[ { "title": "DHHC20: a human palmitoyl acyltransferase that causes cellular transformation.", "journal": "Molecular membrane biology", "date": "2010", "authors": "Draper JM, Smith CD", "reference": { "type": "PubMed", "id": "20334580", "url": "https://pubmed.ncbi.nlm.nih.gov/20334580" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5W0Z9-1", "protein_name": "Palmitoyltransferase ZDHHC20", "gene_name": "ZDHHC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20334580", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of DHHC20-Mediated EGFR Palmitoylation Creates a Dependence on EGFR Signaling.", "journal": "Molecular cell", "date": "2016", "authors": "Runkle KB, Kharbanda A, Stypulkowski E, Cao XJ, Wang W, Garcia BA, Witze ES", "reference": { "type": "PubMed", "id": "27153536", "url": "https://pubmed.ncbi.nlm.nih.gov/27153536" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5W0Z9-1", "protein_name": "Palmitoyltransferase ZDHHC20", "gene_name": "ZDHHC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00533-1", "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1048, "end_pos": 1210, "sequence_org": "ACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA", "sequence_mut": "", "comment": "Abolishes palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "P00533", "url": "https://www.uniprot.org/uniprotkb/P00533" }, { "database": "PubMed", "id": "27153536", "url": "https://pubmed.ncbi.nlm.nih.gov/27153536" } ], "uniprot_canonical_ac": "P00533-1" }, { "start_pos": 1049, "end_pos": 1049, "sequence_org": "C", "sequence_mut": "A", "comment": "Decreased palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "P00533", "url": "https://www.uniprot.org/uniprotkb/P00533" }, { "database": "PubMed", "id": "27153536", "url": "https://pubmed.ncbi.nlm.nih.gov/27153536" } ], "uniprot_canonical_ac": "P00533-1" }, { "start_pos": 1146, "end_pos": 1146, "sequence_org": "C", "sequence_mut": "A", "comment": "Decreased palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "P00533", "url": "https://www.uniprot.org/uniprotkb/P00533" }, { "database": "PubMed", "id": "27153536", "url": "https://pubmed.ncbi.nlm.nih.gov/27153536" } ], "uniprot_canonical_ac": "P00533-1" } ], "phosphorylation": [ { "start_pos": 1092, "end_pos": 1092, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P00533", "url": "https://www.uniprot.org/uniprotkb/P00533" }, { "database": "IntAct", "id": "P00533", "url": "https://www.ebi.ac.uk/intact/interactors/id:P00533*" }, { "database": "iPTMnet", "id": "P00533", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00533" }, { "database": "PubMed", "id": "10229072", "url": "https://pubmed.ncbi.nlm.nih.gov/10229072" }, { "database": "PubMed", "id": "14966128", "url": "https://pubmed.ncbi.nlm.nih.gov/14966128" }, { "database": "PubMed", "id": "11896612", "url": "https://pubmed.ncbi.nlm.nih.gov/11896612" }, { "database": "PubMed", "id": "16729043", "url": "https://pubmed.ncbi.nlm.nih.gov/16729043" }, { "database": "PubMed", "id": "7518560", "url": "https://pubmed.ncbi.nlm.nih.gov/7518560" }, { "database": "PubMed", "id": "7527043", "url": "https://pubmed.ncbi.nlm.nih.gov/7527043" }, { "database": "PubMed", "id": "7993895", "url": "https://pubmed.ncbi.nlm.nih.gov/7993895" }, { "database": "PubMed", "id": "9153411", "url": "https://pubmed.ncbi.nlm.nih.gov/9153411" }, { "database": "PubMed", "id": "8940013", "url": "https://pubmed.ncbi.nlm.nih.gov/8940013" }, { "database": "PRO", "id": "P00533", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P00533" }, { "database": "PubMed", "id": "15329413", "url": "https://pubmed.ncbi.nlm.nih.gov/15329413" }, { "database": "PubMed", "id": "15737014", "url": "https://pubmed.ncbi.nlm.nih.gov/15737014" }, { "database": "PubMed", "id": "17726540", "url": "https://pubmed.ncbi.nlm.nih.gov/17726540" }, { "database": "PubMed", "id": "17877814", "url": "https://pubmed.ncbi.nlm.nih.gov/17877814" }, { "database": "PubMed", "id": "19531499", "url": "https://pubmed.ncbi.nlm.nih.gov/19531499" }, { "database": "PubMed", "id": "23825523", "url": "https://pubmed.ncbi.nlm.nih.gov/23825523" }, { "database": "PubMed", "id": "26370283", "url": "https://pubmed.ncbi.nlm.nih.gov/26370283" }, { "database": "PubMed", "id": "28724430", "url": "https://pubmed.ncbi.nlm.nih.gov/28724430" }, { "database": "PubMed", "id": "31537844", "url": "https://pubmed.ncbi.nlm.nih.gov/31537844" }, { "database": "PubMed", "id": "23774213", "url": "https://pubmed.ncbi.nlm.nih.gov/23774213" }, { "database": "PubMed", "id": "27153536", "url": "https://pubmed.ncbi.nlm.nih.gov/27153536" } ], "site_lbl": "Tyr1092", "uniprot_canonical_ac": "P00533-1" }, { "start_pos": 1172, "end_pos": 1172, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P00533", "url": "https://www.uniprot.org/uniprotkb/P00533" }, { "database": "IEDB", "id": "P00533", "url": "https://www.iedb.org/epitope/P00533" }, { "database": "iPTMnet", "id": "P00533", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00533" }, { "database": "PubMed", "id": "35494241", "url": "https://pubmed.ncbi.nlm.nih.gov/35494241" }, { "database": "IntAct", "id": "P00533", "url": "https://www.ebi.ac.uk/intact/interactors/id:P00533*" }, { "database": "PubMed", "id": "16273093", "url": "https://pubmed.ncbi.nlm.nih.gov/16273093" }, { "database": "PubMed", "id": "16729043", "url": "https://pubmed.ncbi.nlm.nih.gov/16729043" }, { "database": "PubMed", "id": "12454019", "url": "https://pubmed.ncbi.nlm.nih.gov/12454019" }, { "database": "PRO", "id": "P00533", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P00533" }, { "database": "PubMed", "id": "22559222", "url": "https://pubmed.ncbi.nlm.nih.gov/22559222" }, { "database": "PubMed", "id": "27281782", "url": "https://pubmed.ncbi.nlm.nih.gov/27281782" }, { "database": "PubMed", "id": "31492560", "url": "https://pubmed.ncbi.nlm.nih.gov/31492560" }, { "database": "PubMed", "id": "27153536", "url": "https://pubmed.ncbi.nlm.nih.gov/27153536" } ], "site_lbl": "Tyr1172", "uniprot_canonical_ac": "P00533-1" }, { "start_pos": 1197, "end_pos": 1197, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "P00533", "url": "https://www.uniprot.org/uniprotkb/P00533" }, { "database": "IntAct", "id": "P00533", "url": "https://www.ebi.ac.uk/intact/interactors/id:P00533*" }, { "database": "iPTMnet", "id": "P00533", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P00533" }, { "database": "PubMed", "id": "16729043", "url": "https://pubmed.ncbi.nlm.nih.gov/16729043" }, { "database": "PubMed", "id": "7518560", "url": "https://pubmed.ncbi.nlm.nih.gov/7518560" }, { "database": "PubMed", "id": "7542744", "url": "https://pubmed.ncbi.nlm.nih.gov/7542744" }, { "database": "PubMed", "id": "7693694", "url": "https://pubmed.ncbi.nlm.nih.gov/7693694" }, { "database": "PubMed", "id": "8034616", "url": "https://pubmed.ncbi.nlm.nih.gov/8034616" }, { "database": "PubMed", "id": "9733788", "url": "https://pubmed.ncbi.nlm.nih.gov/9733788" }, { "database": "PubMed", "id": "9544989", "url": "https://pubmed.ncbi.nlm.nih.gov/9544989" }, { "database": "PRO", "id": "P00533", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P00533" }, { "database": "PubMed", "id": "22703031", "url": "https://pubmed.ncbi.nlm.nih.gov/22703031" }, { "database": "PubMed", "id": "26370283", "url": "https://pubmed.ncbi.nlm.nih.gov/26370283" }, { "database": "PubMed", "id": "29556515", "url": "https://pubmed.ncbi.nlm.nih.gov/29556515" }, { "database": "PubMed", "id": "30615629", "url": "https://pubmed.ncbi.nlm.nih.gov/30615629" }, { "database": "PubMed", "id": "31492560", "url": "https://pubmed.ncbi.nlm.nih.gov/31492560" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "19563760", "url": "https://pubmed.ncbi.nlm.nih.gov/19563760" }, { "database": "PubMed", "id": "19836242", "url": "https://pubmed.ncbi.nlm.nih.gov/19836242" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23774213", "url": "https://pubmed.ncbi.nlm.nih.gov/23774213" }, { "database": "PubMed", "id": "27153536", "url": "https://pubmed.ncbi.nlm.nih.gov/27153536" } ], "site_lbl": "Tyr1197", "uniprot_canonical_ac": "P00533-1" } ], "record_id": "pubmed.27153536", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fatty acyl recognition and transfer by an integral membrane S-acyltransferase.", "journal": "Science (New York, N.Y.)", "date": "2018", "authors": "Rana MS, Kumar P, Lee CJ, Verardi R, Rajashankar KR, Banerjee A", "reference": { "type": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5W0Z9-1", "protein_name": "Palmitoyltransferase ZDHHC20", "gene_name": "ZDHHC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "F1QXD3-1", "protein_name": "Palmitoyltransferase ZDHHC15B", "gene_name": "zdhhc15b", "tax_name": "Zebrafish" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 153, "end_pos": 153, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 154, "end_pos": 154, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 156, "end_pos": 156, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 158, "end_pos": 158, "sequence_org": "W", "sequence_mut": "A", "comment": "Strongly reduced catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 171, "end_pos": 171, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 174, "end_pos": 174, "sequence_org": "F", "sequence_mut": "A", "comment": "Strongly reduced catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 181, "end_pos": 181, "sequence_org": "Y", "sequence_mut": "A", "comment": "Moderately reduced catalytic activity. Enhances activity with acyl-CoA with C18 and C20 fatty acid chains.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 227, "end_pos": 227, "sequence_org": "L", "sequence_mut": "W", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 22, "end_pos": 22, "sequence_org": "I", "sequence_mut": "W", "comment": "Strongly reduced catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 240, "end_pos": 241, "sequence_org": "TT", "sequence_mut": "AA", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 243, "end_pos": 243, "sequence_org": "E", "sequence_mut": "A", "comment": "Mildly reduced catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 266, "end_pos": 266, "sequence_org": "N", "sequence_mut": "A", "comment": "Strongly reduced catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 267, "end_pos": 267, "sequence_org": "W", "sequence_mut": "", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 271, "end_pos": 271, "sequence_org": "F", "sequence_mut": "A", "comment": "Mildly reduced catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" }, { "start_pos": 29, "end_pos": 29, "sequence_org": "S", "sequence_mut": "F", "comment": "Strongly reduced catalytic activity. Enhances activity with acyl-CoA with C12 and C14 fatty acid chains.", "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" }, { "database": "PubMed", "id": "29326245", "url": "https://pubmed.ncbi.nlm.nih.gov/29326245" } ], "uniprot_canonical_ac": "Q5W0Z9-1" } ], "record_id": "pubmed.29326245", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Metallo-beta-lactamase domain-containing protein 2 is S-palmitoylated and exhibits acyl-CoA hydrolase activity.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Malgapo MIP, Safadi JM, Linder ME", "reference": { "type": "PubMed", "id": "33219126", "url": "https://pubmed.ncbi.nlm.nih.gov/33219126" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5W0Z9-1", "protein_name": "Palmitoyltransferase ZDHHC20", "gene_name": "ZDHHC20", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q68D91-1", "protein_name": "Acyl-coenzyme A thioesterase MBLAC2", "gene_name": "MBLAC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 176, "end_pos": 176, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on ZDHH20-catalyzed palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "Q68D91", "url": "https://www.uniprot.org/uniprotkb/Q68D91" }, { "database": "PubMed", "id": "33219126", "url": "https://pubmed.ncbi.nlm.nih.gov/33219126" } ], "uniprot_canonical_ac": "Q68D91-1" }, { "start_pos": 212, "end_pos": 212, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on ZDHH20-catalyzed palmitoylation.", "evidence": [ { "database": "UniProtKB", "id": "Q68D91", "url": "https://www.uniprot.org/uniprotkb/Q68D91" }, { "database": "PubMed", "id": "33219126", "url": "https://pubmed.ncbi.nlm.nih.gov/33219126" } ], "uniprot_canonical_ac": "Q68D91-1" }, { "start_pos": 254, "end_pos": 254, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of ZDHH20-catalyzed palmitoylation. Shows only a slight reduction in the Vmax and a small increase in the Km towards palmitoyl-CoA in comparison with wild-type.", "evidence": [ { "database": "UniProtKB", "id": "Q68D91", "url": "https://www.uniprot.org/uniprotkb/Q68D91" }, { "database": "PubMed", "id": "33219126", "url": "https://pubmed.ncbi.nlm.nih.gov/33219126" } ], "uniprot_canonical_ac": "Q68D91-1" }, { "start_pos": 87, "end_pos": 87, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q68D91", "url": "https://www.uniprot.org/uniprotkb/Q68D91" }, { "database": "PubMed", "id": "33219126", "url": "https://pubmed.ncbi.nlm.nih.gov/33219126" } ], "uniprot_canonical_ac": "Q68D91-1" }, { "start_pos": 88, "end_pos": 88, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q68D91", "url": "https://www.uniprot.org/uniprotkb/Q68D91" }, { "database": "PubMed", "id": "33219126", "url": "https://pubmed.ncbi.nlm.nih.gov/33219126" } ], "uniprot_canonical_ac": "Q68D91-1" }, { "start_pos": 89, "end_pos": 89, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect on enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q68D91", "url": "https://www.uniprot.org/uniprotkb/Q68D91" }, { "database": "PubMed", "id": "33219126", "url": "https://pubmed.ncbi.nlm.nih.gov/33219126" } ], "uniprot_canonical_ac": "Q68D91-1" }, { "start_pos": 93, "end_pos": 93, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q68D91", "url": "https://www.uniprot.org/uniprotkb/Q68D91" }, { "database": "PubMed", "id": "33219126", "url": "https://pubmed.ncbi.nlm.nih.gov/33219126" } ], "uniprot_canonical_ac": "Q68D91-1" } ], "record_id": "pubmed.33219126", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "S-acylation by ZDHHC20 targets ORAI1 channels to lipid rafts for efficient Ca(2+) signaling by Jurkat T cell receptors at the immune synapse.", "journal": "eLife", "date": "2021", "authors": "Carreras-Sureda A, Abrami L, Ji-Hee K, Wang WA, Henry C, Frieden M, Didier M, van der Goot FG, Demaurex N", "reference": { "type": "PubMed", "id": "34913437", "url": "https://pubmed.ncbi.nlm.nih.gov/34913437" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5W0Z9-1", "protein_name": "Palmitoyltransferase ZDHHC20", "gene_name": "ZDHHC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34913437", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bivalent recognition of fatty acyl-CoA by a human integral membrane palmitoyltransferase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2022", "authors": "Lee CJ, Stix R, Rana MS, Shikwana F, Murphy RE, Ghirlando R, Faraldo-Gomez JD, Banerjee A", "reference": { "type": "PubMed", "id": "35140179", "url": "https://pubmed.ncbi.nlm.nih.gov/35140179" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5W0Z9-1", "protein_name": "Palmitoyltransferase ZDHHC20", "gene_name": "ZDHHC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35140179", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Palmitoyl transferase ZDHHC20 promotes pancreatic cancer metastasis.", "journal": "Cell reports", "date": "2024-05-28", "authors": "Tomi\u0107 Goran, Sheridan Clare, Refermat Alice Y, Baggelaar Marc P, Sipthorp James, Sudarshan Bhuvana, Ocasio Cory A, Su\u00e1rez-Bonnet Alejandro, Priestnall Simon L, Herbert Eleanor, Tate Edward W, Downward Julian", "reference": { "type": "PubMed", "id": "38733589", "url": "https://pubmed.ncbi.nlm.nih.gov/38733589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5W0Z9-1", "protein_name": "Palmitoyltransferase ZDHHC20", "gene_name": "ZDHHC20", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5W0Z9", "url": "https://www.uniprot.org/uniprotkb/Q5W0Z9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38733589", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZSWIM8 is a myogenic protein that partly prevents C2C12 differentiation.", "journal": "Scientific reports", "date": "2021", "authors": "Okumura F, Oki N, Fujiki Y, Ikuta R, Osaki K, Hamada S, Nakatsukasa K, Hisamoto N, Hara T, Kamura T", "reference": { "type": "PubMed", "id": "34686700", "url": "https://pubmed.ncbi.nlm.nih.gov/34686700" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A7E2V4-1", "protein_name": "Zinc finger SWIM domain-containing protein 8", "gene_name": "ZSWIM8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A7E2V4", "url": "https://www.uniprot.org/uniprotkb/A7E2V4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34686700", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The conserved Pelado/ZSWIM8 protein regulates actin dynamics by promoting linear actin filament polymerization.", "journal": "Life science alliance", "date": "2022", "authors": "Molina-Pelayo C, Olguin P, Mlodzik M, Glavic A", "reference": { "type": "PubMed", "id": "35940847", "url": "https://pubmed.ncbi.nlm.nih.gov/35940847" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A7E2V4-1", "protein_name": "Zinc finger SWIM domain-containing protein 8", "gene_name": "ZSWIM8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A7E2V4", "url": "https://www.uniprot.org/uniprotkb/A7E2V4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35940847", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zika virus NS5 protein inhibits type I interferon signaling via CRL3 E3 ubiquitin ligase-mediated degradation of STAT2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2024-08-20", "authors": "Ren Wenlin, Fu Chonglei, Zhang Yu, Ju Xiaohui, Jiang Xi, Song Jingwei, Gong Mingli, Li Zhuoyang, Fan Wenchun, Yao Jun, Ding Qiang", "reference": { "type": "PubMed", "id": "39145933", "url": "https://pubmed.ncbi.nlm.nih.gov/39145933" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A7E2V4-1", "protein_name": "Zinc finger SWIM domain-containing protein 8", "gene_name": "ZSWIM8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A7E2V4", "url": "https://www.uniprot.org/uniprotkb/A7E2V4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39145933", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Angiotensin II requires zinc and downregulation of the zinc transporters ZnT3 and ZnT10 to induce senescence of vascular smooth muscle cells.", "journal": "PloS one", "date": "2012", "authors": "Patrushev N, Seidel-Rogol B, Salazar G", "reference": { "type": "PubMed", "id": "22427991", "url": "https://pubmed.ncbi.nlm.nih.gov/22427991" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6XR72-4", "protein_name": "Calcium/manganese antiporter SLC30A10", "gene_name": "SLC30A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22427991", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Efflux function, tissue-specific expression and intracellular trafficking of the Zn transporter ZnT10 indicate roles in adult Zn homeostasis.", "journal": "Metallomics", "date": "2012", "authors": "Bosomworth Helen J, Thornton Jared K, Coneyworth Lisa J, Ford Dianne, Valentine Ruth A", "reference": { "type": "PubMed", "id": "22706290", "url": "https://pubmed.ncbi.nlm.nih.gov/22706290" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6XR72-4", "protein_name": "Calcium/manganese antiporter SLC30A10", "gene_name": "SLC30A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22706290", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The zinc finger protein ZNF658 regulates the transcription of genes involved in zinc homeostasis and affects ribosome biogenesis through the zinc transcriptional regulatory element.", "journal": "Mol. Cell. Biol.", "date": "2015", "authors": "Ogo OA, Tyson J, Cockell SJ, Howard A, Valentine RA, Ford D", "reference": { "type": "PubMed", "id": "25582195", "url": "https://pubmed.ncbi.nlm.nih.gov/25582195" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6XR72-4", "protein_name": "Calcium/manganese antiporter SLC30A10", "gene_name": "SLC30A10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TAD4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A5", "gene_name": "SLC30A5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q5TYW1-1", "protein_name": "Zinc finger protein 658", "gene_name": "ZNF658", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BRT8-1", "protein_name": "Zinc-regulated GTPase metalloprotein activator 1A", "gene_name": "ZNG1A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25582195", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential Targeting of SLC30A10/ZnT10 Heterodimers to Endolysosomal Compartments Modulates EGF-Induced MEK/ERK1/2 Activity.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2016", "authors": "Zhao Y, Feresin RG, Falcon-Perez JM, Salazar G", "reference": { "type": "PubMed", "id": "26728129", "url": "https://pubmed.ncbi.nlm.nih.gov/26728129" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6XR72-4", "protein_name": "Calcium/manganese antiporter SLC30A10", "gene_name": "SLC30A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 4, "end_pos": 4, "sequence_org": "Y", "sequence_mut": "F", "comment": "Decreased interaction with SLC30A3. No effect on self-association. Decreased zinc ion transmembrane transporter activity. Decreased EGF-induced ERK1/2 phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "26728129", "url": "https://pubmed.ncbi.nlm.nih.gov/26728129" } ], "uniprot_canonical_ac": "Q6XR72-4" } ], "record_id": "pubmed.26728129", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Direct Comparison of Manganese Detoxification/Efflux Proteins and Molecular Characterization of ZnT10 Protein as a Manganese Transporter.", "journal": "The Journal of biological chemistry", "date": "2016-07-08", "authors": "Nishito Yukina, Tsuji Natsuko, Fujishiro Hitomi, Takeda Taka-Aki, Yamazaki Tomohiro, Teranishi Fumie, Okazaki Fumiko, Matsunaga Ayu, Tuschl Karin, Rao Rajini, Kono Satoshi, Miyajima Hiroaki, Narita Hiroshi, Himeno Seiichiro, Kambe Taiho", "reference": { "type": "PubMed", "id": "27226609", "url": "https://pubmed.ncbi.nlm.nih.gov/27226609" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6XR72-4", "protein_name": "Calcium/manganese antiporter SLC30A10", "gene_name": "SLC30A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 242, "end_pos": 242, "sequence_org": "L", "sequence_mut": "F", "comment": "Loss of calcium:manganese antiporter activity and increased zinc ion transmembrane transporter activity; when associated with H-43 and V-52.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27226609", "url": "https://pubmed.ncbi.nlm.nih.gov/27226609" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 43, "end_pos": 43, "sequence_org": "N", "sequence_mut": "H", "comment": "No effect on localization to the plasma membrane. Loss of calcium:manganese antiporter activity. Loss of calcium:manganese antiporter activity and increased zinc ion transmembrane transporter activity; when associated with V-52 and F-242.