ofverstedt LG, Khoshnoodi J, Zhang J, Makela E, Sandin S, Ruotsalainen V, Cheng RH, Jalanko H, Skoglund U, Tryggvason K", "reference": { "type": "PubMed", "id": "15545998", "url": "https://pubmed.ncbi.nlm.nih.gov/15545998" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15545998", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SRC-family kinase Fyn phosphorylates the cytoplasmic domain of nephrin and modulates its interaction with podocin.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2004", "authors": "Li H, Lemay S, Aoudjit L, Kawachi H, Takano T", "reference": { "type": "PubMed", "id": "15579503", "url": "https://pubmed.ncbi.nlm.nih.gov/15579503" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15579503", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the interactions of the nephrin intracellular domain.", "journal": "The FEBS journal", "date": "2005", "authors": "Liu XL, Kilpelainen P, Hellman U, Sun Y, Wartiovaara J, Morgunova E, Pikkarainen T, Yan K, Jonsson AP, Tryggvason K", "reference": { "type": "PubMed", "id": "15634346", "url": "https://pubmed.ncbi.nlm.nih.gov/15634346" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15634346", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "NEPH2 is located at the glomerular slit diaphragm, interacts with nephrin and is cleaved from podocytes by metalloproteinases.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2005", "authors": "Gerke P, Sellin L, Kretz O, Petraschka D, Zentgraf H, Benzing T, Walz G", "reference": { "type": "PubMed", "id": "15843475", "url": "https://pubmed.ncbi.nlm.nih.gov/15843475" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8BR86-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "Kirrel3", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QZS7-1", "protein_name": "Nephrin", "gene_name": "Nphs1", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15843475", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 25 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell junction-associated proteins IQGAP1, MAGI-2, CASK, spectrins, and alpha-actinin are components of the nephrin multiprotein complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Lehtonen S, Ryan JJ, Kudlicka K, Iino N, Zhou H, Farquhar MG", "reference": { "type": "PubMed", "id": "15994232", "url": "https://pubmed.ncbi.nlm.nih.gov/15994232" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q62915-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "Cask", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P16086-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "Gle1; Sptan1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88382-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "Magi2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9R044-1", "protein_name": "Adhesion molecule nephrin", "gene_name": "Nphs1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9QXQ0-1", "protein_name": "Alpha-actinin-4", "gene_name": "Actn4", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15994232", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Postsynaptic recruitment of Dendrin depends on both dendritic mRNA transport and synaptic anchoring.", "journal": "J. Neurochem.", "date": "2006", "authors": "Kremerskothen J, Kindler S, Finger I, Veltel S, Barnekow A", "reference": { "type": "PubMed", "id": "16464232", "url": "https://pubmed.ncbi.nlm.nih.gov/16464232" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88382-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "Magi2", "tax_name": "Rat" }, { "uniprot_canonical_ac": "Q9Z1P2-1", "protein_name": "Alpha-actinin-1", "gene_name": "Actn1", "tax_name": "Rat" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94850-1", "protein_name": "Dendrin", "gene_name": "DDN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P50617-1", "protein_name": "Dendrin", "gene_name": "Ddn", "tax_name": "Rat" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16464232", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nck adaptor proteins link nephrin to the actin cytoskeleton of kidney podocytes.", "journal": "Nature", "date": "2006", "authors": "Jones N, Blasutig IM, Eremina V, Ruston JM, Bladt F, Li H, Huang H, Larose L, Li SS, Takano T, Quaggin SE, Pawson T", "reference": { "type": "PubMed", "id": "16525419", "url": "https://pubmed.ncbi.nlm.nih.gov/16525419" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16525419", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nephrin ectodomain engagement results in Src kinase activation, nephrin phosphorylation, Nck recruitment, and actin polymerization.", "journal": "The Journal of clinical investigation", "date": "2006", "authors": "Verma R, Kovari I, Soofi A, Nihalani D, Patrie K, Holzman LB", "reference": { "type": "PubMed", "id": "16543952", "url": "https://pubmed.ncbi.nlm.nih.gov/16543952" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16543952", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nck links nephrin to actin in kidney podocytes.", "journal": "Cell", "date": "2006", "authors": "Tryggvason K, Pikkarainen T, Patrakka J", "reference": { "type": "PubMed", "id": "16630808", "url": "https://pubmed.ncbi.nlm.nih.gov/16630808" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16630808", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The nephrin-based slit diaphragm: new insight into the signalling platform identifies targets for therapy.", "journal": "Nephrology, dialysis, transplantation : official publication of the European Dialysis and Transplant Association - European Renal Association", "date": "2007", "authors": "Aaltonen P, Holthofer H", "reference": { "type": "PubMed", "id": "17893108", "url": "https://pubmed.ncbi.nlm.nih.gov/17893108" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17893108", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neph1 cooperates with nephrin to transduce a signal that induces actin polymerization.