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27226609", "url": "https://pubmed.ncbi.nlm.nih.gov/27226609" }, { "database": "PubMed", "id": "30755481", "url": "https://pubmed.ncbi.nlm.nih.gov/30755481" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 52, "end_pos": 52, "sequence_org": "C", "sequence_mut": "V", "comment": "Loss of calcium:manganese antiporter activity and increased zinc ion transmembrane transporter activity; when associated with H-43 and F-242.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27226609", "url": "https://pubmed.ncbi.nlm.nih.gov/27226609" } ], "uniprot_canonical_ac": "Q6XR72-4" } ], "record_id": "pubmed.27226609", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural Elements in the Transmembrane and Cytoplasmic Domains of the Metal Transporter SLC30A10 Are Required for Its Manganese Efflux Activity.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Zogzas CE, Aschner M, Mukhopadhyay S", "reference": { "type": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6XR72-4", "protein_name": "Calcium/manganese antiporter SLC30A10", "gene_name": "SLC30A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 127, "end_pos": 127, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on localization to the plasma membrane. No effect on localization to the plasma membrane and decreased calcium:manganese antiporter activity; when associated with A-244.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 244, "end_pos": 244, "sequence_org": "H", "sequence_mut": "A", "comment": "No effect on localization to the plasma membrane. No effect on localization to the plasma membrane and decreased calcium:manganese antiporter activity; when associated with A-127.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 248, "end_pos": 248, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on localization to the plasma membrane. Loss of manganese ion export across plasma membrane.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 25, "end_pos": 25, "sequence_org": "E", "sequence_mut": "A", "comment": "No effect on localization to the plasma membrane. Loss of calcium:manganese antiporter activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 333, "end_pos": 333, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreased calcium:manganese antiporter activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 350, "end_pos": 350, "sequence_org": "H", "sequence_mut": "A", "comment": "Decreased calcium:manganese antiporter activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 40, "end_pos": 40, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on localization to the plasma membrane. Loss of calcium:manganese antiporter activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 43, "end_pos": 43, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on localization to the plasma membrane. Changed calcium:manganese antiporter activity. Enhanced coupling between manganese and calcium exchange.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" }, { "database": "PubMed", "id": "30755481", "url": "https://pubmed.ncbi.nlm.nih.gov/30755481" } ], "uniprot_canonical_ac": "Q6XR72-4" }, { "start_pos": 47, "end_pos": 47, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on localization to the plasma membrane. No effect on calcium:manganese antiporter activity.", "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" }, { "database": "PubMed", "id": "27307044", "url": "https://pubmed.ncbi.nlm.nih.gov/27307044" } ], "uniprot_canonical_ac": "Q6XR72-4" } ], "record_id": "pubmed.27307044", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Manganese efflux transporter SLC30A10 missense polymorphism T95I associated with liver injury retains manganese efflux activity.", "journal": "American journal of physiology. Gastrointestinal and liver physiology", "date": "2023-01-01", "authors": "Gurol Kerem C, Li Danyang, Broberg Karin, Mukhopadhyay Somshuvra", "reference": { "type": "PubMed", "id": "36414535", "url": "https://pubmed.ncbi.nlm.nih.gov/36414535" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6XR72-4", "protein_name": "Calcium/manganese antiporter SLC30A10", "gene_name": "SLC30A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36414535", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell-free SLC30A10 messenger ribonucleic acid (mRNA) expression and their association with vitamin-D level among non-small cell lung cancer (NSCLC) patients.", "journal": "Journal of cancer research and therapeutics", "date": "2023-01-01", "authors": "Verma Amit K, Naseeb Manal A, Basaqr Reem O, Albajri Eram A, Khan Mohammad Idreesh, Dev Kapil, Beg Mirza Masroor Ali", "reference": { "type": "PubMed", "id": "38384053", "url": "https://pubmed.ncbi.nlm.nih.gov/38384053" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6XR72-4", "protein_name": "Calcium/manganese antiporter SLC30A10", "gene_name": "SLC30A10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6XR72", "url": "https://www.uniprot.org/uniprotkb/Q6XR72" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38384053", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A family of unconventional deubiquitinases with modular chain specificity determinants.", "journal": "Nature communications", "date": "2018", "authors": "Hermanns T, Pichlo C, Woiwode I, Klopffleisch K, Witting KF, Ovaa H, Baumann U, Hofmann K", "reference": { "type": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96AP4-1", "protein_name": "Zinc finger-containing ubiquitin peptidase 1", "gene_name": "ZUP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 351, "end_pos": 351, "sequence_org": "S", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 351, "end_pos": 351, "sequence_org": "S", "sequence_mut": "Q", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 351, "end_pos": 351, "sequence_org": "S", "sequence_mut": "Y", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 360, "end_pos": 360, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29563501", "url": "https://pubmed.ncbi.nlm.nih.gov/29563501" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" }, { "database": "PubMed", "id": "29576528", "url": "https://pubmed.ncbi.nlm.nih.gov/29576528" }, { "database": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 406, "end_pos": 406, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 428, "end_pos": 428, "sequence_org": "E", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 491, "end_pos": 491, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29563501", "url": "https://pubmed.ncbi.nlm.nih.gov/29563501" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" }, { "database": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" } ], "uniprot_canonical_ac": "Q96AP4-1" } ], "record_id": "pubmed.29476094", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reactive-site-centric chemoproteomics identifies a distinct class of deubiquitinase enzymes.", "journal": "Nature communications", "date": "2018", "authors": "Hewings DS, Heideker J, Ma TP, AhYoung AP, El Oualid F, Amore A, Costakes GT, Kirchhofer D, Brasher B, Pillow T, Popovych N, Maurer T, Schwerdtfeger C, Forrest WF, Yu K, Flygare J, Bogyo M, Wertz IE", "reference": { "type": "PubMed", "id": "29563501", "url": "https://pubmed.ncbi.nlm.nih.gov/29563501" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96AP4-1", "protein_name": "Zinc finger-containing ubiquitin peptidase 1", "gene_name": "ZUP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 360, "end_pos": 360, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29563501", "url": "https://pubmed.ncbi.nlm.nih.gov/29563501" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" }, { "database": "PubMed", "id": "29576528", "url": "https://pubmed.ncbi.nlm.nih.gov/29576528" }, { "database": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 491, "end_pos": 491, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29563501", "url": "https://pubmed.ncbi.nlm.nih.gov/29563501" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" }, { "database": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" } ], "uniprot_canonical_ac": "Q96AP4-1" } ], "record_id": "pubmed.29563501", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Discovery and Characterization of ZUFSP/ZUP1, a Distinct Deubiquitinase Class Important for Genome Stability.", "journal": "Molecular cell", "date": "2018", "authors": "Kwasna D, Abdul Rehman SA, Natarajan J, Matthews S, Madden R, De Cesare V, Weidlich S, Virdee S, Ahel I, Gibbs-Seymour I, Kulathu Y", "reference": { "type": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96AP4-1", "protein_name": "Zinc finger-containing ubiquitin peptidase 1", "gene_name": "ZUP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 360, "end_pos": 360, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29563501", "url": "https://pubmed.ncbi.nlm.nih.gov/29563501" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" }, { "database": "PubMed", "id": "29576528", "url": "https://pubmed.ncbi.nlm.nih.gov/29576528" }, { "database": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 487, "end_pos": 487, "sequence_org": "Q", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 491, "end_pos": 491, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29563501", "url": "https://pubmed.ncbi.nlm.nih.gov/29563501" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" }, { "database": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" } ], "uniprot_canonical_ac": "Q96AP4-1" }, { "start_pos": 512, "end_pos": 512, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" } ], "uniprot_canonical_ac": "Q96AP4-1" } ], "record_id": "pubmed.29576527", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZUFSP Deubiquitylates K63-Linked Polyubiquitin Chains to Promote Genome Stability.", "journal": "Molecular cell", "date": "2018", "authors": "Haahr P, Borgermann N, Guo X, Typas D, Achuthankutty D, Hoffmann S, Shearer R, Sixma TK, Mailand N", "reference": { "type": "PubMed", "id": "29576528", "url": "https://pubmed.ncbi.nlm.nih.gov/29576528" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96AP4-1", "protein_name": "Zinc finger-containing ubiquitin peptidase 1", "gene_name": "ZUP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 360, "end_pos": 360, "sequence_org": "C", "sequence_mut": "A", "comment": "Loss of catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" }, { "database": "PubMed", "id": "29563501", "url": "https://pubmed.ncbi.nlm.nih.gov/29563501" }, { "database": "PubMed", "id": "29476094", "url": "https://pubmed.ncbi.nlm.nih.gov/29476094" }, { "database": "PubMed", "id": "29576528", "url": "https://pubmed.ncbi.nlm.nih.gov/29576528" }, { "database": "PubMed", "id": "29576527", "url": "https://pubmed.ncbi.nlm.nih.gov/29576527" } ], "uniprot_canonical_ac": "Q96AP4-1" } ], "record_id": "pubmed.29576528", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional Analysis of Single Nucleotide Polymorphism in ZUFSP Protein and Implication in Pathogenesis.", "journal": "The protein journal", "date": "2021", "authors": "Ajadi MB, Soremekun OS, Adewumi AT, Kumalo HM, Soliman MES", "reference": { "type": "PubMed", "id": "33512633", "url": "https://pubmed.ncbi.nlm.nih.gov/33512633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96AP4-1", "protein_name": "Zinc finger-containing ubiquitin peptidase 1", "gene_name": "ZUP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96AP4", "url": "https://www.uniprot.org/uniprotkb/Q96AP4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33512633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZnT5 variant B is a bidirectional zinc transporter and mediates zinc uptake in human intestinal Caco-2 cells.", "journal": "The Journal of biological chemistry", "date": "2007-05-11", "authors": "Valentine Ruth A, Jackson Kelly A, Christie Graham R, Mathers John C, Taylor Peter M, Ford Dianne", "reference": { "type": "PubMed", "id": "17355957", "url": "https://pubmed.ncbi.nlm.nih.gov/17355957" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TAD4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A5", "gene_name": "SLC30A5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TAD4", "url": "https://www.uniprot.org/uniprotkb/Q8TAD4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17355957", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential subcellular localization of the splice variants of the zinc transporter ZnT5 is dictated by the different C-terminal regions.", "journal": "PLoS ONE", "date": "2011", "authors": "Thornton JK, Taylor KM, Ford D, Valentine RA", "reference": { "type": "PubMed", "id": "21887337", "url": "https://pubmed.ncbi.nlm.nih.gov/21887337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TAD4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A5", "gene_name": "SLC30A5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TAD4", "url": "https://www.uniprot.org/uniprotkb/Q8TAD4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21887337", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Histidine pairing at the metal transport site of mammalian ZnT transporters controls Zn2+ over Cd2+ selectivity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Hoch E, Lin W, Chai J, Hershfinkel M, Fu D, Sekler I", "reference": { "type": "PubMed", "id": "22529353", "url": "https://pubmed.ncbi.nlm.nih.gov/22529353" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TAD4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A5", "gene_name": "SLC30A5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TAD4", "url": "https://www.uniprot.org/uniprotkb/Q8TAD4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 451, "end_pos": 451, "sequence_org": "H", "sequence_mut": "D", "comment": "No effect on zinc ion transmembrane transporter activity. No effect on zinc ion import into Golgi. Loss of specificity for zinc ions as it can also transport cadmium ions.", "evidence": [ { "database": "UniProtKB", "id": "Q8TAD4", "url": "https://www.uniprot.org/uniprotkb/Q8TAD4" }, { "database": "PubMed", "id": "22529353", "url": "https://pubmed.ncbi.nlm.nih.gov/22529353" } ], "uniprot_canonical_ac": "Q8TAD4-1" } ], "record_id": "pubmed.22529353", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bi-allelic loss of function variants in SLC30A5 as cause of perinatal lethal cardiomyopathy.", "journal": "European journal of human genetics : EJHG", "date": "2021", "authors": "Lieberwirth JK, Joset P, Heinze A, Hentschel J, Stein A, Iannaccone A, Steindl K, Kuechler A, Abou Jamra R", "reference": { "type": "PubMed", "id": "33547425", "url": "https://pubmed.ncbi.nlm.nih.gov/33547425" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8TAD4-1", "protein_name": "Proton-coupled zinc antiporter SLC30A5", "gene_name": "SLC30A5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8TAD4", "url": "https://www.uniprot.org/uniprotkb/Q8TAD4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33547425", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Case-control study and transmission disequilibrium test provide consistent evidence for association between schizophrenia and genetic variation in the 22q11 gene ZDHHC8.", "journal": "Hum. Mol. Genet.", "date": "2004", "authors": "Chen WY, Shi YY, Zheng YL, Zhao XZ, Zhang GJ, Chen SQ, Yang PD, He L", "reference": { "type": "PubMed", "id": "15489219", "url": "https://pubmed.ncbi.nlm.nih.gov/15489219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ULC8-1", "protein_name": "Palmitoyltransferase ZDHHC8", "gene_name": "ZDHHC8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9ULC8", "url": "https://www.uniprot.org/uniprotkb/Q9ULC8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15489219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "No association was found between a functional SNP in ZDHHC8 and schizophrenia in a Japanese case-control population.", "journal": "Neurosci. Lett.", "date": "2005", "authors": "Saito S, Ikeda M, Iwata N, Suzuki T, Kitajima T, Yamanouchi Y, Kinoshita Y, Takahashi N, Inada T, Ozaki N", "reference": { "type": "PubMed", "id": "15631889", "url": "https://pubmed.ncbi.nlm.nih.gov/15631889" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ULC8-1", "protein_name": "Palmitoyltransferase ZDHHC8", "gene_name": "ZDHHC8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9ULC8", "url": "https://www.uniprot.org/uniprotkb/Q9ULC8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15631889", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "No association between the putative functional ZDHHC8 single nucleotide polymorphism rs175174 and schizophrenia in large European samples.", "journal": "Biol. Psychiatry", "date": "2005", "authors": "Glaser B, Schumacher J, Williams HJ, Jamra RA, Ianakiev N, Milev R, Ohlraun S, Schulze TG, Czerski PM, Hauser J, Jonsson EG, Sedvall GC, Klopp N, Illig T, Becker T, Propping P, Williams NM, Cichon S, Kirov G, Rietschel M, Murphy KC, O'Donovan MC, Nothen MM, Owen MJ", "reference": { "type": "PubMed", "id": "15992527", "url": "https://pubmed.ncbi.nlm.nih.gov/15992527" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ULC8-1", "protein_name": "Palmitoyltransferase ZDHHC8", "gene_name": "ZDHHC8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9ULC8", "url": "https://www.uniprot.org/uniprotkb/Q9ULC8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15992527", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ZDHHC8 gene did not associate with bipolar disorder or schizophrenia.", "journal": "Neurosci. Lett.", "date": "2005", "authors": "Otani K, Ujike H, Tanaka Y, Morita Y, Kishimoto M, Morio A, Uchida N, Nomura A, Kuroda S", "reference": { "type": "PubMed", "id": "16150541", "url": "https://pubmed.ncbi.nlm.nih.gov/16150541" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ULC8-1", "protein_name": "Palmitoyltransferase ZDHHC8", "gene_name": "ZDHHC8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9ULC8", "url": "https://www.uniprot.org/uniprotkb/Q9ULC8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16150541", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lack of association between COMT Val158Met and ZDHHC8 rs175174 polymorphisms and susceptibility to schizophrenia in a Brazilian population.", "journal": "Psychiatric genetics", "date": "2017", "authors": "Moraes LS, Santos ACC, Ferreira-Fernandes H, Yoshioka FKN, Teixeira SS, Guimaraes AC, da Rocha CAM, Rey JA, Pinto GR, Burbano RR", "reference": { "type": "PubMed", "id": "28562378", "url": "https://pubmed.ncbi.nlm.nih.gov/28562378" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ULC8-1", "protein_name": "Palmitoyltransferase ZDHHC8", "gene_name": "ZDHHC8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9ULC8", "url": "https://www.uniprot.org/uniprotkb/Q9ULC8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28562378", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AMPK\u03b11-mediated ZDHHC8 phosphorylation promotes the palmitoylation of SLC7A11 to facilitate ferroptosis resistance in glioblastoma.", "journal": "Cancer letters", "date": "2024-03-01", "authors": "Wang Zhangjie, Wang Yang, Shen Na, Liu Yu, Xu Xinyang, Zhu Ruiqiu, Jiang Hao, Wu Xiaoting, Wei Yunfei, Tang Jingyuan", "reference": { "type": "PubMed", "id": "38211651", "url": "https://pubmed.ncbi.nlm.nih.gov/38211651" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9ULC8-1", "protein_name": "Palmitoyltransferase ZDHHC8", "gene_name": "ZDHHC8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9ULC8", "url": "https://www.uniprot.org/uniprotkb/Q9ULC8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38211651", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Silencing of ZNF610 suppresses cell proliferation and migration in lung adenocarcinoma.", "journal": "Cell biochemistry and function", "date": "2024-06", "authors": "Shi Ye, Cui Weiming, Xi Lei, Liu Feng, Liu Zicheng, Jiang Jie, Liu Zhengcheng, Cao Hui", "reference": { "type": "PubMed", "id": "38898665", "url": "https://pubmed.ncbi.nlm.nih.gov/38898665" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N9Z0-1", "protein_name": "Zinc finger protein 610", "gene_name": "ZNF610", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N9Z0", "url": "https://www.uniprot.org/uniprotkb/Q8N9Z0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38898665", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of calcium signalling and phosphorylations in disruption of the epithelial junctions by Pseudomonas aeruginosa quorum sensing molecule.", "journal": "Eur. J. Cell Biol.", "date": "2010", "authors": "Vikstr\u00f6m Elena, Bui Lan, Konradsson Peter, Magnusson Karl-Eric", "reference": { "type": "PubMed", "id": "20434232", "url": "https://pubmed.ncbi.nlm.nih.gov/20434232" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95049-1", "protein_name": "Tight junction protein ZO-3", "gene_name": "TJP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95049", "url": "https://www.uniprot.org/uniprotkb/O95049" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20434232", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Staphylococcus aureus alpha-toxin perturbs the barrier function in Caco-2 epithelial cell monolayers by altering junctional integrity.", "journal": "Infect. Immun.", "date": "2012", "authors": "Kwak Young-Keun, Vikstr\u00f6m Elena, Magnusson Karl-Eric, V\u00e9csey-Semj\u00e9n Beatrix, Colque-Navarro Patricia, M\u00f6llby Roland", "reference": { "type": "PubMed", "id": "22354024", "url": "https://pubmed.ncbi.nlm.nih.gov/22354024" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95049-1", "protein_name": "Tight junction protein ZO-3", "gene_name": "TJP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95049", "url": "https://www.uniprot.org/uniprotkb/O95049" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22354024", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Delineation of the key aspects in the regulation of epithelial monolayer formation.", "journal": "Mol. Cell. Biol.", "date": "2013", "authors": "Aschauer Lydia, Gruber Leonhard N, Pfaller Walter, Limonciel Alice, Athersuch Toby J, Cavill Rachel, Khan Abdulhameed, Gstraunthaler Gerhard, Grillari Johannes, Grillari Regina, Hewitt Philip, Leonard Martin O, Wilmes Anja, Jennings Paul", "reference": { "type": "PubMed", "id": "23608536", "url": "https://pubmed.ncbi.nlm.nih.gov/23608536" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95049-1", "protein_name": "Tight junction protein ZO-3", "gene_name": "TJP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95049", "url": "https://www.uniprot.org/uniprotkb/O95049" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23608536", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Curcumin prevents leptin-induced tight junction dysfunction in intestinal Caco-2 BBe cells.", "journal": "J. Nutr. Biochem.", "date": "2014", "authors": "Kim Choon Young, Kim Kee-Hong", "reference": { "type": "PubMed", "id": "24314862", "url": "https://pubmed.ncbi.nlm.nih.gov/24314862" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95049-1", "protein_name": "Tight junction protein ZO-3", "gene_name": "TJP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95049", "url": "https://www.uniprot.org/uniprotkb/O95049" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24314862", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Study of cross talk between phosphatases and OGA on a ZO-3-derived peptide.", "journal": "Amino acids", "date": "2019", "authors": "Sharif S, Shi J, Ruijtenbeek R, Pieters RJ", "reference": { "type": "PubMed", "id": "30725225", "url": "https://pubmed.ncbi.nlm.nih.gov/30725225" }, "referenced_glycans": [ { "glytoucan_ac": "G49108TO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "O95049-1", "protein_name": "Tight junction protein ZO-3", "gene_name": "TJP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95049", "url": "https://www.uniprot.org/uniprotkb/O95049" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "icn3d_view": {}, "start_pos": 369, "start_aa": "Ser", "end_pos": 369, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser369", "evidence": [ { "id": "28580691", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/28580691" }, { "id": "O95049", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O95049" }, { "id": "30725225", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/30725225" }, { "id": "O95049", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O95049" } ], "filter_code": "000000000000000100000.xxxxxxx.00000001000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "O95049-1" } ], "record_id": "pubmed.30725225", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Long noncoding RNA NEAT1 promotes ovarian cancer cell invasion and migration by interacting with miR1321 and regulating tight junction protein 3 expression.", "journal": "Molecular medicine reports", "date": "2020", "authors": "Luo M, Zhang L, Yang H, Luo K, Qing C", "reference": { "type": "PubMed", "id": "32945443", "url": "https://pubmed.ncbi.nlm.nih.gov/32945443" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95049-1", "protein_name": "Tight junction protein ZO-3", "gene_name": "TJP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95049", "url": "https://www.uniprot.org/uniprotkb/O95049" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32945443", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TJP3 promotes T cell immunity escape and chemoresistance in breast cancer: a comprehensive analysis of anoikis-based prognosis prediction and drug sensitivity stratification.", "journal": "Aging", "date": "2023-11-10", "authors": "Chaojun Liu, Pengping Li, Yanjun Li, Fangyuan Zhu, Yaning He, Yingbo Shao, Qi Chen, Hui Liu", "reference": { "type": "PubMed", "id": "37950731", "url": "https://pubmed.ncbi.nlm.nih.gov/37950731" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O95049-1", "protein_name": "Tight junction protein ZO-3", "gene_name": "TJP3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O95049", "url": "https://www.uniprot.org/uniprotkb/O95049" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37950731", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZNF598 Plays Distinct Roles in Interferon-Stimulated Gene Expression and Poxvirus Protein Synthesis.", "journal": "Cell reports", "date": "2018", "authors": "DiGiuseppe S, Rollins MG, Bartom ET, Walsh D", "reference": { "type": "PubMed", "id": "29719242", "url": "https://pubmed.ncbi.nlm.nih.gov/29719242" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UK7-1", "protein_name": "E3 ubiquitin-protein ligase ZNF598", "gene_name": "ZNF598", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UK7", "url": "https://www.uniprot.org/uniprotkb/Q86UK7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29719242", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Live-cell imaging reveals kinetic determinants of quality control triggered by ribosome stalling.", "journal": "Molecular cell", "date": "2021-04-15", "authors": "Goldman Daniel H, Livingston Nathan M, Movsik Jonathan, Wu Bin, Green Rachel", "reference": { "type": "PubMed", "id": "33581075", "url": "https://pubmed.ncbi.nlm.nih.gov/33581075" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UK7-1", "protein_name": "E3 ubiquitin-protein ligase ZNF598", "gene_name": "ZNF598", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UK7", "url": "https://www.uniprot.org/uniprotkb/Q86UK7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33581075", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZNF598 co-translationally titrates poly(GR) protein implicated in the pathogenesis of C9ORF72-associated ALS/FTD.", "journal": "Nucleic acids research", "date": "2021", "authors": "Park J, Lee J, Kim JH, Lee J, Park H, Lim C", "reference": { "type": "PubMed", "id": "34551427", "url": "https://pubmed.ncbi.nlm.nih.gov/34551427" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UK7-1", "protein_name": "E3 ubiquitin-protein ligase ZNF598", "gene_name": "ZNF598", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UK7", "url": "https://www.uniprot.org/uniprotkb/Q86UK7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34551427", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zinc finger protein 598 promotes HIV-1 replication and latent reactivation by stabilizing the expression of viral trans-activator of transcription Tat.", "journal": "International journal of biological macromolecules", "date": "2026-03-10", "authors": "Shi Hongyun, Hou Yubao, Wang Huihan, Huan Chen, Wang Yingchao, Wang Hong, Zhang Wenyan", "reference": { "type": "PubMed", "id": "41819311", "url": "https://pubmed.ncbi.nlm.nih.gov/41819311" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86UK7-1", "protein_name": "E3 ubiquitin-protein ligase ZNF598", "gene_name": "ZNF598", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86UK7", "url": "https://www.uniprot.org/uniprotkb/Q86UK7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 29, "end_pos": 29, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes E3 ubiquitin-protein ligase activity, leading to enhanced readthrough on the poly(A)-stall sequences.", "evidence": [ { "database": "UniProtKB", "id": "Q86UK7", "url": "https://www.uniprot.org/uniprotkb/Q86UK7" }, { "database": "PubMed", "id": "28132843", "url": "https://pubmed.ncbi.nlm.nih.gov/28132843" }, { "database": "PubMed", "id": "41819311", "url": "https://pubmed.ncbi.nlm.nih.gov/41819311" } ], "uniprot_canonical_ac": "Q86UK7-1" } ], "record_id": "pubmed.41819311", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zinc Finger 280B regulates sGCalpha1 and p53 in prostate cancer cells.", "journal": "PloS one", "date": "2013", "authors": "Gao S, Hsieh CL, Zhou J, Shemshedini L", "reference": { "type": "PubMed", "id": "24236047", "url": "https://pubmed.ncbi.nlm.nih.gov/24236047" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86YH2-1", "protein_name": "Zinc finger protein 280B", "gene_name": "ZNF280B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86YH2", "url": "https://www.uniprot.org/uniprotkb/Q86YH2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24236047", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZNF280A promotes lung adenocarcinoma development by regulating the expression of EIF3C.", "journal": "Cell death & disease", "date": "2021", "authors": "Liu H, Qin Y, Zhou N, Ma D, Wang Y", "reference": { "type": "PubMed", "id": "33414445", "url": "https://pubmed.ncbi.nlm.nih.gov/33414445" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P59817-1", "protein_name": "Zinc finger protein 280A", "gene_name": "ZNF280A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99613-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit C", "gene_name": "EIF3C", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P59817", "url": "https://www.uniprot.org/uniprotkb/P59817" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33414445", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Knockdown of ZNF280A inhibits cell proliferation and promotes cell apoptosis of bladder cancer.", "journal": "Histology and histopathology", "date": "2024-03", "authors": "He Long, Wang Xialu, Chen Peng, Du Cheng, Li Jinjiang", "reference": { "type": "PubMed", "id": "37345848", "url": "https://pubmed.ncbi.nlm.nih.gov/37345848" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P59817-1", "protein_name": "Zinc finger protein 280A", "gene_name": "ZNF280A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P59817", "url": "https://www.uniprot.org/uniprotkb/P59817" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37345848", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein Z-dependent protease inhibitor is a serpin.", "journal": "Biochemistry", "date": "1999", "authors": "Han X, Huang ZF, Fiehler R, Broze GJ Jr", "reference": { "type": "PubMed", "id": "10460162", "url": "https://pubmed.ncbi.nlm.nih.gov/10460162" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UK55-1", "protein_name": "Protein Z-dependent protease inhibitor", "gene_name": "SERPINA10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UK55", "url": "https://www.uniprot.org/uniprotkb/Q9UK55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 408, "end_pos": 408, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of inhibitory activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9UK55", "url": "https://www.uniprot.org/uniprotkb/Q9UK55" }, { "database": "PubMed", "id": "10460162", "url": "https://pubmed.ncbi.nlm.nih.gov/10460162" } ], "uniprot_canonical_ac": "Q9UK55-1" } ], "record_id": "pubmed.10460162", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the protein Z-dependent protease inhibitor.", "journal": "Blood", "date": "2000-11-01", "authors": "Han X, Fiehler R, Broze G J", "reference": { "type": "PubMed", "id": "11049983", "url": "https://pubmed.ncbi.nlm.nih.gov/11049983" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UK55-1", "protein_name": "Protein Z-dependent protease inhibitor", "gene_name": "SERPINA10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UK55", "url": "https://www.uniprot.org/uniprotkb/Q9UK55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11049983", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of protein Z-dependent inhibitor complex shows how protein Z functions as a cofactor in the membrane inhibition of factor X.", "journal": "Blood", "date": "2009", "authors": "Wei Z, Yan Y, Carrell RW, Zhou A", "reference": { "type": "PubMed", "id": "19528533", "url": "https://pubmed.ncbi.nlm.nih.gov/19528533" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UK55-1", "protein_name": "Protein Z-dependent protease inhibitor", "gene_name": "SERPINA10", "tax_name": "Human" }, { "uniprot_canonical_ac": "P22891-1", "protein_name": "Vitamin K-dependent protein Z", "gene_name": "PROZ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UK55", "url": "https://www.uniprot.org/uniprotkb/Q9UK55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=3F1S&bu=0&command=select+.B:193;+center+selection;+zoom+selection" }, "start_pos": 233, "start_aa": "Asn", "end_pos": 233, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn233", "evidence": [ { "id": "P22891", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P22891#ptm_processing" }, { "id": "19528533", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19528533" }, { "id": "20427285", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20427285" }, { "id": "3F1S", "database": "PDB", "url": "https://www.rcsb.org/structure/3F1S" }, { "id": "3H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/3H5C" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "P22891-1" } ], "record_id": "pubmed.19528533", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the heparin-binding site of the protein z-dependent protease inhibitor.", "journal": "Biochemistry", "date": "2012", "authors": "Yang Likui, Ding Qiulan, Huang Xin, Olson Steven T, Rezaie Alireza R", "reference": { "type": "PubMed", "id": "22540147", "url": "https://pubmed.ncbi.nlm.nih.gov/22540147" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UK55-1", "protein_name": "Protein Z-dependent protease inhibitor", "gene_name": "SERPINA10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UK55", "url": "https://www.uniprot.org/uniprotkb/Q9UK55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22540147", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plasma concentration of protein Z-dependent protease inhibitor and ZPI exon 3 mutations in preeclampsia.", "journal": "Journal of obstetrics and gynaecology : the journal of the Institute of Obstetrics and Gynaecology", "date": "2021", "authors": "Zhang P, Li YC, Li L, Lu Y", "reference": { "type": "PubMed", "id": "33427552", "url": "https://pubmed.ncbi.nlm.nih.gov/33427552" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UK55-1", "protein_name": "Protein Z-dependent protease inhibitor", "gene_name": "SERPINA10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UK55", "url": "https://www.uniprot.org/uniprotkb/Q9UK55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33427552", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Heparin activation of protein Z-dependent protease inhibitor (ZPI) allosterically blocks protein Z activation through an extended heparin-binding site.", "journal": "The Journal of biological chemistry", "date": "2022", "authors": "Huang X, Swanson R, Olson ST", "reference": { "type": "PubMed", "id": "35551912", "url": "https://pubmed.ncbi.nlm.nih.gov/35551912" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UK55-1", "protein_name": "Protein Z-dependent protease inhibitor", "gene_name": "SERPINA10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UK55", "url": "https://www.uniprot.org/uniprotkb/Q9UK55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35551912", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation of a protein Z-dependent plasma protease inhibitor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Han X, Fiehler R, Broze GJ Jr", "reference": { "type": "PubMed", "id": "9689066", "url": "https://pubmed.ncbi.nlm.nih.gov/9689066" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UK55-1", "protein_name": "Protein Z-dependent protease inhibitor", "gene_name": "SERPINA10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UK55", "url": "https://www.uniprot.org/uniprotkb/Q9UK55" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9689066", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cancer cells escape p53's tumor suppression through ablation of ZDHHC1-mediated p53 palmitoylation.", "journal": "Oncogene", "date": "2021-09", "authors": "Tang Jun, Peng Weiyan, Feng Yixiao, Le Xin, Wang Kang, Xiang Qin, Li Lili, Wang Yan, Xu Can, Mu Junhao, Xu Ke, Ji Ping, Tao Qian, Huang Ailong, Deng Chu-Xia, Lin Yong, Xiang Tingxiu", "reference": { "type": "PubMed", "id": "34282274", "url": "https://pubmed.ncbi.nlm.nih.gov/34282274" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WTX9-1", "protein_name": "Palmitoyltransferase ZDHHC1", "gene_name": "ZDHHC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WTX9", "url": "https://www.uniprot.org/uniprotkb/Q8WTX9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34282274", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Nucleotide sequence and cell cycle-associated differential expression of ZF5128, a novel Kruppel type zinc finger protein gene.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Rue SW, Kim BW, Jun DY, Kim YH", "reference": { "type": "PubMed", "id": "11779640", "url": "https://pubmed.ncbi.nlm.nih.gov/11779640" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75467-1", "protein_name": "Zinc finger protein 324A", "gene_name": "ZNF324", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75467", "url": "https://www.uniprot.org/uniprotkb/O75467" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11779640", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biological functions of miRNA-203b-3p/ZNF324 in laryngeal carcinoma.", "journal": "Cellular and molecular biology (Noisy-le-Grand, France)", "date": "2023-12-20", "authors": "Wang Liping, Luo Xianyang", "reference": { "type": "PubMed", "id": "38279443", "url": "https://pubmed.ncbi.nlm.nih.gov/38279443" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75467-1", "protein_name": "Zinc finger protein 324A", "gene_name": "ZNF324", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75467", "url": "https://www.uniprot.org/uniprotkb/O75467" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38279443", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic localization, organization and amplification of the human zinc transporter protein gene, ZNT4, and exclusion as a candidate gene in different clinical variants of acrodermatitis enteropathica.", "journal": "Archives of dermatological research", "date": "2001", "authors": "Bleck O, Ashton GH, Mallipeddi R, South AP, Whittock NV, McLean WH, Atherton DJ, McGrath JA", "reference": { "type": "PubMed", "id": "11686514", "url": "https://pubmed.ncbi.nlm.nih.gov/11686514" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14863-1", "protein_name": "Probable proton-coupled zinc antiporter SLC30A4", "gene_name": "SLC30A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14863", "url": "https://www.uniprot.org/uniprotkb/O14863" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11686514", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZNT4 gene is not responsible for acrodermatitis enteropathica in Japanese families.", "journal": "Human genetics", "date": "2002", "authors": "Nakano A, Nakano H, Hanada K, Nomura K, Uitto J", "reference": { "type": "PubMed", "id": "11935329", "url": "https://pubmed.ncbi.nlm.nih.gov/11935329" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14863-1", "protein_name": "Probable proton-coupled zinc antiporter SLC30A4", "gene_name": "SLC30A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14863", "url": "https://www.uniprot.org/uniprotkb/O14863" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11935329", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zinc transporters protein level in postmortem brain of depressed subjects and suicide victims.", "journal": "Journal of psychiatric research", "date": "2016", "authors": "Rafalo-Ulinska A, Piotrowska J, Kryczyk A, Opoka W, Sowa-Kucma M, Misztak P, Rajkowska G, Stockmeier CA, Datka W, Nowak G, Szewczyk B", "reference": { "type": "PubMed", "id": "27661418", "url": "https://pubmed.ncbi.nlm.nih.gov/27661418" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14863-1", "protein_name": "Probable proton-coupled zinc antiporter SLC30A4", "gene_name": "SLC30A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14863", "url": "https://www.uniprot.org/uniprotkb/O14863" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27661418", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Roles of ZnT1 and ZnT4 in Glucose-Stimulated Zinc Secretion in Prostate Epithelial Cells.", "journal": "Molecular imaging and biology", "date": "2021", "authors": "Lo ST, Parrott D, Jordan MVC, Joseph DB, Strand D, Lo UG, Lin H, Darehshouri A, Sherry AD", "reference": { "type": "PubMed", "id": "33140261", "url": "https://pubmed.ncbi.nlm.nih.gov/33140261" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O14863-1", "protein_name": "Probable proton-coupled zinc antiporter SLC30A4", "gene_name": "SLC30A4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14863", "url": "https://www.uniprot.org/uniprotkb/O14863" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33140261", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "cDNA isolation, expression analysis, and chromosomal localization of two human zinc finger genes.", "journal": "Genomics", "date": "1990", "authors": "Lania L, Donti E, Pannuti A, Pascucci A, Pengue G, Feliciello I, La Mantia G, Lanfrancone L, Pelicci P G", "reference": { "type": "PubMed", "id": "2106481", "url": "https://pubmed.ncbi.nlm.nih.gov/2106481" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17098-1", "protein_name": "Zinc finger protein 8", "gene_name": "ZNF8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P17097-1", "protein_name": "Zinc finger protein 7", "gene_name": "ZNF7", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17098", "url": "https://www.uniprot.org/uniprotkb/P17098" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2106481", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZNF8-miR-552-5p Axis Modulates ACSL4-Mediated Ferroptosis in Hepatocellular Carcinoma.", "journal": "DNA and cell biology", "date": "2023-04-26", "authors": "Yang Hao, Sun Wensheng, Bi Tao, Sun Jiahao, Lu Zhihua, Li Jie, Wei Honglong", "reference": { "type": "PubMed", "id": "37126948", "url": "https://pubmed.ncbi.nlm.nih.gov/37126948" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17098-1", "protein_name": "Zinc finger protein 8", "gene_name": "ZNF8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17098", "url": "https://www.uniprot.org/uniprotkb/P17098" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37126948", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZNF8 promotes progression of gastrointestinal cancers via a p53-dependent mechanism.", "journal": "Cellular signalling", "date": "2024-11", "authors": "Zhang Yiming, Yang Yingchuan, Hou Yushan, Yan Wei, Zhang Xiuyuan, Huang Xiaofen, Song Qin, He Fuchu, Wang Jian, Sun Aihua, Tian Chunyan", "reference": { "type": "PubMed", "id": "39173856", "url": "https://pubmed.ncbi.nlm.nih.gov/39173856" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P17098-1", "protein_name": "Zinc finger protein 8", "gene_name": "ZNF8", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P17098", "url": "https://www.uniprot.org/uniprotkb/P17098" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39173856", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The homeostatic function of Regnase-2 restricts neuroinflammation.