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Garg P, Verma R, Nihalani D, Johnstone DB, Holzman LB", "reference": { "type": "PubMed", "id": "17923684", "url": "https://pubmed.ncbi.nlm.nih.gov/17923684" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17923684", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nephrin mediates actin reorganization via phosphoinositide 3-kinase in podocytes.", "journal": "Kidney international", "date": "2008", "authors": "Zhu J, Sun N, Aoudjit L, Li H, Kawachi H, Lemay S, Takano T", "reference": { "type": "PubMed", "id": "18033240", "url": "https://pubmed.ncbi.nlm.nih.gov/18033240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18033240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nck proteins maintain the adult glomerular filtration barrier.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2009", "authors": "Jones N, New LA, Fortino MA, Eremina V, Ruston J, Blasutig IM, Aoudjit L, Zou Y, Liu X, Yu GL, Takano T, Quaggin SE, Pawson T", "reference": { "type": "PubMed", "id": "19443634", "url": "https://pubmed.ncbi.nlm.nih.gov/19443634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UL8-1", "protein_name": "Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 2", "gene_name": "MAGI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46940-1", "protein_name": "Ras GTPase-activating-like protein IQGAP1", "gene_name": "IQGAP1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43707-1", "protein_name": "Alpha-actinin-4", "gene_name": "ACTN4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00401-1", "protein_name": "Actin nucleation-promoting factor WASL", "gene_name": "WASL", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42336-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform", "gene_name": "PIK3CA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q01082-1", "protein_name": "Spectrin beta chain, non-erythrocytic 1", "gene_name": "SPTBN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60500-1", "protein_name": "Nephrin", "gene_name": "NPHS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NP85-1", "protein_name": "Podocin", "gene_name": "NPHS2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96J84-1", "protein_name": "Kin of IRRE-like protein 1", "gene_name": "KIRREL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35609-1", "protein_name": "Alpha-actinin-2", "gene_name": "ACTN2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12814-1", "protein_name": "Alpha-actinin-1", "gene_name": "ACTN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q08043-1", "protein_name": "Alpha-actinin-3", "gene_name": "ACTN3", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00459-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit beta", "gene_name": "PIK3R2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14936-1", "protein_name": "Peripheral plasma membrane protein CASK", "gene_name": "CASK", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6UWL6-1", "protein_name": "Kin of IRRE-like protein 2", "gene_name": "KIRREL2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y5K6-1", "protein_name": "CD2-associated protein", "gene_name": "CD2AP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZU9-1", "protein_name": "Kin of IRRE-like protein 3", "gene_name": "KIRREL3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P42338-1", "protein_name": "Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform", "gene_name": "PIK3CB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13813-1", "protein_name": "Spectrin alpha chain, non-erythrocytic 1", "gene_name": "SPTAN1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27986-1", "protein_name": "Phosphatidylinositol 3-kinase regulatory subunit alpha", "gene_name": "PIK3R1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P06241-1", "protein_name": "Tyrosine-protein kinase Fyn", "gene_name": "FYN", "tax_name": "Human" }, { "uniprot_canonical_ac": "P16333-1", "protein_name": "SH2/SH3 adapter protein NCK1", "gene_name": "NCK1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43639-1", "protein_name": "Cytoplasmic protein NCK2", "gene_name": "NCK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UL8", "url": "https://www.uniprot.org/uniprotkb/Q86UL8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19443634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 23 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]