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2023-03", "authors": "Sowinska Weronika, Wawro Mateusz, Biswas Debolina D, Kochan Jakub, Pustelny Katarzyna, Solecka Aleksandra, Gupta Angela S, Mockenhaupt Karli, Polak Jaros\u0142aw, Kwinta Borys, Kordula Tomasz, Kasza Aneta", "reference": { "type": "PubMed", "id": "36753401", "url": "https://pubmed.ncbi.nlm.nih.gov/36753401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q5HYM0-1", "protein_name": "Probable ribonuclease ZC3H12B", "gene_name": "ZC3H12B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q5HYM0", "url": "https://www.uniprot.org/uniprotkb/Q5HYM0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36753401", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for shieldin complex subunit 3-mediated recruitment of the checkpoint protein REV7 during DNA double-strand break repair.", "journal": "The Journal of biological chemistry", "date": "2020", "authors": "Dai Y, Zhang F, Wang L, Shan S, Gong Z, Zhou Z", "reference": { "type": "PubMed", "id": "31796627", "url": "https://pubmed.ncbi.nlm.nih.gov/31796627" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q6ZNX1-1", "protein_name": "Shieldin complex subunit 3", "gene_name": "SHLD3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q6ZNX1", "url": "https://www.uniprot.org/uniprotkb/Q6ZNX1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31796627", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The palmitoyltransferase ZDHHC21 regulates oxidative phosphorylation to induce differentiation block and stemness in AML.", "journal": "Blood", "date": "2023-07-27", "authors": "Shao Xuejing, Xu Aixiao, Du Wenxin, Xu Tong, Huang Yunpeng, Xia Zhimei, Wang Wei, Cai Minyi, Zhang Xingya, Zhang Jianhua, Cao Ji, Xu Xiaojun, Yang Bo, He Qiaojun, Ying Meidan", "reference": { "type": "PubMed", "id": "37216691", "url": "https://pubmed.ncbi.nlm.nih.gov/37216691" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IVQ6-1", "protein_name": "Palmitoyltransferase ZDHHC21", "gene_name": "ZDHHC21", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IVQ6", "url": "https://www.uniprot.org/uniprotkb/Q8IVQ6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37216691", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Combining a glycolysis\u2011related prognostic model based on scRNA\u2011Seq with experimental verification identifies ZFP41 as a potential prognostic biomarker for HCC.", "journal": "Molecular medicine reports", "date": "2024-05", "authors": "Teng Yu, Xu Jianrong, Wang Yaoqun, Wen Ningyuan, Ye Hui, Li Bei", "reference": { "type": "PubMed", "id": "38516783", "url": "https://pubmed.ncbi.nlm.nih.gov/38516783" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8N8Y5-1", "protein_name": "Zinc finger protein 41 homolog", "gene_name": "ZFP41", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8N8Y5", "url": "https://www.uniprot.org/uniprotkb/Q8N8Y5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38516783", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Palmitoylation of R-Ras by human DHHC19, a palmitoyl transferase with a CaaX box.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Baumgart F, Corral-Escariz M, Perez-Gil J, Rodriguez-Crespo I", "reference": { "type": "PubMed", "id": "20074548", "url": "https://pubmed.ncbi.nlm.nih.gov/20074548" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WVZ1-1", "protein_name": "Palmitoyltransferase ZDHHC19", "gene_name": "ZDHHC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10301-1", "protein_name": "Ras-related protein R-Ras", "gene_name": "RRAS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WVZ1", "url": "https://www.uniprot.org/uniprotkb/Q8WVZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 142, "end_pos": 142, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes palmitoyltransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8WVZ1", "url": "https://www.uniprot.org/uniprotkb/Q8WVZ1" }, { "database": "PubMed", "id": "20074548", "url": "https://pubmed.ncbi.nlm.nih.gov/20074548" }, { "database": "PubMed", "id": "37802024", "url": "https://pubmed.ncbi.nlm.nih.gov/37802024" } ], "uniprot_canonical_ac": "Q8WVZ1-1" } ], "record_id": "pubmed.20074548", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fatty acids and cancer-amplified ZDHHC19 promote STAT3 activation through S-palmitoylation.", "journal": "Nature", "date": "2019", "authors": "Niu Jixiao, Sun Yang, Chen Baoen, Zheng Baohui, Jarugumilli Gopala K, Walker Sarah R, Hata Aaron N, Mino-Kenudson Mari, Frank David A, Wu Xu", "reference": { "type": "PubMed", "id": "31462771", "url": "https://pubmed.ncbi.nlm.nih.gov/31462771" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WVZ1-1", "protein_name": "Palmitoyltransferase ZDHHC19", "gene_name": "ZDHHC19", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62993-1", "protein_name": "Growth factor receptor-bound protein 2", "gene_name": "GRB2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WVZ1", "url": "https://www.uniprot.org/uniprotkb/Q8WVZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31462771", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zinc finger Asp-His-His-Cys palmitoyl -acyltransferase 19 accelerates tumor progression through wnt/beta-catenin pathway and is upregulated by miR-940 in osteosarcoma.", "journal": "Bioengineered", "date": "2022", "authors": "Liang S, Zhang X, Li J", "reference": { "type": "PubMed", "id": "35297315", "url": "https://pubmed.ncbi.nlm.nih.gov/35297315" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WVZ1-1", "protein_name": "Palmitoyltransferase ZDHHC19", "gene_name": "ZDHHC19", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WVZ1", "url": "https://www.uniprot.org/uniprotkb/Q8WVZ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35297315", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "E3 Ubiquitin ligase ZNRF4 negatively regulates NOD2 signalling and induces tolerance to MDP.", "journal": "Nature communications", "date": "2017", "authors": "Bist P, Cheong WS, Ng A, Dikshit N, Kim BH, Pulloor NK, Khameneh HJ, Hedl M, Shenoy AR, Balamuralidhar V, Malik NBA, Hong M, Neutzner A, Chin KC, Kobayashi KS, Bertoletti A, Mortellaro A, Abraham C, MacMicking JD, Xavier RJ, Sukumaran B", "reference": { "type": "PubMed", "id": "28656966", "url": "https://pubmed.ncbi.nlm.nih.gov/28656966" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8WWF5-1", "protein_name": "E3 ubiquitin-protein ligase ZNRF4", "gene_name": "ZNRF4", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43353-1", "protein_name": "Receptor-interacting serine/threonine-protein kinase 2", "gene_name": "RIPK2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8WWF5", "url": "https://www.uniprot.org/uniprotkb/Q8WWF5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 329, "end_pos": 332, "sequence_org": "HTYH", "sequence_mut": "WTYW", "comment": "Abolished E3 ubiquitin-protein ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q8WWF5", "url": "https://www.uniprot.org/uniprotkb/Q8WWF5" }, { "database": "PubMed", "id": "21205830", "url": "https://pubmed.ncbi.nlm.nih.gov/21205830" }, { "database": "PubMed", "id": "28656966", "url": "https://pubmed.ncbi.nlm.nih.gov/28656966" } ], "uniprot_canonical_ac": "Q8WWF5-1" }, { "start_pos": 503, "end_pos": 503, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolished ubiquitination by ZNRF4.", "evidence": [ { "database": "UniProtKB", "id": "O43353", "url": "https://www.uniprot.org/uniprotkb/O43353" }, { "database": "PubMed", "id": "28656966", "url": "https://pubmed.ncbi.nlm.nih.gov/28656966" } ], "uniprot_canonical_ac": "O43353-1" } ], "record_id": "pubmed.28656966", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of ZDHHC15 expression in a woman with a balanced translocation t(X;15)(q13.3;cen) and severe mental retardation.", "journal": "Eur. J. Hum. Genet.", "date": "2005", "authors": "Mansouri MR, Marklund L, Gustavsson P, Davey E, Carlsson B, Larsson C, White I, Gustavson KH, Dahl N", "reference": { "type": "PubMed", "id": "15915161", "url": "https://pubmed.ncbi.nlm.nih.gov/15915161" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MV8-1", "protein_name": "Palmitoyltransferase ZDHHC15", "gene_name": "ZDHHC15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MV8", "url": "https://www.uniprot.org/uniprotkb/Q96MV8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15915161", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Local anesthetics impair the growth and self-renewal of glioblastoma stem cells by inhibiting ZDHHC15-mediated GP130 palmitoylation.", "journal": "Stem cell research & therapy", "date": "2021", "authors": "Fan X, Yang H, Zhao C, Hu L, Wang D, Wang R, Fang Z, Chen X", "reference": { "type": "PubMed", "id": "33541421", "url": "https://pubmed.ncbi.nlm.nih.gov/33541421" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MV8-1", "protein_name": "Palmitoyltransferase ZDHHC15", "gene_name": "ZDHHC15", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40763-1", "protein_name": "Signal transducer and activator of transcription 3", "gene_name": "STAT3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MV8", "url": "https://www.uniprot.org/uniprotkb/Q96MV8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 705, "end_pos": 705, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FER and PTK6", "evidence": [ { "database": "UniProtKB", "id": "P40763", "url": "https://www.uniprot.org/uniprotkb/P40763" }, { "database": "iPTMnet", "id": "P40763", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P40763" }, { "database": "PubMed", "id": "10918587", "url": "https://pubmed.ncbi.nlm.nih.gov/10918587" }, { "database": "PubMed", "id": "11294897", "url": "https://pubmed.ncbi.nlm.nih.gov/11294897" }, { "database": "PubMed", "id": "11350938", "url": "https://pubmed.ncbi.nlm.nih.gov/11350938" }, { "database": "PubMed", "id": "11940572", "url": "https://pubmed.ncbi.nlm.nih.gov/11940572" }, { "database": "PubMed", "id": "12244095", "url": "https://pubmed.ncbi.nlm.nih.gov/12244095" }, { "database": "PubMed", "id": "12576423", "url": "https://pubmed.ncbi.nlm.nih.gov/12576423" }, { "database": "PubMed", "id": "12626508", "url": "https://pubmed.ncbi.nlm.nih.gov/12626508" }, { "database": "PubMed", "id": "14551213", "url": "https://pubmed.ncbi.nlm.nih.gov/14551213" }, { "database": "PubMed", "id": "16497976", "url": "https://pubmed.ncbi.nlm.nih.gov/16497976" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "19901323", "url": "https://pubmed.ncbi.nlm.nih.gov/19901323" }, { "database": "PubMed", "id": "8626374", "url": "https://pubmed.ncbi.nlm.nih.gov/8626374" }, { "database": "IntAct", "id": "P40763", "url": "https://www.ebi.ac.uk/intact/interactors/id:P40763*" }, { "database": "PubMed", "id": "7510216", "url": "https://pubmed.ncbi.nlm.nih.gov/7510216" }, { "database": "PubMed", "id": "8662591", "url": "https://pubmed.ncbi.nlm.nih.gov/8662591" }, { "database": "PubMed", "id": "10446219", "url": "https://pubmed.ncbi.nlm.nih.gov/10446219" }, { "database": "PubMed", "id": "10537060", "url": "https://pubmed.ncbi.nlm.nih.gov/10537060" }, { "database": "PubMed", "id": "10623619", "url": "https://pubmed.ncbi.nlm.nih.gov/10623619" }, { "database": "PubMed", "id": "10660304", "url": "https://pubmed.ncbi.nlm.nih.gov/10660304" }, { "database": "PubMed", "id": "10845908", "url": "https://pubmed.ncbi.nlm.nih.gov/10845908" }, { "database": "PubMed", "id": "11278353", "url": "https://pubmed.ncbi.nlm.nih.gov/11278353" }, { "database": "PubMed", "id": "11278729", "url": "https://pubmed.ncbi.nlm.nih.gov/11278729" }, { "database": "PubMed", "id": "11322950", "url": "https://pubmed.ncbi.nlm.nih.gov/11322950" }, { "database": "PubMed", "id": "11335711", "url": "https://pubmed.ncbi.nlm.nih.gov/11335711" }, { "database": "PubMed", "id": "11378264", "url": "https://pubmed.ncbi.nlm.nih.gov/11378264" }, { "database": "PubMed", "id": "11429693", "url": "https://pubmed.ncbi.nlm.nih.gov/11429693" }, { "database": "PubMed", "id": "11470914", "url": "https://pubmed.ncbi.nlm.nih.gov/11470914" }, { "database": "PubMed", "id": "11553624", "url": "https://pubmed.ncbi.nlm.nih.gov/11553624" }, { "database": "PubMed", "id": "11777539", "url": "https://pubmed.ncbi.nlm.nih.gov/11777539" }, { "database": "PubMed", "id": "12061840", "url": "https://pubmed.ncbi.nlm.nih.gov/12061840" }, { "database": "PubMed", "id": "12208879", "url": "https://pubmed.ncbi.nlm.nih.gov/12208879" }, { "database": "PubMed", "id": "12474230", "url": "https://pubmed.ncbi.nlm.nih.gov/12474230" }, { "database": "PubMed", "id": "12494267", "url": "https://pubmed.ncbi.nlm.nih.gov/12494267" }, { "database": "PubMed", "id": "12670499", "url": "https://pubmed.ncbi.nlm.nih.gov/12670499" }, { "database": "PubMed", "id": "12763138", "url": "https://pubmed.ncbi.nlm.nih.gov/12763138" }, { "database": "PubMed", "id": "12842895", "url": "https://pubmed.ncbi.nlm.nih.gov/12842895" }, { "database": "PubMed", "id": "13678425", "url": "https://pubmed.ncbi.nlm.nih.gov/13678425" }, { "database": "PubMed", "id": "14701810", "url": "https://pubmed.ncbi.nlm.nih.gov/14701810" }, { "database": "PubMed", "id": "14963038", "url": "https://pubmed.ncbi.nlm.nih.gov/14963038" }, { "database": "PubMed", "id": "14996842", "url": "https://pubmed.ncbi.nlm.nih.gov/14996842" }, { "database": "PubMed", "id": "14999683", "url": "https://pubmed.ncbi.nlm.nih.gov/14999683" }, { "database": "PubMed", "id": "15030166", "url": "https://pubmed.ncbi.nlm.nih.gov/15030166" }, { "database": "PubMed", "id": "15143062", "url": "https://pubmed.ncbi.nlm.nih.gov/15143062" }, { "database": "PubMed", "id": "15155836", "url": "https://pubmed.ncbi.nlm.nih.gov/15155836" }, { "database": "PubMed", "id": "15173005", "url": "https://pubmed.ncbi.nlm.nih.gov/15173005" }, { "database": "PubMed", "id": "15174071", "url": "https://pubmed.ncbi.nlm.nih.gov/15174071" }, { "database": "PubMed", "id": "15320963", "url": "https://pubmed.ncbi.nlm.nih.gov/15320963" }, { "database": "PubMed", "id": "15527783", "url": "https://pubmed.ncbi.nlm.nih.gov/15527783" }, { "database": "PubMed", "id": "15705894", "url": "https://pubmed.ncbi.nlm.nih.gov/15705894" }, { "database": "PubMed", "id": "15753368", "url": "https://pubmed.ncbi.nlm.nih.gov/15753368" }, { "database": "PubMed", "id": "15864742", "url": "https://pubmed.ncbi.nlm.nih.gov/15864742" }, { "database": "PubMed", "id": "16048438", "url": "https://pubmed.ncbi.nlm.nih.gov/16048438" }, { "database": "PubMed", "id": "16081048", "url": "https://pubmed.ncbi.nlm.nih.gov/16081048" }, { "database": "PubMed", "id": "16150460", "url": "https://pubmed.ncbi.nlm.nih.gov/16150460" }, { "database": "PubMed", "id": "16247467", "url": "https://pubmed.ncbi.nlm.nih.gov/16247467" }, { "database": "PubMed", "id": "16288304", "url": "https://pubmed.ncbi.nlm.nih.gov/16288304" }, { "database": "PubMed", "id": "16384639", "url": "https://pubmed.ncbi.nlm.nih.gov/16384639" }, { "database": "PubMed", "id": "16401721", "url": "https://pubmed.ncbi.nlm.nih.gov/16401721" }, { "database": "PubMed", "id": "16413037", "url": "https://pubmed.ncbi.nlm.nih.gov/16413037" }, { "database": "PubMed", "id": "16427042", "url": "https://pubmed.ncbi.nlm.nih.gov/16427042" }, { "database": "PubMed", "id": "16455651", "url": "https://pubmed.ncbi.nlm.nih.gov/16455651" }, { "database": "PubMed", "id": "16463269", "url": "https://pubmed.ncbi.nlm.nih.gov/16463269" }, { "database": "PubMed", "id": "16603078", "url": "https://pubmed.ncbi.nlm.nih.gov/16603078" }, { "database": "PubMed", "id": "16613491", "url": "https://pubmed.ncbi.nlm.nih.gov/16613491" }, { "database": "PubMed", "id": "16619044", "url": "https://pubmed.ncbi.nlm.nih.gov/16619044" }, { "database": "PubMed", "id": "16651438", "url": "https://pubmed.ncbi.nlm.nih.gov/16651438" }, { "database": "PubMed", "id": "16669628", "url": "https://pubmed.ncbi.nlm.nih.gov/16669628" }, { "database": "PubMed", "id": "16801397", "url": "https://pubmed.ncbi.nlm.nih.gov/16801397" }, { "database": "PubMed", "id": "16846476", "url": "https://pubmed.ncbi.nlm.nih.gov/16846476" }, { "database": "PubMed", "id": "16849418", "url": "https://pubmed.ncbi.nlm.nih.gov/16849418" }, { "database": "PubMed", "id": "16951338", "url": "https://pubmed.ncbi.nlm.nih.gov/16951338" }, { "database": "PubMed", "id": "17008315", "url": "https://pubmed.ncbi.nlm.nih.gov/17008315" }, { "database": "PubMed", "id": "17173857", "url": "https://pubmed.ncbi.nlm.nih.gov/17173857" }, { "database": "PubMed", "id": "17176261", "url": "https://pubmed.ncbi.nlm.nih.gov/17176261" }, { "database": "PubMed", "id": "17202361", "url": "https://pubmed.ncbi.nlm.nih.gov/17202361" }, { "database": "PubMed", "id": "17204573", "url": "https://pubmed.ncbi.nlm.nih.gov/17204573" }, { "database": "PubMed", "id": "17237271", "url": "https://pubmed.ncbi.nlm.nih.gov/17237271" }, { "database": "PubMed", "id": "17311011", "url": "https://pubmed.ncbi.nlm.nih.gov/17311011" }, { "database": "PubMed", "id": "17341659", "url": "https://pubmed.ncbi.nlm.nih.gov/17341659" }, { "database": "PubMed", "id": "17432718", "url": "https://pubmed.ncbi.nlm.nih.gov/17432718" }, { "database": "PubMed", "id": "17543278", "url": "https://pubmed.ncbi.nlm.nih.gov/17543278" }, { "database": "PubMed", "id": "17575268", "url": "https://pubmed.ncbi.nlm.nih.gov/17575268" }, { "database": "PubMed", "id": "17586727", "url": "https://pubmed.ncbi.nlm.nih.gov/17586727" }, { "database": "PubMed", "id": "17616983", "url": "https://pubmed.ncbi.nlm.nih.gov/17616983" }, { "database": "PubMed", "id": "17670892", "url": "https://pubmed.ncbi.nlm.nih.gov/17670892" }, { "database": "PubMed", "id": "17761947", "url": "https://pubmed.ncbi.nlm.nih.gov/17761947" }, { "database": "PubMed", "id": "17931419", "url": "https://pubmed.ncbi.nlm.nih.gov/17931419" }, { "database": "PubMed", "id": "17967179", "url": "https://pubmed.ncbi.nlm.nih.gov/17967179" }, { "database": "PubMed", "id": "18196976", "url": "https://pubmed.ncbi.nlm.nih.gov/18196976" }, { "database": "PubMed", "id": "18198175", "url": "https://pubmed.ncbi.nlm.nih.gov/18198175" }, { "database": "PubMed", "id": "18203738", "url": "https://pubmed.ncbi.nlm.nih.gov/18203738" }, { "database": "PubMed", "id": "18204781", "url": "https://pubmed.ncbi.nlm.nih.gov/18204781" }, { "database": "PubMed", "id": "18353781", "url": "https://pubmed.ncbi.nlm.nih.gov/18353781" }, { "database": "PubMed", "id": "18365011", "url": "https://pubmed.ncbi.nlm.nih.gov/18365011" }, { "database": "PubMed", "id": "18463684", "url": "https://pubmed.ncbi.nlm.nih.gov/18463684" }, { "database": "PubMed", "id": "18498667", "url": "https://pubmed.ncbi.nlm.nih.gov/18498667" }, { "database": "PubMed", "id": "18519681", "url": "https://pubmed.ncbi.nlm.nih.gov/18519681" }, { "database": "PubMed", "id": "18525315", "url": "https://pubmed.ncbi.nlm.nih.gov/18525315" }, { "database": "PubMed", "id": "18544087", "url": "https://pubmed.ncbi.nlm.nih.gov/18544087" }, { "database": "PubMed", "id": "18550668", "url": "https://pubmed.ncbi.nlm.nih.gov/18550668" }, { "database": "PubMed", "id": "18593565", "url": "https://pubmed.ncbi.nlm.nih.gov/18593565" }, { "database": "PubMed", "id": "18612371", "url": "https://pubmed.ncbi.nlm.nih.gov/18612371" }, { "database": "PubMed", "id": "18755267", "url": "https://pubmed.ncbi.nlm.nih.gov/18755267" }, { "database": "PubMed", "id": "18755494", "url": "https://pubmed.ncbi.nlm.nih.gov/18755494" }, { "database": "PubMed", "id": "18779368", "url": "https://pubmed.ncbi.nlm.nih.gov/18779368" }, { "database": "PubMed", "id": "18790750", "url": "https://pubmed.ncbi.nlm.nih.gov/18790750" }, { "database": "PubMed", "id": "18939995", "url": "https://pubmed.ncbi.nlm.nih.gov/18939995" }, { "database": "PubMed", "id": "18941632", "url": "https://pubmed.ncbi.nlm.nih.gov/18941632" }, { "database": "PubMed", "id": "18995957", "url": "https://pubmed.ncbi.nlm.nih.gov/18995957" }, { "database": "PubMed", "id": "19001435", "url": "https://pubmed.ncbi.nlm.nih.gov/19001435" }, { "database": "PubMed", "id": "19025606", "url": "https://pubmed.ncbi.nlm.nih.gov/19025606" }, { "database": "PubMed", "id": "19118003", "url": "https://pubmed.ncbi.nlm.nih.gov/19118003" }, { "database": "PubMed", "id": "19182994", "url": "https://pubmed.ncbi.nlm.nih.gov/19182994" }, { "database": "PubMed", "id": "19201396", "url": "https://pubmed.ncbi.nlm.nih.gov/19201396" }, { "database": "PubMed", "id": "19232485", "url": "https://pubmed.ncbi.nlm.nih.gov/19232485" }, { "database": "PubMed", "id": "19351839", "url": "https://pubmed.ncbi.nlm.nih.gov/19351839" }, { "database": "PubMed", "id": "19421230", "url": "https://pubmed.ncbi.nlm.nih.gov/19421230" }, { "database": "PubMed", "id": "19440292", "url": "https://pubmed.ncbi.nlm.nih.gov/19440292" }, { "database": "PubMed", "id": "19506034", "url": "https://pubmed.ncbi.nlm.nih.gov/19506034" }, { "database": "PubMed", "id": "19595669", "url": "https://pubmed.ncbi.nlm.nih.gov/19595669" }, { "database": "PubMed", "id": "19623660", "url": "https://pubmed.ncbi.nlm.nih.gov/19623660" }, { "database": "PubMed", "id": "19712481", "url": "https://pubmed.ncbi.nlm.nih.gov/19712481" }, { "database": "PubMed", "id": "19723038", "url": "https://pubmed.ncbi.nlm.nih.gov/19723038" }, { "database": "PubMed", "id": "19741197", "url": "https://pubmed.ncbi.nlm.nih.gov/19741197" }, { "database": "PubMed", "id": "19744341", "url": "https://pubmed.ncbi.nlm.nih.gov/19744341" }, { "database": "PubMed", "id": "19754877", "url": "https://pubmed.ncbi.nlm.nih.gov/19754877" }, { "database": "PubMed", "id": "19764570", "url": "https://pubmed.ncbi.nlm.nih.gov/19764570" }, { "database": "PubMed", "id": "19808903", "url": "https://pubmed.ncbi.nlm.nih.gov/19808903" }, { "database": "PubMed", "id": "19821497", "url": "https://pubmed.ncbi.nlm.nih.gov/19821497" }, { "database": "PubMed", "id": "19901082", "url": "https://pubmed.ncbi.nlm.nih.gov/19901082" }, { "database": "PubMed", "id": "19903761", "url": "https://pubmed.ncbi.nlm.nih.gov/19903761" }, { "database": "PubMed", "id": "19903771", "url": "https://pubmed.ncbi.nlm.nih.gov/19903771" }, { "database": "PubMed", "id": "19995546", "url": "https://pubmed.ncbi.nlm.nih.gov/19995546" }, { "database": "PubMed", "id": "20072652", "url": "https://pubmed.ncbi.nlm.nih.gov/20072652" }, { "database": "PubMed", "id": "20156552", "url": "https://pubmed.ncbi.nlm.nih.gov/20156552" }, { "database": "PubMed", "id": "20169197", "url": "https://pubmed.ncbi.nlm.nih.gov/20169197" }, { "database": "PubMed", "id": "20228845", "url": "https://pubmed.ncbi.nlm.nih.gov/20228845" }, { "database": "PubMed", "id": "20233902", "url": "https://pubmed.ncbi.nlm.nih.gov/20233902" }, { "database": "PubMed", "id": "20351777", "url": "https://pubmed.ncbi.nlm.nih.gov/20351777" }, { "database": "PubMed", "id": "20371721", "url": "https://pubmed.ncbi.nlm.nih.gov/20371721" }, { "database": "PubMed", "id": "20455003", "url": "https://pubmed.ncbi.nlm.nih.gov/20455003" }, { "database": "PubMed", "id": "20507639", "url": "https://pubmed.ncbi.nlm.nih.gov/20507639" }, { "database": "PubMed", "id": "20534983", "url": "https://pubmed.ncbi.nlm.nih.gov/20534983" }, { "database": "PubMed", "id": "20576164", "url": "https://pubmed.ncbi.nlm.nih.gov/20576164" }, { "database": "PubMed", "id": "20589525", "url": "https://pubmed.ncbi.nlm.nih.gov/20589525" }, { "database": "PubMed", "id": "20712901", "url": "https://pubmed.ncbi.nlm.nih.gov/20712901" }, { "database": "PubMed", "id": "20724373", "url": "https://pubmed.ncbi.nlm.nih.gov/20724373" }, { "database": "PubMed", "id": "20808823", "url": "https://pubmed.ncbi.nlm.nih.gov/20808823" }, { "database": "PubMed", "id": "20840775", "url": "https://pubmed.ncbi.nlm.nih.gov/20840775" }, { "database": "PubMed", "id": "20851386", "url": "https://pubmed.ncbi.nlm.nih.gov/20851386" }, { "database": "PubMed", "id": "20877211", "url": "https://pubmed.ncbi.nlm.nih.gov/20877211" }, { "database": "PubMed", "id": "20959517", "url": "https://pubmed.ncbi.nlm.nih.gov/20959517" }, { "database": "PubMed", "id": "20977777", "url": "https://pubmed.ncbi.nlm.nih.gov/20977777" }, { "database": "PubMed", "id": "21098725", "url": "https://pubmed.ncbi.nlm.nih.gov/21098725" }, { "database": "PubMed", "id": "21122157", "url": "https://pubmed.ncbi.nlm.nih.gov/21122157" }, { "database": "PubMed", "id": "21163886", "url": "https://pubmed.ncbi.nlm.nih.gov/21163886" }, { "database": "PubMed", "id": "21253577", "url": "https://pubmed.ncbi.nlm.nih.gov/21253577" }, { "database": "PubMed", "id": "21254404", "url": "https://pubmed.ncbi.nlm.nih.gov/21254404" }, { "database": "PubMed", "id": "21311975", "url": "https://pubmed.ncbi.nlm.nih.gov/21311975" }, { "database": "PubMed", "id": "21360612", "url": "https://pubmed.ncbi.nlm.nih.gov/21360612" }, { "database": "PubMed", "id": "21369699", "url": "https://pubmed.ncbi.nlm.nih.gov/21369699" }, { "database": "PubMed", "id": "21388555", "url": "https://pubmed.ncbi.nlm.nih.gov/21388555" }, { "database": "PubMed", "id": "21435102", "url": "https://pubmed.ncbi.nlm.nih.gov/21435102" }, { "database": "PubMed", "id": "21443800", "url": "https://pubmed.ncbi.nlm.nih.gov/21443800" }, { "database": "PubMed", "id": "21486470", "url": "https://pubmed.ncbi.nlm.nih.gov/21486470" }, { "database": "PubMed", "id": "21490133", "url": "https://pubmed.ncbi.nlm.nih.gov/21490133" }, { "database": "PubMed", "id": "21524651", "url": "https://pubmed.ncbi.nlm.nih.gov/21524651" }, { "database": "PubMed", "id": "21526200", "url": "https://pubmed.ncbi.nlm.nih.gov/21526200" }, { "database": "PubMed", "id": "21538419", "url": "https://pubmed.ncbi.nlm.nih.gov/21538419" }, { "database": "PubMed", "id": "21625473", "url": "https://pubmed.ncbi.nlm.nih.gov/21625473" }, { "database": "PubMed", "id": "21625522", "url": "https://pubmed.ncbi.nlm.nih.gov/21625522" }, { "database": "PubMed", "id": "21625597", "url": "https://pubmed.ncbi.nlm.nih.gov/21625597" }, { "database": "PubMed", "id": "21654841", "url": "https://pubmed.ncbi.nlm.nih.gov/21654841" }, { "database": "PubMed", "id": "21655185", "url": "https://pubmed.ncbi.nlm.nih.gov/21655185" }, { "database": "PubMed", "id": "21677772", "url": "https://pubmed.ncbi.nlm.nih.gov/21677772" }, { "database": "PubMed", "id": "21685938", "url": "https://pubmed.ncbi.nlm.nih.gov/21685938" }, { "database": "PubMed", "id": "21689417", "url": "https://pubmed.ncbi.nlm.nih.gov/21689417" }, { "database": "PubMed", "id": "21690253", "url": "https://pubmed.ncbi.nlm.nih.gov/21690253" }, { "database": "PubMed", "id": "21694723", "url": "https://pubmed.ncbi.nlm.nih.gov/21694723" }, { "database": "PubMed", "id": "21730976", "url": "https://pubmed.ncbi.nlm.nih.gov/21730976" }, { "database": "PubMed", "id": "21738667", "url": "https://pubmed.ncbi.nlm.nih.gov/21738667" }, { "database": "PubMed", "id": "21785467", "url": "https://pubmed.ncbi.nlm.nih.gov/21785467" }, { "database": "PubMed", "id": "21799891", "url": "https://pubmed.ncbi.nlm.nih.gov/21799891" }, { "database": "PubMed", "id": "21801384", "url": "https://pubmed.ncbi.nlm.nih.gov/21801384" }, { "database": "PubMed", "id": "21840932", "url": "https://pubmed.ncbi.nlm.nih.gov/21840932" }, { "database": "PubMed", "id": "21906308", "url": "https://pubmed.ncbi.nlm.nih.gov/21906308" }, { "database": "PubMed", "id": "21915376", "url": "https://pubmed.ncbi.nlm.nih.gov/21915376" }, { "database": "PubMed", "id": "21931595", "url": "https://pubmed.ncbi.nlm.nih.gov/21931595" }, { "database": "PubMed", "id": "21954831", "url": "https://pubmed.ncbi.nlm.nih.gov/21954831" }, { "database": "PubMed", "id": "22016776", "url": "https://pubmed.ncbi.nlm.nih.gov/22016776" }, { "database": "PubMed", "id": "22110204", "url": "https://pubmed.ncbi.nlm.nih.gov/22110204" }, { "database": "PubMed", "id": "22142222", "url": "https://pubmed.ncbi.nlm.nih.gov/22142222" }, { "database": "PubMed", "id": "22174695", "url": "https://pubmed.ncbi.nlm.nih.gov/22174695" }, { "database": "PubMed", "id": "22174819", "url": "https://pubmed.ncbi.nlm.nih.gov/22174819" }, { "database": "PubMed", "id": "22179221", "url": "https://pubmed.ncbi.nlm.nih.gov/22179221" }, { "database": "PubMed", "id": "22210382", "url": "https://pubmed.ncbi.nlm.nih.gov/22210382" }, { "database": "PubMed", "id": "22259633", "url": "https://pubmed.ncbi.nlm.nih.gov/22259633" }, { "database": "PubMed", "id": "22279540", "url": "https://pubmed.ncbi.nlm.nih.gov/22279540" }, { "database": "PubMed", "id": "22280969", "url": "https://pubmed.ncbi.nlm.nih.gov/22280969" }, { "database": "PubMed", "id": "22313388", "url": "https://pubmed.ncbi.nlm.nih.gov/22313388" }, { "database": "PubMed", "id": "22315522", "url": "https://pubmed.ncbi.nlm.nih.gov/22315522" }, { "database": "PubMed", "id": "22349830", "url": "https://pubmed.ncbi.nlm.nih.gov/22349830" }, { "database": "PubMed", "id": "22351606", "url": "https://pubmed.ncbi.nlm.nih.gov/22351606" }, { "database": "PubMed", "id": "22359610", "url": "https://pubmed.ncbi.nlm.nih.gov/22359610" }, { "database": "PubMed", "id": "22366233", "url": "https://pubmed.ncbi.nlm.nih.gov/22366233" }, { "database": "PubMed", "id": "22370645", "url": "https://pubmed.ncbi.nlm.nih.gov/22370645" }, { "database": "PubMed", "id": "22374428", "url": "https://pubmed.ncbi.nlm.nih.gov/22374428" }, { "database": "PubMed", "id": "22406995", "url": "https://pubmed.ncbi.nlm.nih.gov/22406995" }, { "database": "PubMed", "id": "22418867", "url": "https://pubmed.ncbi.nlm.nih.gov/22418867" }, { "database": "PubMed", "id": "22450744", "url": "https://pubmed.ncbi.nlm.nih.gov/22450744" }, { "database": "PubMed", "id": "22461519", "url": "https://pubmed.ncbi.nlm.nih.gov/22461519" }, { "database": "PubMed", "id": "22465052", "url": "https://pubmed.ncbi.nlm.nih.gov/22465052" }, { "database": "PubMed", "id": "22484976", "url": "https://pubmed.ncbi.nlm.nih.gov/22484976" }, { "database": "PubMed", "id": "22504904", "url": "https://pubmed.ncbi.nlm.nih.gov/22504904" }, { "database": "PubMed", "id": "22522613", "url": "https://pubmed.ncbi.nlm.nih.gov/22522613" }, { "database": "PubMed", "id": "22581261", "url": "https://pubmed.ncbi.nlm.nih.gov/22581261" }, { "database": "PubMed", "id": "22642622", "url": "https://pubmed.ncbi.nlm.nih.gov/22642622" }, { "database": "PubMed", "id": "22677902", "url": "https://pubmed.ncbi.nlm.nih.gov/22677902" }, { "database": "PubMed", "id": "22754353", "url": "https://pubmed.ncbi.nlm.nih.gov/22754353" }, { "database": "PubMed", "id": "22799634", "url": "https://pubmed.ncbi.nlm.nih.gov/22799634" }, { "database": "PubMed", "id": "22801507", "url": "https://pubmed.ncbi.nlm.nih.gov/22801507" }, { "database": "PubMed", "id": "22824293", "url": "https://pubmed.ncbi.nlm.nih.gov/22824293" }, { "database": "PubMed", "id": "22829072", "url": "https://pubmed.ncbi.nlm.nih.gov/22829072" }, { "database": "PubMed", "id": "22870139", "url": "https://pubmed.ncbi.nlm.nih.gov/22870139" }, { "database": "PubMed", "id": "22899991", "url": "https://pubmed.ncbi.nlm.nih.gov/22899991" }, { "database": "PubMed", "id": "22905257", "url": "https://pubmed.ncbi.nlm.nih.gov/22905257" }, { "database": "PubMed", "id": "22920439", "url": "https://pubmed.ncbi.nlm.nih.gov/22920439" }, { "database": "PubMed", "id": "22922995", "url": "https://pubmed.ncbi.nlm.nih.gov/22922995" }, { "database": "PubMed", "id": "22937084", "url": "https://pubmed.ncbi.nlm.nih.gov/22937084" }, { "database": "PubMed", "id": "22978563", "url": "https://pubmed.ncbi.nlm.nih.gov/22978563" }, { "database": "PubMed", "id": "22984561", "url": "https://pubmed.ncbi.nlm.nih.gov/22984561" }, { "database": "PubMed", "id": "22987802", "url": "https://pubmed.ncbi.nlm.nih.gov/22987802" }, { "database": "PubMed", "id": "23007731", "url": "https://pubmed.ncbi.nlm.nih.gov/23007731" }, { "database": "PubMed", "id": "23056374", "url": "https://pubmed.ncbi.nlm.nih.gov/23056374" }, { "database": "PubMed", "id": "23056515", "url": "https://pubmed.ncbi.nlm.nih.gov/23056515" }, { "database": "PubMed", "id": "23074171", "url": "https://pubmed.ncbi.nlm.nih.gov/23074171" }, { "database": "PubMed", "id": "23094050", "url": "https://pubmed.ncbi.nlm.nih.gov/23094050" }, { "database": "PubMed", "id": "23108098", "url": "https://pubmed.ncbi.nlm.nih.gov/23108098" }, { "database": "PubMed", "id": "23125416", "url": "https://pubmed.ncbi.nlm.nih.gov/23125416" }, { "database": "PubMed", "id": "23166634", "url": "https://pubmed.ncbi.nlm.nih.gov/23166634" }, { "database": "PubMed", "id": "23189171", "url": "https://pubmed.ncbi.nlm.nih.gov/23189171" }, { "database": "PubMed", "id": "23226414", "url": "https://pubmed.ncbi.nlm.nih.gov/23226414" }, { "database": "PubMed", "id": "23251493", "url": "https://pubmed.ncbi.nlm.nih.gov/23251493" }, { "database": "PubMed", "id": "23279849", "url": "https://pubmed.ncbi.nlm.nih.gov/23279849" }, { "database": "PubMed", "id": "23303450", "url": "https://pubmed.ncbi.nlm.nih.gov/23303450" }, { "database": "PubMed", "id": "23318430", "url": "https://pubmed.ncbi.nlm.nih.gov/23318430" }, { "database": "PubMed", "id": "23322008", "url": "https://pubmed.ncbi.nlm.nih.gov/23322008" }, { "database": "PubMed", "id": "23326583", "url": "https://pubmed.ncbi.nlm.nih.gov/23326583" }, { "database": "PubMed", "id": "23350355", "url": "https://pubmed.ncbi.nlm.nih.gov/23350355" }, { "database": "PubMed", "id": "23372833", "url": "https://pubmed.ncbi.nlm.nih.gov/23372833" }, { "database": "PubMed", "id": "23382914", "url": "https://pubmed.ncbi.nlm.nih.gov/23382914" }, { "database": "PubMed", "id": "23416975", "url": "https://pubmed.ncbi.nlm.nih.gov/23416975" }, { "database": "PubMed", "id": "23434226", "url": "https://pubmed.ncbi.nlm.nih.gov/23434226" }, { "database": "PubMed", "id": "23440042", "url": "https://pubmed.ncbi.nlm.nih.gov/23440042" }, { "database": "PubMed", "id": "23446809", "url": "https://pubmed.ncbi.nlm.nih.gov/23446809" }, { "database": "PubMed", "id": "23455323", "url": "https://pubmed.ncbi.nlm.nih.gov/23455323" }, { "database": "PubMed", "id": "23496892", "url": "https://pubmed.ncbi.nlm.nih.gov/23496892" }, { "database": "PubMed", "id": "23525442", "url": "https://pubmed.ncbi.nlm.nih.gov/23525442" }, { "database": "PubMed", "id": "23528817", "url": "https://pubmed.ncbi.nlm.nih.gov/23528817" }, { "database": "PubMed", "id": "23614738", "url": "https://pubmed.ncbi.nlm.nih.gov/23614738" }, { "database": "PubMed", "id": "23637829", "url": "https://pubmed.ncbi.nlm.nih.gov/23637829" }, { "database": "PubMed", "id": "23686305", "url": "https://pubmed.ncbi.nlm.nih.gov/23686305" }, { "database": "PubMed", "id": "23686482", "url": "https://pubmed.ncbi.nlm.nih.gov/23686482" }, { "database": "PubMed", "id": "23690956", "url": "https://pubmed.ncbi.nlm.nih.gov/23690956" }, { "database": "PubMed", "id": "23704931", "url": "https://pubmed.ncbi.nlm.nih.gov/23704931" }, { "database": "PubMed", "id": "23740516", "url": "https://pubmed.ncbi.nlm.nih.gov/23740516" }, { "database": "PubMed", "id": "23755918", "url": "https://pubmed.ncbi.nlm.nih.gov/23755918" }, { "database": "PubMed", "id": "23756865", "url": "https://pubmed.ncbi.nlm.nih.gov/23756865" }, { "database": "PubMed", "id": "23774064", "url": "https://pubmed.ncbi.nlm.nih.gov/23774064" }, { "database": "PubMed", "id": "23776396", "url": "https://pubmed.ncbi.nlm.nih.gov/23776396" }, { "database": "PubMed", "id": "23782265", "url": "https://pubmed.ncbi.nlm.nih.gov/23782265" }, { "database": "PubMed", "id": "23831387", "url": "https://pubmed.ncbi.nlm.nih.gov/23831387" }, { "database": "PubMed", "id": "23861822", "url": "https://pubmed.ncbi.nlm.nih.gov/23861822" }, { "database": "PubMed", "id": "23872421", "url": "https://pubmed.ncbi.nlm.nih.gov/23872421" }, { "database": "PubMed", "id": "23874455", "url": "https://pubmed.ncbi.nlm.nih.gov/23874455" }, { "database": "PubMed", "id": "23889739", "url": "https://pubmed.ncbi.nlm.nih.gov/23889739" }, { "database": "PubMed", "id": "23894143", "url": "https://pubmed.ncbi.nlm.nih.gov/23894143" }, { "database": "PubMed", "id": "23903834", "url": "https://pubmed.ncbi.nlm.nih.gov/23903834" }, { "database": "PubMed", "id": "23923048", "url": "https://pubmed.ncbi.nlm.nih.gov/23923048" }, { "database": "PubMed", "id": "23928694", "url": "https://pubmed.ncbi.nlm.nih.gov/23928694" }, { "database": "PubMed", "id": "23936533", "url": "https://pubmed.ncbi.nlm.nih.gov/23936533" }, { "database": "PubMed", "id": "23947369", "url": "https://pubmed.ncbi.nlm.nih.gov/23947369" }, { "database": "PubMed", "id": "23967200", "url": "https://pubmed.ncbi.nlm.nih.gov/23967200" }, { "database": "PubMed", "id": "23991099", "url": "https://pubmed.ncbi.nlm.nih.gov/23991099" }, { "database": "PubMed", "id": "24015205", "url": "https://pubmed.ncbi.nlm.nih.gov/24015205" }, { "database": "PubMed", "id": "24019973", "url": "https://pubmed.ncbi.nlm.nih.gov/24019973" }, { "database": "PubMed", "id": "24043762", "url": "https://pubmed.ncbi.nlm.nih.gov/24043762" }, { "database": "PubMed", "id": "24048798", "url": "https://pubmed.ncbi.nlm.nih.gov/24048798" }, { "database": "PubMed", "id": "24058749", "url": "https://pubmed.ncbi.nlm.nih.gov/24058749" }, { "database": "PubMed", "id": "24058783", "url": "https://pubmed.ncbi.nlm.nih.gov/24058783" }, { "database": "PubMed", "id": "24063605", "url": "https://pubmed.ncbi.nlm.nih.gov/24063605" }, { "database": "PubMed", "id": "24069562", "url": "https://pubmed.ncbi.nlm.nih.gov/24069562" }, { "database": "PubMed", "id": "24086526", "url": "https://pubmed.ncbi.nlm.nih.gov/24086526" }, { "database": "PubMed", "id": "24090995", "url": "https://pubmed.ncbi.nlm.nih.gov/24090995" }, { "database": "PubMed", "id": "24098663", "url": "https://pubmed.ncbi.nlm.nih.gov/24098663" }, { "database": "PubMed", "id": "24129709", "url": "https://pubmed.ncbi.nlm.nih.gov/24129709" }, { "database": "PubMed", "id": "24154873", "url": "https://pubmed.ncbi.nlm.nih.gov/24154873" }, { "database": "PubMed", "id": "24164699", "url": "https://pubmed.ncbi.nlm.nih.gov/24164699" }, { "database": "PubMed", "id": "24165129", "url": "https://pubmed.ncbi.nlm.nih.gov/24165129" }, { "database": "PubMed", "id": "24192293", "url": "https://pubmed.ncbi.nlm.nih.gov/24192293" }, { "database": "PubMed", "id": "24280348", "url": "https://pubmed.ncbi.nlm.nih.gov/24280348" }, { "database": "PubMed", "id": "24288470", "url": "https://pubmed.ncbi.nlm.nih.gov/24288470" }, { "database": "PubMed", "id": "24312439", "url": "https://pubmed.ncbi.nlm.nih.gov/24312439" }, { "database": "PubMed", "id": "24314214", "url": "https://pubmed.ncbi.nlm.nih.gov/24314214" }, { "database": "PubMed", "id": "24317090", "url": "https://pubmed.ncbi.nlm.nih.gov/24317090" }, { "database": "PubMed", "id": "24319264", "url": "https://pubmed.ncbi.nlm.nih.gov/24319264" }, { "database": "PubMed", "id": "24324713", "url": "https://pubmed.ncbi.nlm.nih.gov/24324713" }, { "database": "PubMed", "id": "24348829", "url": "https://pubmed.ncbi.nlm.nih.gov/24348829" }, { "database": "PubMed", "id": "24418169", "url": "https://pubmed.ncbi.nlm.nih.gov/24418169" }, { "database": "PubMed", "id": "24423131", "url": "https://pubmed.ncbi.nlm.nih.gov/24423131" }, { "database": "PubMed", "id": "24499623", "url": "https://pubmed.ncbi.nlm.nih.gov/24499623" }, { "database": "PubMed", "id": "24505404", "url": "https://pubmed.ncbi.nlm.nih.gov/24505404" }, { "database": "PubMed", "id": "24520293", "url": "https://pubmed.ncbi.nlm.nih.gov/24520293" }, { "database": "PubMed", "id": "24533098", "url": "https://pubmed.ncbi.nlm.nih.gov/24533098" }, { "database": "PubMed", "id": "24586249", "url": "https://pubmed.ncbi.nlm.nih.gov/24586249" }, { "database": "PubMed", "id": "24602263", "url": "https://pubmed.ncbi.nlm.nih.gov/24602263" }, { "database": "PubMed", "id": "24615012", "url": "https://pubmed.ncbi.nlm.nih.gov/24615012" }, { "database": "PubMed", "id": "24622734", "url": "https://pubmed.ncbi.nlm.nih.gov/24622734" }, { "database": "PubMed", "id": "24652192", "url": "https://pubmed.ncbi.nlm.nih.gov/24652192" }, { "database": "PubMed", "id": "24661007", "url": "https://pubmed.ncbi.nlm.nih.gov/24661007" }, { "database": "PubMed", "id": "24671465", "url": "https://pubmed.ncbi.nlm.nih.gov/24671465" }, { "database": "PubMed", "id": "24671708", "url": "https://pubmed.ncbi.nlm.nih.gov/24671708" }, { "database": "PubMed", "id": "24687132", "url": "https://pubmed.ncbi.nlm.nih.gov/24687132" }, { "database": "PubMed", "id": "24707243", "url": "https://pubmed.ncbi.nlm.nih.gov/24707243" }, { "database": "PubMed", "id": "24726840", "url": "https://pubmed.ncbi.nlm.nih.gov/24726840" }, { "database": "PubMed", "id": "24736071", "url": "https://pubmed.ncbi.nlm.nih.gov/24736071" }, { "database": "PubMed", "id": "24756126", "url": "https://pubmed.ncbi.nlm.nih.gov/24756126" }, { "database": "PubMed", "id": "24799285", "url": "https://pubmed.ncbi.nlm.nih.gov/24799285" }, { "database": "PubMed", "id": "24846175", "url": "https://pubmed.ncbi.nlm.nih.gov/24846175" }, { "database": "PubMed", "id": "24855827", "url": "https://pubmed.ncbi.nlm.nih.gov/24855827" }, { "database": "PubMed", "id": "24909826", "url": "https://pubmed.ncbi.nlm.nih.gov/24909826" }, { "database": "PubMed", "id": "24930769", "url": "https://pubmed.ncbi.nlm.nih.gov/24930769" }, { "database": "PubMed", "id": "24931163", "url": "https://pubmed.ncbi.nlm.nih.gov/24931163" }, { "database": "PubMed", "id": "24932134", "url": "https://pubmed.ncbi.nlm.nih.gov/24932134" }, { "database": "PubMed", "id": "24945434", "url": "https://pubmed.ncbi.nlm.nih.gov/24945434" }, { "database": "PubMed", "id": "24953430", "url": "https://pubmed.ncbi.nlm.nih.gov/24953430" }, { "database": "PubMed", "id": "24954857", "url": "https://pubmed.ncbi.nlm.nih.gov/24954857" }, { "database": "PubMed", "id": "24970801", "url": "https://pubmed.ncbi.nlm.nih.gov/24970801" }, { "database": "PubMed", "id": "24978112", "url": "https://pubmed.ncbi.nlm.nih.gov/24978112" }, { "database": "PubMed", "id": "25013907", "url": "https://pubmed.ncbi.nlm.nih.gov/25013907" }, { "database": "PubMed", "id": "25016575", "url": "https://pubmed.ncbi.nlm.nih.gov/25016575" }, { "database": "PubMed", "id": "25031733", "url": "https://pubmed.ncbi.nlm.nih.gov/25031733" }, { "database": "PubMed", "id": "25036749", "url": "https://pubmed.ncbi.nlm.nih.gov/25036749" }, { "database": "PubMed", "id": "25040935", "url": "https://pubmed.ncbi.nlm.nih.gov/25040935" }, { "database": "PubMed", "id": "25047660", "url": "https://pubmed.ncbi.nlm.nih.gov/25047660" }, { "database": "PubMed", "id": "25071018", "url": "https://pubmed.ncbi.nlm.nih.gov/25071018" }, { "database": "PubMed", "id": "25072782", "url": "https://pubmed.ncbi.nlm.nih.gov/25072782" }, { "database": "PubMed", "id": "25101566", "url": "https://pubmed.ncbi.nlm.nih.gov/25101566" }, { "database": "PubMed", "id": "25116684", "url": "https://pubmed.ncbi.nlm.nih.gov/25116684" }, { "database": "PubMed", "id": "25200966", "url": "https://pubmed.ncbi.nlm.nih.gov/25200966" }, { "database": "PubMed", "id": "25216529", "url": "https://pubmed.ncbi.nlm.nih.gov/25216529" }, { "database": "PubMed", "id": "25217633", "url": "https://pubmed.ncbi.nlm.nih.gov/25217633" }, { "database": "PubMed", "id": "25226283", "url": "https://pubmed.ncbi.nlm.nih.gov/25226283" }, { "database": "PubMed", "id": "25231320", "url": "https://pubmed.ncbi.nlm.nih.gov/25231320" }, { "database": "PubMed", "id": "25246098", "url": "https://pubmed.ncbi.nlm.nih.gov/25246098" }, { "database": "PubMed", "id": "25252914", "url": "https://pubmed.ncbi.nlm.nih.gov/25252914" }, { "database": "PubMed", "id": "25266665", "url": "https://pubmed.ncbi.nlm.nih.gov/25266665" }, { "database": "PubMed", "id": "25296502", "url": "https://pubmed.ncbi.nlm.nih.gov/25296502" }, { "database": "PubMed", "id": "25299776", "url": "https://pubmed.ncbi.nlm.nih.gov/25299776" }, { "database": "PubMed", "id": "25327561", "url": "https://pubmed.ncbi.nlm.nih.gov/25327561" }, { "database": "PubMed", "id": "25360179", "url": "https://pubmed.ncbi.nlm.nih.gov/25360179" }, { "database": "PubMed", "id": "25373509", "url": "https://pubmed.ncbi.nlm.nih.gov/25373509" }, { "database": "PubMed", "id": "25383546", "url": "https://pubmed.ncbi.nlm.nih.gov/25383546" }, { "database": "PubMed", "id": "25393367", "url": "https://pubmed.ncbi.nlm.nih.gov/25393367" }, { "database": "PubMed", "id": "25401333", "url": "https://pubmed.ncbi.nlm.nih.gov/25401333" }, { "database": "PubMed", "id": "25417721", "url": "https://pubmed.ncbi.nlm.nih.gov/25417721" }, { "database": "PubMed", "id": "25452693", "url": "https://pubmed.ncbi.nlm.nih.gov/25452693" }, { "database": "PubMed", "id": "25476455", "url": "https://pubmed.ncbi.nlm.nih.gov/25476455" }, { "database": "PubMed", "id": "25486864", "url": "https://pubmed.ncbi.nlm.nih.gov/25486864" }, { "database": "PubMed", "id": "25512602", "url": "https://pubmed.ncbi.nlm.nih.gov/25512602" }, { "database": "PubMed", "id": "25539644", "url": "https://pubmed.ncbi.nlm.nih.gov/25539644" }, { "database": "PubMed", "id": "25544757", "url": "https://pubmed.ncbi.nlm.nih.gov/25544757" }, { "database": "PubMed", "id": "25548514", "url": "https://pubmed.ncbi.nlm.nih.gov/25548514" }, { "database": "PubMed", "id": "25561562", "url": "https://pubmed.ncbi.nlm.nih.gov/25561562" }, { "database": "PubMed", "id": "25584415", "url": "https://pubmed.ncbi.nlm.nih.gov/25584415" }, { "database": "PubMed", "id": "25594014", "url": "https://pubmed.ncbi.nlm.nih.gov/25594014" }, { "database": "PubMed", "id": "25597412", "url": "https://pubmed.ncbi.nlm.nih.gov/25597412" }, { "database": "PubMed", "id": "25605239", "url": "https://pubmed.ncbi.nlm.nih.gov/25605239" }, { "database": "PubMed", "id": "25612622", "url": "https://pubmed.ncbi.nlm.nih.gov/25612622" }, { "database": "PubMed", "id": "25622587", "url": "https://pubmed.ncbi.nlm.nih.gov/25622587" }, { "database": "PubMed", "id": "25661370", "url": "https://pubmed.ncbi.nlm.nih.gov/25661370" }, { "database": "PubMed", "id": "25684140", "url": "https://pubmed.ncbi.nlm.nih.gov/25684140" }, { "database": "PubMed", "id": "25687700", "url": "https://pubmed.ncbi.nlm.nih.gov/25687700" }, { "database": "PubMed", "id": "25699542", "url": "https://pubmed.ncbi.nlm.nih.gov/25699542" }, { "database": "PubMed", "id": "25734337", "url": "https://pubmed.ncbi.nlm.nih.gov/25734337" }, { "database": "PubMed", "id": "25736961", "url": "https://pubmed.ncbi.nlm.nih.gov/25736961" }, { "database": "PubMed", "id": "25744297", "url": "https://pubmed.ncbi.nlm.nih.gov/25744297" }, { "database": "PubMed", "id": "25750173", "url": "https://pubmed.ncbi.nlm.nih.gov/25750173" }, { "database": "PubMed", "id": "25789077", "url": "https://pubmed.ncbi.nlm.nih.gov/25789077" }, { "database": "PubMed", "id": "25793261", "url": "https://pubmed.ncbi.nlm.nih.gov/25793261" }, { "database": "PubMed", "id": "25811798", "url": "https://pubmed.ncbi.nlm.nih.gov/25811798" }, { "database": "PubMed", "id": "25843671", "url": "https://pubmed.ncbi.nlm.nih.gov/25843671" }, { "database": "PubMed", "id": "25849286", "url": "https://pubmed.ncbi.nlm.nih.gov/25849286" }, { "database": "PubMed", "id": "25869100", "url": "https://pubmed.ncbi.nlm.nih.gov/25869100" }, { "database": "PubMed", "id": "25879763", "url": "https://pubmed.ncbi.nlm.nih.gov/25879763" }, { "database": "PubMed", "id": "25881314", "url": "https://pubmed.ncbi.nlm.nih.gov/25881314" }, { "database": "PubMed", "id": "25883212", "url": "https://pubmed.ncbi.nlm.nih.gov/25883212" }, { "database": "PubMed", "id": "25915430", "url": "https://pubmed.ncbi.nlm.nih.gov/25915430" }, { "database": "PubMed", "id": "25928665", "url": "https://pubmed.ncbi.nlm.nih.gov/25928665" }, { "database": "PubMed", "id": "25947346", "url": "https://pubmed.ncbi.nlm.nih.gov/25947346" }, { "database": "PubMed", "id": "25961376", "url": "https://pubmed.ncbi.nlm.nih.gov/25961376" }, { "database": "PubMed", "id": "25968054", "url": "https://pubmed.ncbi.nlm.nih.gov/25968054" }, { "database": "PubMed", "id": "25984943", "url": "https://pubmed.ncbi.nlm.nih.gov/25984943" }, { "database": "PubMed", "id": "26008966", "url": "https://pubmed.ncbi.nlm.nih.gov/26008966" }, { "database": "PubMed", "id": "26028030", "url": "https://pubmed.ncbi.nlm.nih.gov/26028030" }, { "database": "PubMed", "id": "26041409", "url": "https://pubmed.ncbi.nlm.nih.gov/26041409" }, { "database": "PubMed", "id": "26045618", "url": "https://pubmed.ncbi.nlm.nih.gov/26045618" }, { "database": "PubMed", "id": "26051842", "url": "https://pubmed.ncbi.nlm.nih.gov/26051842" }, { "database": "PubMed", "id": "26055806", "url": "https://pubmed.ncbi.nlm.nih.gov/26055806" }, { "database": "PubMed", "id": "26068861", "url": "https://pubmed.ncbi.nlm.nih.gov/26068861" }, { "database": "PubMed", "id": "26084289", "url": "https://pubmed.ncbi.nlm.nih.gov/26084289" }, { "database": "PubMed", "id": "26090459", "url": "https://pubmed.ncbi.nlm.nih.gov/26090459" }, { "database": "PubMed", "id": "26136691", "url": "https://pubmed.ncbi.nlm.nih.gov/26136691" }, { "database": "PubMed", "id": "26138072", "url": "https://pubmed.ncbi.nlm.nih.gov/26138072" }, { "database": "PubMed", "id": "26166037", "url": "https://pubmed.ncbi.nlm.nih.gov/26166037" }, { "database": "PubMed", "id": "26175331", "url": "https://pubmed.ncbi.nlm.nih.gov/26175331" }, { "database": "PubMed", "id": "26212545", "url": "https://pubmed.ncbi.nlm.nih.gov/26212545" }, { "database": "PubMed", "id": "26215634", "url": "https://pubmed.ncbi.nlm.nih.gov/26215634" }, { "database": "PubMed", "id": "26215971", "url": "https://pubmed.ncbi.nlm.nih.gov/26215971" }, { "database": "PubMed", "id": "26279438", "url": "https://pubmed.ncbi.nlm.nih.gov/26279438" }, { "database": "PubMed", "id": "26283544", "url": "https://pubmed.ncbi.nlm.nih.gov/26283544" }, { "database": "PubMed", "id": "26307676", "url": "https://pubmed.ncbi.nlm.nih.gov/26307676" }, { "database": "PubMed", "id": "26329521", "url": "https://pubmed.ncbi.nlm.nih.gov/26329521" }, { "database": "PubMed", "id": "26343524", "url": "https://pubmed.ncbi.nlm.nih.gov/26343524" }, { "database": "PubMed", "id": "26359029", "url": "https://pubmed.ncbi.nlm.nih.gov/26359029" }, { "database": "PubMed", "id": "26376676", "url": "https://pubmed.ncbi.nlm.nih.gov/26376676" }, { "database": "PubMed", "id": "26396689", "url": "https://pubmed.ncbi.nlm.nih.gov/26396689" }, { "database": "PubMed", "id": "26410177", "url": "https://pubmed.ncbi.nlm.nih.gov/26410177" }, { "database": "PubMed", "id": "26418031", "url": "https://pubmed.ncbi.nlm.nih.gov/26418031" }, { "database": "PubMed", "id": "26430964", "url": "https://pubmed.ncbi.nlm.nih.gov/26430964" }, { "database": "PubMed", "id": "26452542", "url": "https://pubmed.ncbi.nlm.nih.gov/26452542" }, { "database": "PubMed", "id": "26459366", "url": "https://pubmed.ncbi.nlm.nih.gov/26459366" }, { "database": "PubMed", "id": "26485029", "url": "https://pubmed.ncbi.nlm.nih.gov/26485029" }, { "database": "PubMed", "id": "26486080", "url": "https://pubmed.ncbi.nlm.nih.gov/26486080" }, { "database": "PubMed", "id": "26528725", "url": "https://pubmed.ncbi.nlm.nih.gov/26528725" }, { "database": "PubMed", "id": "26542452", "url": "https://pubmed.ncbi.nlm.nih.gov/26542452" }, { "database": "PubMed", "id": "26549437", "url": "https://pubmed.ncbi.nlm.nih.gov/26549437" }, { "database": "PubMed", "id": "26549519", "url": "https://pubmed.ncbi.nlm.nih.gov/26549519" }, { "database": "PubMed", "id": "26575169", "url": "https://pubmed.ncbi.nlm.nih.gov/26575169" }, { "database": "PubMed", "id": "26580615", "url": "https://pubmed.ncbi.nlm.nih.gov/26580615" }, { "database": "PubMed", "id": "26610526", "url": "https://pubmed.ncbi.nlm.nih.gov/26610526" }, { "database": "PubMed", "id": "26646010", "url": "https://pubmed.ncbi.nlm.nih.gov/26646010" }, { "database": "PubMed", "id": "26657118", "url": "https://pubmed.ncbi.nlm.nih.gov/26657118" }, { "database": "PubMed", "id": "26664907", "url": "https://pubmed.ncbi.nlm.nih.gov/26664907" }, { "database": "PubMed", "id": "26667266", "url": "https://pubmed.ncbi.nlm.nih.gov/26667266" }, { "database": "PubMed", "id": "26700461", "url": "https://pubmed.ncbi.nlm.nih.gov/26700461" }, { "database": "PubMed", "id": "26755645", "url": "https://pubmed.ncbi.nlm.nih.gov/26755645" }, { "database": "PubMed", "id": "26799670", "url": "https://pubmed.ncbi.nlm.nih.gov/26799670" }, { "database": "PubMed", "id": "26807955", "url": "https://pubmed.ncbi.nlm.nih.gov/26807955" }, { "database": "PubMed", "id": "26843613", "url": "https://pubmed.ncbi.nlm.nih.gov/26843613" }, { "database": "PubMed", "id": "26848618", "url": "https://pubmed.ncbi.nlm.nih.gov/26848618" }, { "database": "PubMed", "id": "26883202", "url": "https://pubmed.ncbi.nlm.nih.gov/26883202" }, { "database": "PubMed", "id": "26883847", "url": "https://pubmed.ncbi.nlm.nih.gov/26883847" }, { "database": "PubMed", "id": "26893174", "url": "https://pubmed.ncbi.nlm.nih.gov/26893174" }, { "database": "PubMed", "id": "26893580", "url": "https://pubmed.ncbi.nlm.nih.gov/26893580" }, { "database": "PubMed", "id": "26898989", "url": "https://pubmed.ncbi.nlm.nih.gov/26898989" }, { "database": "PubMed", "id": "26904942", "url": "https://pubmed.ncbi.nlm.nih.gov/26904942" }, { "database": "PubMed", "id": "26904961", "url": "https://pubmed.ncbi.nlm.nih.gov/26904961" }, { "database": "PubMed", "id": "26909608", "url": "https://pubmed.ncbi.nlm.nih.gov/26909608" }, { "database": "PubMed", "id": "26911335", "url": "https://pubmed.ncbi.nlm.nih.gov/26911335" }, { "database": "PubMed", "id": "26921179", "url": "https://pubmed.ncbi.nlm.nih.gov/26921179" }, { "database": "PubMed", "id": "26926996", "url": "https://pubmed.ncbi.nlm.nih.gov/26926996" }, { "database": "PubMed", "id": "26927669", "url": "https://pubmed.ncbi.nlm.nih.gov/26927669" }, { "database": "PubMed", "id": "26949510", "url": "https://pubmed.ncbi.nlm.nih.gov/26949510" }, { "database": "PubMed", "id": "26956050", "url": "https://pubmed.ncbi.nlm.nih.gov/26956050" }, { "database": "PubMed", "id": "26959890", "url": "https://pubmed.ncbi.nlm.nih.gov/26959890" }, { "database": "PubMed", "id": "26967055", "url": "https://pubmed.ncbi.nlm.nih.gov/26967055" }, { "database": "PubMed", "id": "26974964", "url": "https://pubmed.ncbi.nlm.nih.gov/26974964" }, { "database": "PubMed", "id": "27009358", "url": "https://pubmed.ncbi.nlm.nih.gov/27009358" }, { "database": "PubMed", "id": "27036022", "url": "https://pubmed.ncbi.nlm.nih.gov/27036022" }, { "database": "PubMed", "id": "27050371", "url": "https://pubmed.ncbi.nlm.nih.gov/27050371" }, { "database": "PubMed", "id": "27064016", "url": "https://pubmed.ncbi.nlm.nih.gov/27064016" }, { "database": "PubMed", "id": "27080861", "url": "https://pubmed.ncbi.nlm.nih.gov/27080861" }, { "database": "PubMed", "id": "27107422", "url": "https://pubmed.ncbi.nlm.nih.gov/27107422" }, { "database": "PubMed", "id": "27121055", "url": "https://pubmed.ncbi.nlm.nih.gov/27121055" }, { "database": "PubMed", "id": "27145367", "url": "https://pubmed.ncbi.nlm.nih.gov/27145367" }, { "database": "PubMed", "id": "27151455", "url": "https://pubmed.ncbi.nlm.nih.gov/27151455" }, { "database": "PubMed", "id": "27181202", "url": "https://pubmed.ncbi.nlm.nih.gov/27181202" }, { "database": "PubMed", "id": "27200496", "url": "https://pubmed.ncbi.nlm.nih.gov/27200496" }, { "database": "PubMed", "id": "27216197", "url": "https://pubmed.ncbi.nlm.nih.gov/27216197" }, { "database": "PubMed", "id": "27264264", "url": "https://pubmed.ncbi.nlm.nih.gov/27264264" }, { "database": "PubMed", "id": "27274723", "url": "https://pubmed.ncbi.nlm.nih.gov/27274723" }, { "database": "PubMed", "id": "27279256", "url": "https://pubmed.ncbi.nlm.nih.gov/27279256" }, { "database": "PubMed", "id": "27292026", "url": "https://pubmed.ncbi.nlm.nih.gov/27292026" }, { "database": "PubMed", "id": "27317770", "url": "https://pubmed.ncbi.nlm.nih.gov/27317770" }, { "database": "PubMed", "id": "27323414", "url": "https://pubmed.ncbi.nlm.nih.gov/27323414" }, { "database": "PubMed", "id": "27326257", "url": "https://pubmed.ncbi.nlm.nih.gov/27326257" }, { "database": "PubMed", "id": "27344175", "url": "https://pubmed.ncbi.nlm.nih.gov/27344175" }, { "database": "PubMed", "id": "27362806", "url": "https://pubmed.ncbi.nlm.nih.gov/27362806" }, { "database": "PubMed", "id": "27373978", "url": "https://pubmed.ncbi.nlm.nih.gov/27373978" }, { "database": "PubMed", "id": "27384401", "url": "https://pubmed.ncbi.nlm.nih.gov/27384401" }, { "database": "PubMed", "id": "27418138", "url": "https://pubmed.ncbi.nlm.nih.gov/27418138" }, { "database": "PubMed", "id": "27419630", "url": "https://pubmed.ncbi.nlm.nih.gov/27419630" }, { "database": "PubMed", "id": "27428425", "url": "https://pubmed.ncbi.nlm.nih.gov/27428425" }, { "database": "PubMed", "id": "27456333", "url": "https://pubmed.ncbi.nlm.nih.gov/27456333" }, { "database": "PubMed", "id": "27457246", "url": "https://pubmed.ncbi.nlm.nih.gov/27457246" }, { "database": "PubMed", "id": "27458171", "url": "https://pubmed.ncbi.nlm.nih.gov/27458171" }, { "database": "PubMed", "id": "27462789", "url": "https://pubmed.ncbi.nlm.nih.gov/27462789" }, { "database": "PubMed", "id": "27486258", "url": "https://pubmed.ncbi.nlm.nih.gov/27486258" }, { "database": "PubMed", "id": "27502076", "url": "https://pubmed.ncbi.nlm.nih.gov/27502076" }, { "database": "PubMed", "id": "27537522", "url": "https://pubmed.ncbi.nlm.nih.gov/27537522" }, { "database": "PubMed", "id": "27555284", "url": "https://pubmed.ncbi.nlm.nih.gov/27555284" }, { "database": "PubMed", "id": "27602766", "url": "https://pubmed.ncbi.nlm.nih.gov/27602766" }, { "database": "PubMed", "id": "27616044", "url": "https://pubmed.ncbi.nlm.nih.gov/27616044" }, { "database": "PubMed", "id": "27624867", "url": "https://pubmed.ncbi.nlm.nih.gov/27624867" }, { "database": "PubMed", "id": "27626315", "url": "https://pubmed.ncbi.nlm.nih.gov/27626315" }, { "database": "PubMed", "id": "27658964", "url": "https://pubmed.ncbi.nlm.nih.gov/27658964" }, { "database": "PubMed", "id": "27660268", "url": "https://pubmed.ncbi.nlm.nih.gov/27660268" }, { "database": "PubMed", "id": "27687804", "url": "https://pubmed.ncbi.nlm.nih.gov/27687804" }, { "database": "PubMed", "id": "27694691", "url": "https://pubmed.ncbi.nlm.nih.gov/27694691" }, { "database": "PubMed", "id": "27705908", "url": "https://pubmed.ncbi.nlm.nih.gov/27705908" }, { "database": "PubMed", "id": "27708408", "url": "https://pubmed.ncbi.nlm.nih.gov/27708408" }, { "database": "PubMed", "id": "27732936", "url": "https://pubmed.ncbi.nlm.nih.gov/27732936" }, { "database": "PubMed", "id": "27748760", "url": "https://pubmed.ncbi.nlm.nih.gov/27748760" }, { "database": "PubMed", "id": "27748818", "url": "https://pubmed.ncbi.nlm.nih.gov/27748818" }, { "database": "PubMed", "id": "27806334", "url": "https://pubmed.ncbi.nlm.nih.gov/27806334" }, { "database": "PubMed", "id": "27824155", "url": "https://pubmed.ncbi.nlm.nih.gov/27824155" }, { "database": "PubMed", "id": "27834930", "url": "https://pubmed.ncbi.nlm.nih.gov/27834930" }, { "database": "PubMed", "id": "27845909", "url": "https://pubmed.ncbi.nlm.nih.gov/27845909" }, { "database": "PubMed", "id": "27855189", "url": "https://pubmed.ncbi.nlm.nih.gov/27855189" }, { "database": "PubMed", "id": "27855669", "url": "https://pubmed.ncbi.nlm.nih.gov/27855669" }, { "database": "PubMed", "id": "27861147", "url": "https://pubmed.ncbi.nlm.nih.gov/27861147" }, { "database": "PubMed", "id": "27862183", "url": "https://pubmed.ncbi.nlm.nih.gov/27862183" }, { "database": "PubMed", "id": "27864909", "url": "https://pubmed.ncbi.nlm.nih.gov/27864909" }, { "database": "PubMed", "id": "27871173", "url": "https://pubmed.ncbi.nlm.nih.gov/27871173" }, { "database": "PubMed", "id": "27888804", "url": "https://pubmed.ncbi.nlm.nih.gov/27888804" }, { "database": "PubMed", "id": "27903968", "url": "https://pubmed.ncbi.nlm.nih.gov/27903968" }, { "database": "PubMed", "id": "27977009", "url": "https://pubmed.ncbi.nlm.nih.gov/27977009" }, { "database": "PubMed", "id": "28000790", "url": "https://pubmed.ncbi.nlm.nih.gov/28000790" }, { "database": "PubMed", "id": "28004755", "url": "https://pubmed.ncbi.nlm.nih.gov/28004755" }, { "database": "PubMed", "id": "28017654", "url": "https://pubmed.ncbi.nlm.nih.gov/28017654" }, { "database": "PubMed", "id": "28030813", "url": "https://pubmed.ncbi.nlm.nih.gov/28030813" }, { "database": "PubMed", "id": "28035720", "url": "https://pubmed.ncbi.nlm.nih.gov/28035720" }, { "database": "PubMed", "id": "28053540", "url": "https://pubmed.ncbi.nlm.nih.gov/28053540" }, { "database": "PubMed", "id": "28054649", "url": "https://pubmed.ncbi.nlm.nih.gov/28054649" }, { "database": "PubMed", "id": "28055016", "url": "https://pubmed.ncbi.nlm.nih.gov/28055016" }, { "database": "PubMed", "id": "28100038", "url": "https://pubmed.ncbi.nlm.nih.gov/28100038" }, { "database": "PubMed", "id": "28123608", "url": "https://pubmed.ncbi.nlm.nih.gov/28123608" }, { "database": "PubMed", "id": "28125678", "url": "https://pubmed.ncbi.nlm.nih.gov/28125678" }, { "database": "PubMed", "id": "28134252", "url": "https://pubmed.ncbi.nlm.nih.gov/28134252" }, { "database": "PubMed", "id": "28138036", "url": "https://pubmed.ncbi.nlm.nih.gov/28138036" }, { "database": "PubMed", "id": "28150703", "url": "https://pubmed.ncbi.nlm.nih.gov/28150703" }, { "database": "PubMed", "id": "28150717", "url": "https://pubmed.ncbi.nlm.nih.gov/28150717" }, { "database": "PubMed", "id": "28157205", "url": "https://pubmed.ncbi.nlm.nih.gov/28157205" }, { "database": "PubMed", "id": "28157698", "url": "https://pubmed.ncbi.nlm.nih.gov/28157698" }, { "database": "PubMed", "id": "28157712", "url": "https://pubmed.ncbi.nlm.nih.gov/28157712" }, { "database": "PubMed", "id": "28159925", "url": "https://pubmed.ncbi.nlm.nih.gov/28159925" }, { "database": "PubMed", "id": "28160777", "url": "https://pubmed.ncbi.nlm.nih.gov/28160777" }, { "database": "PubMed", "id": "28207963", "url": "https://pubmed.ncbi.nlm.nih.gov/28207963" }, { "database": "PubMed", "id": "28222632", "url": "https://pubmed.ncbi.nlm.nih.gov/28222632" }, { "database": "PubMed", "id": "28223425", "url": "https://pubmed.ncbi.nlm.nih.gov/28223425" }, { "database": "PubMed", "id": "28228214", "url": "https://pubmed.ncbi.nlm.nih.gov/28228214" }, { "database": "PubMed", "id": "28240316", "url": "https://pubmed.ncbi.nlm.nih.gov/28240316" }, { "database": "PubMed", "id": "28264935", "url": "https://pubmed.ncbi.nlm.nih.gov/28264935" }, { "database": "PubMed", "id": "28276425", "url": "https://pubmed.ncbi.nlm.nih.gov/28276425" }, { "database": "PubMed", "id": "28280036", "url": "https://pubmed.ncbi.nlm.nih.gov/28280036" }, { "database": "PubMed", "id": "28345832", "url": "https://pubmed.ncbi.nlm.nih.gov/28345832" }, { "database": "PubMed", "id": "28350008", "url": "https://pubmed.ncbi.nlm.nih.gov/28350008" }, { "database": "PubMed", "id": "28367059", "url": "https://pubmed.ncbi.nlm.nih.gov/28367059" }, { "database": "PubMed", "id": "28376152", "url": "https://pubmed.ncbi.nlm.nih.gov/28376152" }, { "database": "PubMed", "id": "28384648", "url": "https://pubmed.ncbi.nlm.nih.gov/28384648" }, { "database": "PubMed", "id": "28388577", "url": "https://pubmed.ncbi.nlm.nih.gov/28388577" }, { "database": "PubMed", "id": "28397855", "url": "https://pubmed.ncbi.nlm.nih.gov/28397855" }, { "database": "PubMed", "id": "28415760", "url": "https://pubmed.ncbi.nlm.nih.gov/28415760" }, { "database": "PubMed", "id": "28427199", "url": "https://pubmed.ncbi.nlm.nih.gov/28427199" }, { "database": "PubMed", "id": "28427224", "url": "https://pubmed.ncbi.nlm.nih.gov/28427224" }, { "database": "PubMed", "id": "28430601", "url": "https://pubmed.ncbi.nlm.nih.gov/28430601" }, { "database": "PubMed", "id": "28432285", "url": "https://pubmed.ncbi.nlm.nih.gov/28432285" }, { "database": "PubMed", "id": "28469272", "url": "https://pubmed.ncbi.nlm.nih.gov/28469272" }, { "database": "PubMed", "id": "28483518", "url": "https://pubmed.ncbi.nlm.nih.gov/28483518" }, { "database": "PubMed", "id": "28492557", "url": "https://pubmed.ncbi.nlm.nih.gov/28492557" }, { "database": "PubMed", "id": "28500786", "url": "https://pubmed.ncbi.nlm.nih.gov/28500786" }, { "database": "PubMed", "id": "28503147", "url": "https://pubmed.ncbi.nlm.nih.gov/28503147" }, { "database": "PubMed", "id": "28520923", "url": "https://pubmed.ncbi.nlm.nih.gov/28520923" }, { "database": "PubMed", "id": "28526807", "url": "https://pubmed.ncbi.nlm.nih.gov/28526807" }, { "database": "PubMed", "id": "28526849", "url": "https://pubmed.ncbi.nlm.nih.gov/28526849" }, { "database": "PubMed", "id": "28542650", "url": "https://pubmed.ncbi.nlm.nih.gov/28542650" }, { "database": "PubMed", "id": "28549350", "url": "https://pubmed.ncbi.nlm.nih.gov/28549350" }, { "database": "PubMed", "id": "28550731", "url": "https://pubmed.ncbi.nlm.nih.gov/28550731" }, { "database": "PubMed", "id": "28560454", "url": "https://pubmed.ncbi.nlm.nih.gov/28560454" }, { "database": "PubMed", "id": "28572601", "url": "https://pubmed.ncbi.nlm.nih.gov/28572601" }, { "database": "PubMed", "id": "28574510", "url": "https://pubmed.ncbi.nlm.nih.gov/28574510" }, { "database": "PubMed", "id": "28588262", "url": "https://pubmed.ncbi.nlm.nih.gov/28588262" }, { "database": "PubMed", "id": "28629363", "url": "https://pubmed.ncbi.nlm.nih.gov/28629363" }, { "database": "PubMed", "id": "28634059", "url": "https://pubmed.ncbi.nlm.nih.gov/28634059" }, { "database": "PubMed", "id": "28636670", "url": "https://pubmed.ncbi.nlm.nih.gov/28636670" }, { "database": "PubMed", "id": "28654902", "url": "https://pubmed.ncbi.nlm.nih.gov/28654902" }, { "database": "PubMed", "id": "28661045", "url": "https://pubmed.ncbi.nlm.nih.gov/28661045" }, { "database": "PubMed", "id": "28664080", "url": "https://pubmed.ncbi.nlm.nih.gov/28664080" }, { "database": "PubMed", "id": "28666623", "url": "https://pubmed.ncbi.nlm.nih.gov/28666623" }, { "database": "PubMed", "id": "28670112", "url": "https://pubmed.ncbi.nlm.nih.gov/28670112" }, { "database": "PubMed", "id": "28672024", "url": "https://pubmed.ncbi.nlm.nih.gov/28672024" }, { "database": "PubMed", "id": "28676732", "url": "https://pubmed.ncbi.nlm.nih.gov/28676732" }, { "database": "PubMed", "id": "28705432", "url": "https://pubmed.ncbi.nlm.nih.gov/28705432" }, { "database": "PubMed", "id": "28720093", "url": "https://pubmed.ncbi.nlm.nih.gov/28720093" }, { "database": "PubMed", "id": "28745314", "url": "https://pubmed.ncbi.nlm.nih.gov/28745314" }, { "database": "PubMed", "id": "28750624", "url": "https://pubmed.ncbi.nlm.nih.gov/28750624" }, { "database": "PubMed", "id": "28757590", "url": "https://pubmed.ncbi.nlm.nih.gov/28757590" }, { "database": "PubMed", "id": "28781685", "url": "https://pubmed.ncbi.nlm.nih.gov/28781685" }, { "database": "PubMed", "id": "28783167", "url": "https://pubmed.ncbi.nlm.nih.gov/28783167" }, { "database": "PubMed", "id": "28785079", "url": "https://pubmed.ncbi.nlm.nih.gov/28785079" }, { "database": "PubMed", "id": "28785380", "url": "https://pubmed.ncbi.nlm.nih.gov/28785380" }, { "database": "PubMed", "id": "28859117", "url": "https://pubmed.ncbi.nlm.nih.gov/28859117" }, { "database": "PubMed", "id": "28881473", "url": "https://pubmed.ncbi.nlm.nih.gov/28881473" }, { "database": "PubMed", "id": "28883791", "url": "https://pubmed.ncbi.nlm.nih.gov/28883791" }, { "database": "PubMed", "id": "28884137", "url": "https://pubmed.ncbi.nlm.nih.gov/28884137" }, { "database": "PubMed", "id": "28903349", "url": "https://pubmed.ncbi.nlm.nih.gov/28903349" }, { "database": "PubMed", "id": "28918059", "url": "https://pubmed.ncbi.nlm.nih.gov/28918059" }, { "database": "PubMed", "id": "29024195", "url": "https://pubmed.ncbi.nlm.nih.gov/29024195" }, { "database": "PubMed", "id": "29050232", "url": "https://pubmed.ncbi.nlm.nih.gov/29050232" }, { "database": "PubMed", "id": "29062282", "url": "https://pubmed.ncbi.nlm.nih.gov/29062282" }, { "database": "PubMed", "id": "29082496", "url": "https://pubmed.ncbi.nlm.nih.gov/29082496" }, { "database": "PubMed", "id": "29088733", "url": "https://pubmed.ncbi.nlm.nih.gov/29088733" }, { "database": "PubMed", "id": "29126425", "url": "https://pubmed.ncbi.nlm.nih.gov/29126425" }, { "database": "PubMed", "id": "29133922", "url": "https://pubmed.ncbi.nlm.nih.gov/29133922" }, { "database": "PubMed", "id": "29142074", "url": "https://pubmed.ncbi.nlm.nih.gov/29142074" }, { "database": "PubMed", "id": "29158850", "url": "https://pubmed.ncbi.nlm.nih.gov/29158850" }, { "database": "PubMed", "id": "29162862", "url": "https://pubmed.ncbi.nlm.nih.gov/29162862" }, { "database": "PubMed", "id": "29174507", "url": "https://pubmed.ncbi.nlm.nih.gov/29174507" }, { "database": "PubMed", "id": "29179471", "url": "https://pubmed.ncbi.nlm.nih.gov/29179471" }, { "database": "PubMed", "id": "29180818", "url": "https://pubmed.ncbi.nlm.nih.gov/29180818" }, { "database": "PubMed", "id": "29182685", "url": "https://pubmed.ncbi.nlm.nih.gov/29182685" }, { "database": "PubMed", "id": "29185442", "url": "https://pubmed.ncbi.nlm.nih.gov/29185442" }, { "database": "PubMed", "id": "29190960", "url": "https://pubmed.ncbi.nlm.nih.gov/29190960" }, { "database": "PubMed", "id": "29207075", "url": "https://pubmed.ncbi.nlm.nih.gov/29207075" }, { "database": "PubMed", "id": "29207614", "url": "https://pubmed.ncbi.nlm.nih.gov/29207614" }, { "database": "PubMed", "id": "29212252", "url": "https://pubmed.ncbi.nlm.nih.gov/29212252" }, { "database": "PubMed", "id": "29228628", "url": "https://pubmed.ncbi.nlm.nih.gov/29228628" }, { "database": "PubMed", "id": "29229958", "url": "https://pubmed.ncbi.nlm.nih.gov/29229958" }, { "database": "PubMed", "id": "29234062", "url": "https://pubmed.ncbi.nlm.nih.gov/29234062" }, { "database": "PubMed", "id": "29242509", "url": "https://pubmed.ncbi.nlm.nih.gov/29242509" }, { "database": "PubMed", "id": "29253028", "url": "https://pubmed.ncbi.nlm.nih.gov/29253028" }, { "database": "PubMed", "id": "29254221", "url": "https://pubmed.ncbi.nlm.nih.gov/29254221" }, { "database": "PubMed", "id": "29263930", "url": "https://pubmed.ncbi.nlm.nih.gov/29263930" }, { "database": "PubMed", "id": "29270528", "url": "https://pubmed.ncbi.nlm.nih.gov/29270528" }, { "database": "PubMed", "id": "29286132", "url": "https://pubmed.ncbi.nlm.nih.gov/29286132" }, { "database": "PubMed", "id": "29290793", "url": "https://pubmed.ncbi.nlm.nih.gov/29290793" }, { "database": "PubMed", "id": "29309895", "url": "https://pubmed.ncbi.nlm.nih.gov/29309895" }, { "database": "PubMed", "id": "29330478", "url": "https://pubmed.ncbi.nlm.nih.gov/29330478" }, { "database": "PubMed", "id": "29351406", "url": "https://pubmed.ncbi.nlm.nih.gov/29351406" }, { "database": "PubMed", "id": "29402895", "url": "https://pubmed.ncbi.nlm.nih.gov/29402895" }, { "database": "PubMed", "id": "29423098", "url": "https://pubmed.ncbi.nlm.nih.gov/29423098" }, { "database": "PubMed", "id": "29449694", "url": "https://pubmed.ncbi.nlm.nih.gov/29449694" }, { "database": "PubMed", "id": "29456111", "url": "https://pubmed.ncbi.nlm.nih.gov/29456111" }, { "database": "PubMed", "id": "29456240", "url": "https://pubmed.ncbi.nlm.nih.gov/29456240" }, { "database": "PubMed", "id": "29464030", "url": "https://pubmed.ncbi.nlm.nih.gov/29464030" }, { "database": "PubMed", "id": "29488000", "url": "https://pubmed.ncbi.nlm.nih.gov/29488000" }, { "database": "PubMed", "id": "29499951", "url": "https://pubmed.ncbi.nlm.nih.gov/29499951" }, { "database": "PubMed", "id": "29511087", "url": "https://pubmed.ncbi.nlm.nih.gov/29511087" }, { "database": "PubMed", "id": "29511600", "url": "https://pubmed.ncbi.nlm.nih.gov/29511600" }, { "database": "PubMed", "id": "29518696", "url": "https://pubmed.ncbi.nlm.nih.gov/29518696" }, { "database": "PubMed", "id": "29540666", "url": "https://pubmed.ncbi.nlm.nih.gov/29540666" }, { "database": "PubMed", "id": "29565987", "url": "https://pubmed.ncbi.nlm.nih.gov/29565987" }, { "database": "PubMed", "id": "29566069", "url": "https://pubmed.ncbi.nlm.nih.gov/29566069" }, { "database": "PubMed", "id": "29571296", "url": "https://pubmed.ncbi.nlm.nih.gov/29571296" }, { "database": "PubMed", "id": "29595328", "url": "https://pubmed.ncbi.nlm.nih.gov/29595328" }, { "database": "PubMed", "id": "29599917", "url": "https://pubmed.ncbi.nlm.nih.gov/29599917" }, { "database": "PubMed", "id": "29606890", "url": "https://pubmed.ncbi.nlm.nih.gov/29606890" }, { "database": "PubMed", "id": "29630659", "url": "https://pubmed.ncbi.nlm.nih.gov/29630659" }, { "database": "PubMed", "id": "29636527", "url": "https://pubmed.ncbi.nlm.nih.gov/29636527" }, { "database": "PubMed", "id": "29637003", "url": "https://pubmed.ncbi.nlm.nih.gov/29637003" }, { "database": "PubMed", "id": "29652915", "url": "https://pubmed.ncbi.nlm.nih.gov/29652915" }, { "database": "PubMed", "id": "29660364", "url": "https://pubmed.ncbi.nlm.nih.gov/29660364" }, { "database": "PubMed", "id": "29666362", "url": "https://pubmed.ncbi.nlm.nih.gov/29666362" }, { "database": "PubMed", "id": "29682112", "url": "https://pubmed.ncbi.nlm.nih.gov/29682112" }, { "database": "PubMed", "id": "29686295", "url": "https://pubmed.ncbi.nlm.nih.gov/29686295" }, { "database": "PubMed", "id": "29717134", "url": "https://pubmed.ncbi.nlm.nih.gov/29717134" }, { "database": "PubMed", "id": "29721383", "url": "https://pubmed.ncbi.nlm.nih.gov/29721383" }, { "database": "PubMed", "id": "29749438", "url": "https://pubmed.ncbi.nlm.nih.gov/29749438" }, { "database": "PubMed", "id": "29765448", "url": "https://pubmed.ncbi.nlm.nih.gov/29765448" }, { "database": "PubMed", "id": "29774125", "url": "https://pubmed.ncbi.nlm.nih.gov/29774125" }, { "database": "PubMed", "id": "29795016", "url": "https://pubmed.ncbi.nlm.nih.gov/29795016" }, { "database": "PubMed", "id": "29805309", "url": "https://pubmed.ncbi.nlm.nih.gov/29805309" }, { "database": "PubMed", "id": "29807795", "url": "https://pubmed.ncbi.nlm.nih.gov/29807795" }, { "database": "PubMed", "id": "29855616", "url": "https://pubmed.ncbi.nlm.nih.gov/29855616" }, { "database": "PubMed", "id": "29891854", "url": "https://pubmed.ncbi.nlm.nih.gov/29891854" }, { "database": "PubMed", "id": "29892198", "url": "https://pubmed.ncbi.nlm.nih.gov/29892198" }, { "database": "PubMed", "id": "29901083", "url": "https://pubmed.ncbi.nlm.nih.gov/29901083" }, { "database": "PubMed", "id": "29904948", "url": "https://pubmed.ncbi.nlm.nih.gov/29904948" }, { "database": "PubMed", "id": "29915371", "url": "https://pubmed.ncbi.nlm.nih.gov/29915371" }, { "database": "PubMed", "id": "29920512", "url": "https://pubmed.ncbi.nlm.nih.gov/29920512" }, { "database": "PubMed", "id": "29921768", "url": "https://pubmed.ncbi.nlm.nih.gov/29921768" }, { "database": "PubMed", "id": "29949238", "url": "https://pubmed.ncbi.nlm.nih.gov/29949238" }, { "database": "PubMed", "id": "29950561", "url": "https://pubmed.ncbi.nlm.nih.gov/29950561" }, { "database": "PubMed", "id": "29991802", "url": "https://pubmed.ncbi.nlm.nih.gov/29991802" }, { "database": "PubMed", "id": "29995595", "url": "https://pubmed.ncbi.nlm.nih.gov/29995595" }, { "database": "PubMed", "id": "30008594", "url": "https://pubmed.ncbi.nlm.nih.gov/30008594" }, { "database": "PubMed", "id": "30009856", "url": "https://pubmed.ncbi.nlm.nih.gov/30009856" }, { "database": "PubMed", "id": "30015159", "url": "https://pubmed.ncbi.nlm.nih.gov/30015159" }, { "database": "PubMed", "id": "30016456", "url": "https://pubmed.ncbi.nlm.nih.gov/30016456" }, { "database": "PubMed", "id": "30036966", "url": "https://pubmed.ncbi.nlm.nih.gov/30036966" }, { "database": "PubMed", "id": "30072687", "url": "https://pubmed.ncbi.nlm.nih.gov/30072687" }, { "database": "PubMed", "id": "30080291", "url": "https://pubmed.ncbi.nlm.nih.gov/30080291" }, { "database": "PubMed", "id": "30106087", "url": "https://pubmed.ncbi.nlm.nih.gov/30106087" }, { "database": "PubMed", "id": "30123428", "url": "https://pubmed.ncbi.nlm.nih.gov/30123428" }, { "database": "PubMed", "id": "30127373", "url": "https://pubmed.ncbi.nlm.nih.gov/30127373" }, { "database": "PubMed", "id": "30127519", "url": "https://pubmed.ncbi.nlm.nih.gov/30127519" }, { "database": "PubMed", "id": "30135074", "url": "https://pubmed.ncbi.nlm.nih.gov/30135074" }, { "database": "PubMed", "id": "30135654", "url": "https://pubmed.ncbi.nlm.nih.gov/30135654" }, { "database": "PubMed", "id": "30209389", "url": "https://pubmed.ncbi.nlm.nih.gov/30209389" }, { "database": "PubMed", "id": "30214513", "url": "https://pubmed.ncbi.nlm.nih.gov/30214513" }, { "database": "PubMed", "id": "30234199", "url": "https://pubmed.ncbi.nlm.nih.gov/30234199" }, { "database": "PubMed", "id": "30250641", "url": "https://pubmed.ncbi.nlm.nih.gov/30250641" }, { "database": "PubMed", "id": "30251272", "url": "https://pubmed.ncbi.nlm.nih.gov/30251272" }, { "database": "PubMed", "id": "30261753", "url": "https://pubmed.ncbi.nlm.nih.gov/30261753" }, { "database": "PubMed", "id": "30286779", "url": "https://pubmed.ncbi.nlm.nih.gov/30286779" }, { "database": "PubMed", "id": "30302278", "url": "https://pubmed.ncbi.nlm.nih.gov/30302278" }, { "database": "PubMed", "id": "30323565", "url": "https://pubmed.ncbi.nlm.nih.gov/30323565" }, { "database": "PubMed", "id": "30368518", "url": "https://pubmed.ncbi.nlm.nih.gov/30368518" }, { "database": "PubMed", "id": "30375708", "url": "https://pubmed.ncbi.nlm.nih.gov/30375708" }, { "database": "PubMed", "id": "30410767", "url": "https://pubmed.ncbi.nlm.nih.gov/30410767" }, { "database": "PubMed", "id": "30442941", "url": "https://pubmed.ncbi.nlm.nih.gov/30442941" }, { "database": "PubMed", "id": "30455690", "url": "https://pubmed.ncbi.nlm.nih.gov/30455690" }, { "database": "PubMed", "id": "30481203", "url": "https://pubmed.ncbi.nlm.nih.gov/30481203" }, { "database": "PubMed", "id": "30519314", "url": "https://pubmed.ncbi.nlm.nih.gov/30519314" }, { "database": "PubMed", "id": "30523261", "url": "https://pubmed.ncbi.nlm.nih.gov/30523261" }, { "database": "PubMed", "id": "30577812", "url": "https://pubmed.ncbi.nlm.nih.gov/30577812" }, { "database": "PubMed", "id": "30622543", "url": "https://pubmed.ncbi.nlm.nih.gov/30622543" }, { "database": "PubMed", "id": "30622697", "url": "https://pubmed.ncbi.nlm.nih.gov/30622697" }, { "database": "PubMed", "id": "30631031", "url": "https://pubmed.ncbi.nlm.nih.gov/30631031" }, { "database": "PubMed", "id": "30668440", "url": "https://pubmed.ncbi.nlm.nih.gov/30668440" }, { "database": "PubMed", "id": "30674340", "url": "https://pubmed.ncbi.nlm.nih.gov/30674340" }, { "database": "PubMed", "id": "30675525", "url": "https://pubmed.ncbi.nlm.nih.gov/30675525" }, { "database": "PubMed", "id": "30687322", "url": "https://pubmed.ncbi.nlm.nih.gov/30687322" }, { "database": "PubMed", "id": "30720080", "url": "https://pubmed.ncbi.nlm.nih.gov/30720080" }, { "database": "PubMed", "id": "30720090", "url": "https://pubmed.ncbi.nlm.nih.gov/30720090" }, { "database": "PubMed", "id": "30735121", "url": "https://pubmed.ncbi.nlm.nih.gov/30735121" }, { "database": "PubMed", "id": "30745853", "url": "https://pubmed.ncbi.nlm.nih.gov/30745853" }, { "database": "PubMed", "id": "30756445", "url": "https://pubmed.ncbi.nlm.nih.gov/30756445" }, { "database": "PubMed", "id": "30760703", "url": "https://pubmed.ncbi.nlm.nih.gov/30760703" }, { "database": "PubMed", "id": "30770798", "url": "https://pubmed.ncbi.nlm.nih.gov/30770798" }, { "database": "PubMed", "id": "30783489", "url": "https://pubmed.ncbi.nlm.nih.gov/30783489" }, { "database": "PubMed", "id": "30787270", "url": "https://pubmed.ncbi.nlm.nih.gov/30787270" }, { "database": "PubMed", "id": "30810286", "url": "https://pubmed.ncbi.nlm.nih.gov/30810286" }, { "database": "PubMed", "id": "30833574", "url": "https://pubmed.ncbi.nlm.nih.gov/30833574" }, { "database": "PubMed", "id": "30854231", "url": "https://pubmed.ncbi.nlm.nih.gov/30854231" }, { "database": "PubMed", "id": "30857539", "url": "https://pubmed.ncbi.nlm.nih.gov/30857539" }, { "database": "PubMed", "id": "30899371", "url": "https://pubmed.ncbi.nlm.nih.gov/30899371" }, { "database": "PubMed", "id": "30947697", "url": "https://pubmed.ncbi.nlm.nih.gov/30947697" }, { "database": "PubMed", "id": "30948493", "url": "https://pubmed.ncbi.nlm.nih.gov/30948493" }, { "database": "PubMed", "id": "30949204", "url": "https://pubmed.ncbi.nlm.nih.gov/30949204" }, { "database": "PubMed", "id": "30950039", "url": "https://pubmed.ncbi.nlm.nih.gov/30950039" }, { "database": "PubMed", "id": "30958597", "url": "https://pubmed.ncbi.nlm.nih.gov/30958597" }, { "database": "PubMed", "id": "30980700", "url": "https://pubmed.ncbi.nlm.nih.gov/30980700" }, { "database": "PubMed", "id": "30981183", "url": "https://pubmed.ncbi.nlm.nih.gov/30981183" }, { "database": "PubMed", "id": "30986607", "url": "https://pubmed.ncbi.nlm.nih.gov/30986607" }, { "database": "PubMed", "id": "31002364", "url": "https://pubmed.ncbi.nlm.nih.gov/31002364" }, { "database": "PubMed", "id": "31013746", "url": "https://pubmed.ncbi.nlm.nih.gov/31013746" }, { "database": "PubMed", "id": "31018021", "url": "https://pubmed.ncbi.nlm.nih.gov/31018021" }, { "database": "PubMed", "id": "31048139", "url": "https://pubmed.ncbi.nlm.nih.gov/31048139" }, { "database": "PubMed", "id": "31058868", "url": "https://pubmed.ncbi.nlm.nih.gov/31058868" }, { "database": "PubMed", "id": "31068940", "url": "https://pubmed.ncbi.nlm.nih.gov/31068940" }, { "database": "PubMed", "id": "31105997", "url": "https://pubmed.ncbi.nlm.nih.gov/31105997" }, { "database": "PubMed", "id": "31118769", "url": "https://pubmed.ncbi.nlm.nih.gov/31118769" }, { "database": "PubMed", "id": "31129031", "url": "https://pubmed.ncbi.nlm.nih.gov/31129031" }, { "database": "PubMed", "id": "31182137", "url": "https://pubmed.ncbi.nlm.nih.gov/31182137" }, { "database": "PubMed", "id": "31198634", "url": "https://pubmed.ncbi.nlm.nih.gov/31198634" }, { "database": "PubMed", "id": "31201357", "url": "https://pubmed.ncbi.nlm.nih.gov/31201357" }, { "database": "PubMed", "id": "31205408", "url": "https://pubmed.ncbi.nlm.nih.gov/31205408" }, { "database": "PubMed", "id": "31213027", "url": "https://pubmed.ncbi.nlm.nih.gov/31213027" }, { "database": "PubMed", "id": "31226168", "url": "https://pubmed.ncbi.nlm.nih.gov/31226168" }, { "database": "PubMed", "id": "31227842", "url": "https://pubmed.ncbi.nlm.nih.gov/31227842" }, { "database": "PubMed", "id": "31277507", "url": "https://pubmed.ncbi.nlm.nih.gov/31277507" }, { "database": "PubMed", "id": "31277685", "url": "https://pubmed.ncbi.nlm.nih.gov/31277685" }, { "database": "PubMed", "id": "31284599", "url": "https://pubmed.ncbi.nlm.nih.gov/31284599" }, { "database": "PubMed", "id": "31285546", "url": "https://pubmed.ncbi.nlm.nih.gov/31285546" }, { "database": "PubMed", "id": "31306849", "url": "https://pubmed.ncbi.nlm.nih.gov/31306849" }, { "database": "PubMed", "id": "31319869", "url": "https://pubmed.ncbi.nlm.nih.gov/31319869" }, { "database": "PubMed", "id": "31323961", "url": "https://pubmed.ncbi.nlm.nih.gov/31323961" }, { "database": "PubMed", "id": "31337063", "url": "https://pubmed.ncbi.nlm.nih.gov/31337063" }, { "database": "PubMed", "id": "31337349", "url": "https://pubmed.ncbi.nlm.nih.gov/31337349" }, { "database": "PubMed", "id": "31337843", "url": "https://pubmed.ncbi.nlm.nih.gov/31337843" }, { "database": "PubMed", "id": "31361391", "url": "https://pubmed.ncbi.nlm.nih.gov/31361391" }, { "database": "PubMed", "id": "31361777", "url": "https://pubmed.ncbi.nlm.nih.gov/31361777" }, { "database": "PubMed", "id": "31372043", "url": "https://pubmed.ncbi.nlm.nih.gov/31372043" }, { "database": "PubMed", "id": "31375423", "url": "https://pubmed.ncbi.nlm.nih.gov/31375423" }, { "database": "PubMed", "id": "31383893", "url": "https://pubmed.ncbi.nlm.nih.gov/31383893" }, { "database": "PubMed", "id": "31390744", "url": "https://pubmed.ncbi.nlm.nih.gov/31390744" }, { "database": "PubMed", "id": "31409371", "url": "https://pubmed.ncbi.nlm.nih.gov/31409371" }, { "database": "PubMed", "id": "31412593", "url": "https://pubmed.ncbi.nlm.nih.gov/31412593" }, { "database": "PubMed", "id": "31422383", "url": "https://pubmed.ncbi.nlm.nih.gov/31422383" }, { "database": "PubMed", "id": "31438472", "url": "https://pubmed.ncbi.nlm.nih.gov/31438472" }, { "database": "PubMed", "id": "31438567", "url": "https://pubmed.ncbi.nlm.nih.gov/31438567" }, { "database": "PubMed", "id": "31448054", "url": "https://pubmed.ncbi.nlm.nih.gov/31448054" }, { "database": "PubMed", "id": "31455240", "url": "https://pubmed.ncbi.nlm.nih.gov/31455240" }, { "database": "PubMed", "id": "31465777", "url": "https://pubmed.ncbi.nlm.nih.gov/31465777" }, { "database": "PubMed", "id": "31500219", "url": "https://pubmed.ncbi.nlm.nih.gov/31500219" }, { "database": "PubMed", "id": "31511071", "url": "https://pubmed.ncbi.nlm.nih.gov/31511071" }, { "database": "PubMed", "id": "31530281", "url": "https://pubmed.ncbi.nlm.nih.gov/31530281" }, { "database": "PubMed", "id": "31537377", "url": "https://pubmed.ncbi.nlm.nih.gov/31537377" }, { "database": "PubMed", "id": "31568643", "url": "https://pubmed.ncbi.nlm.nih.gov/31568643" }, { "database": "PubMed", "id": "31573734", "url": "https://pubmed.ncbi.nlm.nih.gov/31573734" }, { "database": "PubMed", "id": "31575007", "url": "https://pubmed.ncbi.nlm.nih.gov/31575007" }, { "database": "PubMed", "id": "31597912", "url": "https://pubmed.ncbi.nlm.nih.gov/31597912" }, { "database": "PubMed", "id": "31616177", "url": "https://pubmed.ncbi.nlm.nih.gov/31616177" }, { "database": "PubMed", "id": "31655629", "url": "https://pubmed.ncbi.nlm.nih.gov/31655629" }, { "database": "PubMed", "id": "31695791", "url": "https://pubmed.ncbi.nlm.nih.gov/31695791" }, { "database": "PubMed", "id": "31709178", "url": "https://pubmed.ncbi.nlm.nih.gov/31709178" }, { "database": "PubMed", "id": "31744223", "url": "https://pubmed.ncbi.nlm.nih.gov/31744223" }, { "database": "PubMed", "id": "31750256", "url": "https://pubmed.ncbi.nlm.nih.gov/31750256" }, { "database": "PubMed", "id": "31760402", "url": "https://pubmed.ncbi.nlm.nih.gov/31760402" }, { "database": "PubMed", "id": "31765941", "url": "https://pubmed.ncbi.nlm.nih.gov/31765941" }, { "database": "PubMed", "id": "31781039", "url": "https://pubmed.ncbi.nlm.nih.gov/31781039" }, { "database": "PubMed", "id": "31816634", "url": "https://pubmed.ncbi.nlm.nih.gov/31816634" }, { "database": "PubMed", "id": "31817171", "url": "https://pubmed.ncbi.nlm.nih.gov/31817171" }, { "database": "PubMed", "id": "31847229", "url": "https://pubmed.ncbi.nlm.nih.gov/31847229" }, { "database": "PubMed", "id": "31878046", "url": "https://pubmed.ncbi.nlm.nih.gov/31878046" }, { "database": "PubMed", "id": "31888532", "url": "https://pubmed.ncbi.nlm.nih.gov/31888532" }, { "database": "PubMed", "id": "31894334", "url": "https://pubmed.ncbi.nlm.nih.gov/31894334" }, { "database": "PubMed", "id": "31900385", "url": "https://pubmed.ncbi.nlm.nih.gov/31900385" }, { "database": "PubMed", "id": "31908417", "url": "https://pubmed.ncbi.nlm.nih.gov/31908417" }, { "database": "PubMed", "id": "31920333", "url": "https://pubmed.ncbi.nlm.nih.gov/31920333" }, { "database": "PubMed", "id": "31936807", "url": "https://pubmed.ncbi.nlm.nih.gov/31936807" }, { "database": "PubMed", "id": "31938049", "url": "https://pubmed.ncbi.nlm.nih.gov/31938049" }, { "database": "PubMed", "id": "31956373", "url": "https://pubmed.ncbi.nlm.nih.gov/31956373" }, { "database": "PubMed", "id": "31980595", "url": "https://pubmed.ncbi.nlm.nih.gov/31980595" }, { "database": "PubMed", "id": "31990532", "url": "https://pubmed.ncbi.nlm.nih.gov/31990532" }, { "database": "PubMed", "id": "32005797", "url": "https://pubmed.ncbi.nlm.nih.gov/32005797" }, { "database": "PubMed", "id": "32005799", "url": "https://pubmed.ncbi.nlm.nih.gov/32005799" }, { "database": "PubMed", "id": "32021288", "url": "https://pubmed.ncbi.nlm.nih.gov/32021288" }, { "database": "PubMed", "id": "32029900", "url": "https://pubmed.ncbi.nlm.nih.gov/32029900" }, { "database": "PubMed", "id": "32051479", "url": "https://pubmed.ncbi.nlm.nih.gov/32051479" }, { "database": "PubMed", "id": "32054489", "url": "https://pubmed.ncbi.nlm.nih.gov/32054489" }, { "database": "PubMed", "id": "32071920", "url": "https://pubmed.ncbi.nlm.nih.gov/32071920" }, { "database": "PubMed", "id": "32080166", "url": "https://pubmed.ncbi.nlm.nih.gov/32080166" }, { "database": "PubMed", "id": "32150979", "url": "https://pubmed.ncbi.nlm.nih.gov/32150979" }, { "database": "PubMed", "id": "32164483", "url": "https://pubmed.ncbi.nlm.nih.gov/32164483" }, { "database": "PubMed", "id": "32171124", "url": "https://pubmed.ncbi.nlm.nih.gov/32171124" }, { "database": "PubMed", "id": "32182833", "url": "https://pubmed.ncbi.nlm.nih.gov/32182833" }, { "database": "PubMed", "id": "32188095", "url": "https://pubmed.ncbi.nlm.nih.gov/32188095" }, { "database": "PubMed", "id": "32242230", "url": "https://pubmed.ncbi.nlm.nih.gov/32242230" }, { "database": "PubMed", "id": "32252311", "url": "https://pubmed.ncbi.nlm.nih.gov/32252311" }, { "database": "PubMed", "id": "32257917", "url": "https://pubmed.ncbi.nlm.nih.gov/32257917" }, { "database": "PubMed", "id": "32273843", "url": "https://pubmed.ncbi.nlm.nih.gov/32273843" }, { "database": "PubMed", "id": "32365859", "url": "https://pubmed.ncbi.nlm.nih.gov/32365859" }, { "database": "PubMed", "id": "32391256", "url": "https://pubmed.ncbi.nlm.nih.gov/32391256" }, { "database": "PubMed", "id": "32422984", "url": "https://pubmed.ncbi.nlm.nih.gov/32422984" }, { "database": "PubMed", "id": "32450513", "url": "https://pubmed.ncbi.nlm.nih.gov/32450513" }, { "database": "PubMed", "id": "32456348", "url": "https://pubmed.ncbi.nlm.nih.gov/32456348" }, { "database": "PubMed", "id": "32475380", "url": "https://pubmed.ncbi.nlm.nih.gov/32475380" }, { "database": "PubMed", "id": "32483468", "url": "https://pubmed.ncbi.nlm.nih.gov/32483468" }, { "database": "PubMed", "id": "32491253", "url": "https://pubmed.ncbi.nlm.nih.gov/32491253" }, { "database": "PubMed", "id": "32495998", "url": "https://pubmed.ncbi.nlm.nih.gov/32495998" }, { "database": "PubMed", "id": "32517717", "url": "https://pubmed.ncbi.nlm.nih.gov/32517717" }, { "database": "PubMed", "id": "32526010", "url": "https://pubmed.ncbi.nlm.nih.gov/32526010" }, { "database": "PubMed", "id": "32528731", "url": "https://pubmed.ncbi.nlm.nih.gov/32528731" }, { "database": "PubMed", "id": "32580970", "url": "https://pubmed.ncbi.nlm.nih.gov/32580970" }, { "database": "PubMed", "id": "32587662", "url": "https://pubmed.ncbi.nlm.nih.gov/32587662" }, { "database": "PubMed", "id": "32589311", "url": "https://pubmed.ncbi.nlm.nih.gov/32589311" }, { "database": "PubMed", "id": "32641029", "url": "https://pubmed.ncbi.nlm.nih.gov/32641029" }, { "database": "PubMed", "id": "32657763", "url": "https://pubmed.ncbi.nlm.nih.gov/32657763" }, { "database": "PubMed", "id": "32667731", "url": "https://pubmed.ncbi.nlm.nih.gov/32667731" }, { "database": "PubMed", "id": "32716315", "url": "https://pubmed.ncbi.nlm.nih.gov/32716315" }, { "database": "PubMed", "id": "32721246", "url": "https://pubmed.ncbi.nlm.nih.gov/32721246" }, { "database": "PubMed", "id": "32735617", "url": "https://pubmed.ncbi.nlm.nih.gov/32735617" }, { "database": "PubMed", "id": "32751884", "url": "https://pubmed.ncbi.nlm.nih.gov/32751884" }, { "database": "PubMed", "id": "32754441", "url": "https://pubmed.ncbi.nlm.nih.gov/32754441" }, { "database": "PubMed", "id": "32766155", "url": "https://pubmed.ncbi.nlm.nih.gov/32766155" }, { "database": "PubMed", "id": "32767999", "url": "https://pubmed.ncbi.nlm.nih.gov/32767999" }, { "database": "PubMed", "id": "32807795", "url": "https://pubmed.ncbi.nlm.nih.gov/32807795" }, { "database": "PubMed", "id": "32811873", "url": "https://pubmed.ncbi.nlm.nih.gov/32811873" }, { "database": "PubMed", "id": "32850477", "url": "https://pubmed.ncbi.nlm.nih.gov/32850477" }, { "database": "PubMed", "id": "32852592", "url": "https://pubmed.ncbi.nlm.nih.gov/32852592" }, { "database": "PubMed", "id": "32863764", "url": "https://pubmed.ncbi.nlm.nih.gov/32863764" }, { "database": "PubMed", "id": "32868906", "url": "https://pubmed.ncbi.nlm.nih.gov/32868906" }, { "database": "PubMed", "id": "32877289", "url": "https://pubmed.ncbi.nlm.nih.gov/32877289" }, { "database": "PubMed", "id": "32885530", "url": "https://pubmed.ncbi.nlm.nih.gov/32885530" }, { "database": "PubMed", "id": "32908147", "url": "https://pubmed.ncbi.nlm.nih.gov/32908147" }, { "database": "PubMed", "id": "32922036", "url": "https://pubmed.ncbi.nlm.nih.gov/32922036" }, { "database": "PubMed", "id": "32929201", "url": "https://pubmed.ncbi.nlm.nih.gov/32929201" }, { "database": "PubMed", "id": "32961646", "url": "https://pubmed.ncbi.nlm.nih.gov/32961646" }, { "database": "PubMed", "id": "32971907", "url": "https://pubmed.ncbi.nlm.nih.gov/32971907" }, { "database": "PubMed", "id": "32972460", "url": "https://pubmed.ncbi.nlm.nih.gov/32972460" }, { "database": "PubMed", "id": "32973302", "url": "https://pubmed.ncbi.nlm.nih.gov/32973302" }, { "database": "PubMed", "id": "33015502", "url": "https://pubmed.ncbi.nlm.nih.gov/33015502" }, { "database": "PubMed", "id": "33038372", "url": "https://pubmed.ncbi.nlm.nih.gov/33038372" }, { "database": "PubMed", "id": "33040485", "url": "https://pubmed.ncbi.nlm.nih.gov/33040485" }, { "database": "PubMed", "id": "33042115", "url": "https://pubmed.ncbi.nlm.nih.gov/33042115" }, { "database": "PubMed", "id": "33053804", "url": "https://pubmed.ncbi.nlm.nih.gov/33053804" }, { "database": "PubMed", "id": "33061855", "url": "https://pubmed.ncbi.nlm.nih.gov/33061855" }, { "database": "PubMed", "id": "33066004", "url": "https://pubmed.ncbi.nlm.nih.gov/33066004" }, { "database": "PubMed", "id": "33101052", "url": "https://pubmed.ncbi.nlm.nih.gov/33101052" }, { "database": "PubMed", "id": "33140053", "url": "https://pubmed.ncbi.nlm.nih.gov/33140053" }, { "database": "PubMed", "id": "33144502", "url": "https://pubmed.ncbi.nlm.nih.gov/33144502" }, { "database": "PubMed", "id": "33164240", "url": "https://pubmed.ncbi.nlm.nih.gov/33164240" }, { "database": "PubMed", "id": "33174044", "url": "https://pubmed.ncbi.nlm.nih.gov/33174044" }, { "database": "PubMed", "id": "33178223", "url": "https://pubmed.ncbi.nlm.nih.gov/33178223" }, { "database": "PubMed", "id": "33193827", "url": "https://pubmed.ncbi.nlm.nih.gov/33193827" }, { "database": "PubMed", "id": "33217668", "url": "https://pubmed.ncbi.nlm.nih.gov/33217668" }, { "database": "PubMed", "id": "33249747", "url": "https://pubmed.ncbi.nlm.nih.gov/33249747" }, { "database": "PubMed", "id": "33257655", "url": "https://pubmed.ncbi.nlm.nih.gov/33257655" }, { "database": "PubMed", "id": "33259114", "url": "https://pubmed.ncbi.nlm.nih.gov/33259114" }, { "database": "PubMed", "id": "33262462", "url": "https://pubmed.ncbi.nlm.nih.gov/33262462" }, { "database": "PubMed", "id": "33274592", "url": "https://pubmed.ncbi.nlm.nih.gov/33274592" }, { "database": "PubMed", "id": "33277798", "url": "https://pubmed.ncbi.nlm.nih.gov/33277798" }, { "database": "PubMed", "id": "33279931", "url": "https://pubmed.ncbi.nlm.nih.gov/33279931" }, { "database": "PubMed", "id": "33281966", "url": "https://pubmed.ncbi.nlm.nih.gov/33281966" }, { "database": "PubMed", "id": "33291686", "url": "https://pubmed.ncbi.nlm.nih.gov/33291686" }, { "database": "PubMed", "id": "33293765", "url": "https://pubmed.ncbi.nlm.nih.gov/33293765" }, { "database": "PubMed", "id": "33380422", "url": "https://pubmed.ncbi.nlm.nih.gov/33380422" }, { "database": "PubMed", "id": "33391507", "url": "https://pubmed.ncbi.nlm.nih.gov/33391507" }, { "database": "PubMed", "id": "33392396", "url": "https://pubmed.ncbi.nlm.nih.gov/33392396" }, { "database": "PubMed", "id": "33420372", "url": "https://pubmed.ncbi.nlm.nih.gov/33420372" }, { "database": "PubMed", "id": "33440995", "url": "https://pubmed.ncbi.nlm.nih.gov/33440995" }, { "database": "PubMed", "id": "33448097", "url": "https://pubmed.ncbi.nlm.nih.gov/33448097" }, { "database": "PubMed", "id": "33450849", "url": "https://pubmed.ncbi.nlm.nih.gov/33450849" }, { "database": "PubMed", "id": "33469308", "url": "https://pubmed.ncbi.nlm.nih.gov/33469308" }, { "database": "PubMed", "id": "33513694", "url": "https://pubmed.ncbi.nlm.nih.gov/33513694" }, { "database": "PubMed", "id": "33517393", "url": "https://pubmed.ncbi.nlm.nih.gov/33517393" }, { "database": "PubMed", "id": "33529218", "url": "https://pubmed.ncbi.nlm.nih.gov/33529218" }, { "database": "PubMed", "id": "33541421", "url": "https://pubmed.ncbi.nlm.nih.gov/33541421" }, { "database": "PubMed", "id": "33640759", "url": "https://pubmed.ncbi.nlm.nih.gov/33640759" }, { "database": "PubMed", "id": "33658640", "url": "https://pubmed.ncbi.nlm.nih.gov/33658640" }, { "database": "PubMed", "id": "33660414", "url": "https://pubmed.ncbi.nlm.nih.gov/33660414" }, { "database": "PubMed", "id": "33669259", "url": "https://pubmed.ncbi.nlm.nih.gov/33669259" }, { "database": "PubMed", "id": "33669634", "url": "https://pubmed.ncbi.nlm.nih.gov/33669634" }, { "database": "PubMed", "id": "33772065", "url": "https://pubmed.ncbi.nlm.nih.gov/33772065" }, { "database": "PubMed", "id": "33818016", "url": "https://pubmed.ncbi.nlm.nih.gov/33818016" }, { "database": "PubMed", "id": "33824475", "url": "https://pubmed.ncbi.nlm.nih.gov/33824475" }, { "database": "PubMed", "id": "33839684", "url": "https://pubmed.ncbi.nlm.nih.gov/33839684" }, { "database": "PubMed", "id": "33909625", "url": "https://pubmed.ncbi.nlm.nih.gov/33909625" }, { "database": "PubMed", "id": "33920736", "url": "https://pubmed.ncbi.nlm.nih.gov/33920736" }, { "database": "PubMed", "id": "33924087", "url": "https://pubmed.ncbi.nlm.nih.gov/33924087" }, { "database": "PubMed", "id": "33968084", "url": "https://pubmed.ncbi.nlm.nih.gov/33968084" }, { "database": "PubMed", "id": "33986510", "url": "https://pubmed.ncbi.nlm.nih.gov/33986510" }, { "database": "PubMed", "id": "34067421", "url": "https://pubmed.ncbi.nlm.nih.gov/34067421" }, { "database": "PubMed", "id": "34440160", "url": "https://pubmed.ncbi.nlm.nih.gov/34440160" }, { "database": "PubMed", "id": "34908808", "url": "https://pubmed.ncbi.nlm.nih.gov/34908808" }, { "database": "PubMed", "id": "35131454", "url": "https://pubmed.ncbi.nlm.nih.gov/35131454" }, { "database": "PubMed", "id": "35184394", "url": "https://pubmed.ncbi.nlm.nih.gov/35184394" }, { "database": "PubMed", "id": "35200033", "url": "https://pubmed.ncbi.nlm.nih.gov/35200033" }, { "database": "PubMed", "id": "35476936", "url": "https://pubmed.ncbi.nlm.nih.gov/35476936" }, { "database": "PubMed", "id": "35566660", "url": "https://pubmed.ncbi.nlm.nih.gov/35566660" }, { "database": "PubMed", "id": "35670018", "url": "https://pubmed.ncbi.nlm.nih.gov/35670018" }, { "database": "PubMed", "id": "35712699", "url": "https://pubmed.ncbi.nlm.nih.gov/35712699" }, { "database": "PubMed", "id": "35722967", "url": "https://pubmed.ncbi.nlm.nih.gov/35722967" }, { "database": "PubMed", "id": "35756080", "url": "https://pubmed.ncbi.nlm.nih.gov/35756080" }, { "database": "PubMed", "id": "35809767", "url": "https://pubmed.ncbi.nlm.nih.gov/35809767" }, { "database": "PubMed", "id": "35932642", "url": "https://pubmed.ncbi.nlm.nih.gov/35932642" }, { "database": "PubMed", "id": "36017196", "url": "https://pubmed.ncbi.nlm.nih.gov/36017196" }, { "database": "PubMed", "id": "36068200", "url": "https://pubmed.ncbi.nlm.nih.gov/36068200" }, { "database": "PubMed", "id": "36103247", "url": "https://pubmed.ncbi.nlm.nih.gov/36103247" }, { "database": "PubMed", "id": "36179418", "url": "https://pubmed.ncbi.nlm.nih.gov/36179418" }, { "database": "PubMed", "id": "36207761", "url": "https://pubmed.ncbi.nlm.nih.gov/36207761" }, { "database": "PubMed", "id": "36282975", "url": "https://pubmed.ncbi.nlm.nih.gov/36282975" }, { "database": "PubMed", "id": "36362294", "url": "https://pubmed.ncbi.nlm.nih.gov/36362294" }, { "database": "PubMed", "id": "9531474", "url": "https://pubmed.ncbi.nlm.nih.gov/9531474" }, { "database": "PubMed", "id": "12637586", "url": "https://pubmed.ncbi.nlm.nih.gov/12637586" }, { "database": "PubMed", "id": "15592455", "url": "https://pubmed.ncbi.nlm.nih.gov/15592455" }, { "database": "PubMed", "id": "16568091", "url": "https://pubmed.ncbi.nlm.nih.gov/16568091" }, { "database": "PubMed", "id": "21135090", "url": "https://pubmed.ncbi.nlm.nih.gov/21135090" }, { "database": "PubMed", "id": "22306293", "url": "https://pubmed.ncbi.nlm.nih.gov/22306293" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "26293184", "url": "https://pubmed.ncbi.nlm.nih.gov/26293184" }, { "database": "PubMed", "id": "31899195", "url": "https://pubmed.ncbi.nlm.nih.gov/31899195" } ], "site_lbl": "Tyr705", "uniprot_canonical_ac": "P40763-1" } ], "record_id": "pubmed.33541421", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZDHHC15 as a candidate gene for autism spectrum disorder.", "journal": "American journal of medical genetics. Part A", "date": "2022-12-23", "authors": "Casellas-Vidal Dolors, Mademont-Soler Irene, S\u00e1nchez Joana, Plaja Alberto, Castells Neus, Cam\u00f3s Maria, Nieto-Moragas Javier, Del Mar Garc\u00eda Maria, Rodriguez-Solera Celia, Rivera Helena, Brunet Joan, \u00c1lvarez Sara, Perapoch Josep, Queralt Xavier, Ob\u00f3n Mar\u00eda", "reference": { "type": "PubMed", "id": "36565021", "url": "https://pubmed.ncbi.nlm.nih.gov/36565021" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MV8-1", "protein_name": "Palmitoyltransferase ZDHHC15", "gene_name": "ZDHHC15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MV8", "url": "https://www.uniprot.org/uniprotkb/Q96MV8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36565021", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ZDHHC15 promotes glioma malignancy and acts as a novel prognostic biomarker for patients with glioma.", "journal": "BMC cancer", "date": "2023-05-09", "authors": "Liu Zhen-Yuan, Lan Tian, Tang Feng, He Yong-Ze, Liu Jin-Sheng, Yang Jin-Zhou, Chen Xi, Wang Ze-Fen, Li Zhi-Qiang", "reference": { "type": "PubMed", "id": "37161425", "url": "https://pubmed.ncbi.nlm.nih.gov/37161425" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q96MV8-1", "protein_name": "Palmitoyltransferase ZDHHC15", "gene_name": "ZDHHC15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q96MV8", "url": "https://www.uniprot.org/uniprotkb/Q96MV8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37161425", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "High-resolution localization of 69 potential human zinc finger protein genes: a number are clustered.", "journal": "Genomics", "date": "1992", "authors": "Hoovers J M, Mannens M, John R, Bliek J, van Heyningen V, Porteous D J, Leschot N J, Westerveld A, Little P F", "reference": { "type": "PubMed", "id": "1740334", "url": "https://pubmed.ncbi.nlm.nih.gov/1740334" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NSJ1-1", "protein_name": "Putative zinc finger protein 355P", "gene_name": "ZNF355P", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IYN0-1", "protein_name": "Zinc finger protein 100", "gene_name": "ZNF100", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NSJ1", "url": "https://www.uniprot.org/uniprotkb/Q9NSJ1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1740334", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Zbtb4 represses transcription of P21CIP1 and controls the cellular response to p53 activation.", "journal": "The EMBO journal", "date": "2008", "authors": "Weber A, Marquardt J, Elzi D, Forster N, Starke S, Glaum A, Yamada D, Defossez PA, Delrow J, Eisenman RN, Christiansen H, Eilers M", "reference": { "type": "PubMed", "id": "18451802", "url": "https://pubmed.ncbi.nlm.nih.gov/18451802" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P1Z0-1", "protein_name": "Zinc finger and BTB domain-containing protein 4", "gene_name": "ZBTB4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P1Z0", "url": "https://www.uniprot.org/uniprotkb/Q9P1Z0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18451802", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MicroRNA-301b-3p accelerates the growth of gastric cancer cells by targeting zinc finger and BTB domain containing 4.", "journal": "Pathology, research and practice", "date": "2019", "authors": "Fan H, Jin X, Liao C, Qiao L, Zhao W", "reference": { "type": "PubMed", "id": "31585814", "url": "https://pubmed.ncbi.nlm.nih.gov/31585814" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P1Z0-1", "protein_name": "Zinc finger and BTB domain-containing protein 4", "gene_name": "ZBTB4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P1Z0", "url": "https://www.uniprot.org/uniprotkb/Q9P1Z0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.31585814", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Suppression of lncRNA MALAT1 reduces pro-inflammatory cytokines production by regulating miR-150-5p/ZBTB4 axis through JAK/STAT signal pathway in systemic juvenile idiopathic arthritis.", "journal": "Cytokine", "date": "2021", "authors": "Jiang H, Zhu M, Wang H, Liu H", "reference": { "type": "PubMed", "id": "33341002", "url": "https://pubmed.ncbi.nlm.nih.gov/33341002" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P1Z0-1", "protein_name": "Zinc finger and BTB domain-containing protein 4", "gene_name": "ZBTB4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P1Z0", "url": "https://www.uniprot.org/uniprotkb/Q9P1Z0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33341002", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "miRNA-576-5p promotes endometrial cancer cell growth and metastasis by targeting ZBTB4.", "journal": "Clinical & translational oncology : official publication of the Federation of Spanish Oncology Societies and of the National Cancer Institute of Mexico", "date": "2022-12-20", "authors": "Chen Chen, Zhang Qing, Kong Beihua", "reference": { "type": "PubMed", "id": "36538280", "url": "https://pubmed.ncbi.nlm.nih.gov/36538280" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P1Z0-1", "protein_name": "Zinc finger and BTB domain-containing protein 4", "gene_name": "ZBTB4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P1Z0", "url": "https://www.uniprot.org/uniprotkb/Q9P1Z0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36538280", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of ZBTB4 as an immunological biomarker that can inhibit the proliferation and invasion of pancreatic cancer.", "journal": "BMC cancer", "date": "2023-03-22", "authors": "Yang Zhe, Chen Feiran, Wang Feng, Chen Xiubing, Zheng Biaolin, Liao Xiaomin, Deng Zhejun, Ruan Xianxian, Ning Jing, Li Qing, Jiang Haixing, Qin Shanyu", "reference": { "type": "PubMed", "id": "36949454", "url": "https://pubmed.ncbi.nlm.nih.gov/36949454" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P1Z0-1", "protein_name": "Zinc finger and BTB domain-containing protein 4", "gene_name": "ZBTB4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P1Z0", "url": "https://www.uniprot.org/uniprotkb/Q9P1Z0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36949454", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RoXaN, a novel cellular protein containing TPR, LD, and zinc finger motifs, forms a ternary complex with eukaryotic initiation factor 4G and rotavirus NSP3.", "journal": "Journal of virology", "date": "2004", "authors": "Vitour D, Lindenbaum P, Vende P, Becker MM, Poncet D", "reference": { "type": "PubMed", "id": "15047801", "url": "https://pubmed.ncbi.nlm.nih.gov/15047801" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGR2-1", "protein_name": "Zinc finger CCCH domain-containing protein 7B", "gene_name": "ZC3H7B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGR2", "url": "https://www.uniprot.org/uniprotkb/Q9UGR2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 241, "end_pos": 243, "sequence_org": "DSS", "sequence_mut": "AAA", "comment": "Almost no effect on NSP3 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q9UGR2", "url": "https://www.uniprot.org/uniprotkb/Q9UGR2" }, { "database": "PubMed", "id": "15047801", "url": "https://pubmed.ncbi.nlm.nih.gov/15047801" } ], "uniprot_canonical_ac": "Q9UGR2-1" }, { "start_pos": 252, "end_pos": 254, "sequence_org": "LDD", "sequence_mut": "AAA", "comment": "Complete loss of NSP3 binding.", "evidence": [ { "database": "UniProtKB", "id": "Q9UGR2", "url": "https://www.uniprot.org/uniprotkb/Q9UGR2" }, { "database": "PubMed", "id": "15047801", "url": "https://pubmed.ncbi.nlm.nih.gov/15047801" } ], "uniprot_canonical_ac": "Q9UGR2-1" } ], "record_id": "pubmed.15047801", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fusion of the ZC3H7B and BCOR genes in endometrial stromal sarcomas carrying an X;22-translocation.", "journal": "Genes, chromosomes & cancer", "date": "2013", "authors": "Panagopoulos I, Thorsen J, Gorunova L, Haugom L, Bjerkehagen B, Davidson B, Heim S, Micci F", "reference": { "type": "PubMed", "id": "23580382", "url": "https://pubmed.ncbi.nlm.nih.gov/23580382" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGR2-1", "protein_name": "Zinc finger CCCH domain-containing protein 7B", "gene_name": "ZC3H7B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGR2", "url": "https://www.uniprot.org/uniprotkb/Q9UGR2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23580382", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel ZC3H7B-BCOR, MEAF6-PHF1, and EPC1-PHF1 fusions in ossifying fibromyxoid tumors--molecular characterization shows genetic overlap with endometrial stromal sarcoma.", "journal": "Genes, chromosomes & cancer", "date": "2014", "authors": "Antonescu CR, Sung YS, Chen CL, Zhang L, Chen HW, Singer S, Agaram NP, Sboner A, Fletcher CD", "reference": { "type": "PubMed", "id": "24285434", "url": "https://pubmed.ncbi.nlm.nih.gov/24285434" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGR2-1", "protein_name": "Zinc finger CCCH domain-containing protein 7B", "gene_name": "ZC3H7B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGR2", "url": "https://www.uniprot.org/uniprotkb/Q9UGR2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24285434", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel BCOR-MAML3 and ZC3H7B-BCOR Gene Fusions in Undifferentiated Small Blue Round Cell Sarcomas.", "journal": "The American journal of surgical pathology", "date": "2016", "authors": "Specht K, Zhang L, Sung YS, Nucci M, Dry S, Vaiyapuri S, Richter GH, Fletcher CD, Antonescu CR", "reference": { "type": "PubMed", "id": "26752546", "url": "https://pubmed.ncbi.nlm.nih.gov/26752546" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGR2-1", "protein_name": "Zinc finger CCCH domain-containing protein 7B", "gene_name": "ZC3H7B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGR2", "url": "https://www.uniprot.org/uniprotkb/Q9UGR2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26752546", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel High-grade Endometrial Stromal Sarcoma: A Morphologic Mimicker of Myxoid Leiomyosarcoma.", "journal": "The American journal of surgical pathology", "date": "2017", "authors": "Hoang LN, Aneja A, Conlon N, Delair DF, Middha S, Benayed R, Hensley ML, Park KJ, Hollmann TJ, Hameed MR, Antonescu CR, Soslow RA, Chiang S", "reference": { "type": "PubMed", "id": "27631520", "url": "https://pubmed.ncbi.nlm.nih.gov/27631520" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGR2-1", "protein_name": "Zinc finger CCCH domain-containing protein 7B", "gene_name": "ZC3H7B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGR2", "url": "https://www.uniprot.org/uniprotkb/Q9UGR2" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27631520", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning, characterization, and chromosomal assignment of the human ortholog of murine Zfp-37, a candidate gene for Nager syndrome.", "journal": "Mamm. Genome", "date": "1998", "authors": "Dreyer SD, Zhou L, Machado MA, Horton WA, Zabel B, Winterpacht A, Lee B", "reference": { "type": "PubMed", "id": "9585434", "url": "https://pubmed.ncbi.nlm.nih.gov/9585434" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9Y6Q3-1", "protein_name": "Zinc finger protein 37 homolog", "gene_name": "ZFP37", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9Y6Q3", "url": "https://www.uniprot.org/uniprotkb/Q9Y6Q3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9585434", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteogenomic analysis to identify missing proteins from haploid cell lines.", "journal": "Proteomics", "date": "2018", "authors": "Lee Seung-Eun, Song JongKeon, B\u00f6sl Korbinian, M\u00fcller Andr\u00e9 C, Vitko Dijana, Bennett Keiryn L, Superti-Furga Giulio, Pandey Akhilesh, Kandasamy Richard K, Kim Min-Sik", "reference": { "type": "PubMed", "id": "29474001", "url": "https://pubmed.ncbi.nlm.nih.gov/29474001" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0A0U1RRL7-1", "protein_name": "Protein MMP24OS", "gene_name": "MMP24OS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A0U1RRL7", "url": "https://www.uniprot.org/uniprotkb/A0A0U1RRL7" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29474001", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and Characterization of CD300H, a New Member of the Human CD300 Immunoreceptor Family.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Niizuma K, Tahara-Hanaoka S, Noguchi E, Shibuya A", "reference": { "type": "PubMed", "id": "26221034", "url": "https://pubmed.ncbi.nlm.nih.gov/26221034" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0A0K2S4Q6-1", "protein_name": "Protein CD300H", "gene_name": "CD300H", "tax_name": "Human" }, { "uniprot_canonical_ac": "O43914-1", "protein_name": "TYRO protein tyrosine kinase-binding protein", "gene_name": "TYROBP", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBK5-1", "protein_name": "Hematopoietic cell signal transducer", "gene_name": "HCST", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A0K2S4Q6", "url": "https://www.uniprot.org/uniprotkb/A0A0K2S4Q6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26221034", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of the Vdelta domain of a human gammadelta T-cell antigen receptor.", "journal": "Nature", "date": "1998", "authors": "Li H, Lebedeva M I, Llera A S, Fields B A, Brenner M B, Mariuzza R A", "reference": { "type": "PubMed", "id": "9461220", "url": "https://pubmed.ncbi.nlm.nih.gov/9461220" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0JD37-1", "protein_name": "T cell receptor delta variable 3", "gene_name": "TRDV3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0JD37", "url": "https://www.uniprot.org/uniprotkb/A0JD37" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9461220", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homozygosity for a stop-gain variant in CCDC201 causes primary ovarian insufficiency.", "journal": "Nature genetics", "date": "2024-09", "authors": "Oddsson Asmundur, Steinthorsdottir Valgerdur, Oskarsson Gudjon R, Styrkarsdottir Unnur, Moore Kristjan H S, Isberg Salvor, Halldorsson Gisli H, Sveinbjornsson Gardar, Westergaard David, Nielsen Henriette Svarre, Fridriksdottir Run, Jensson Brynjar O, Arnadottir Gudny A, Jonsson Hakon, Sturluson Arni, Snaebjarnarson Audunn S, Andreassen Ole A, Walters G Bragi, Nyegaard Mette, Erikstrup Christian, Steingrimsdottir Thora, Lie Rolv T, Melsted Pall, Jonsdottir Ingileif, Halldorsson Bjarni V, Thorleifsson Gudmar, Saemundsdottir Jona, Magnusson Olafur Th, , Banasik Karina, Sorensen Erik, Masson Gisli, Pedersen Ole Birger, Tryggvadottir Laufey, Haavik Jan, Ostrowski Sisse Rye, Stefansson Hreinn, Holm Hilma, Rafnar Thorunn, Gudbjartsson Daniel F, Sulem Patrick, Stefansson Kari", "reference": { "type": "PubMed", "id": "39192094", "url": "https://pubmed.ncbi.nlm.nih.gov/39192094" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A0A1B0GTI1-1", "protein_name": "Coiled-coil domain-containing protein 201", "gene_name": "CCDC201", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A0A1B0GTI1", "url": "https://www.uniprot.org/uniprotkb/A0A1B0GTI1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39192094", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human endothelin converting enzyme-2 (ECE2): characterization of mRNA species and chromosomal localization.", "journal": "Biochim. Biophys. Acta", "date": "2001", "authors": "Lorenzo MN, Khan RY, Wang Y, Tai SC, Chan GC, Cheung AH, Marsden PA", "reference": { "type": "PubMed", "id": "11718899", "url": "https://pubmed.ncbi.nlm.nih.gov/11718899" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DPD6-4", "protein_name": "Endothelin-converting enzyme 2", "gene_name": "ECE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0DPD8-1", "protein_name": "EEF1AKMT4-ECE2 readthrough transcript protein", "gene_name": "EEF1AKMT4-ECE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPD6", "url": "https://www.uniprot.org/uniprotkb/P0DPD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11718899", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of endothelin-converting enzyme-2. Implication for a role in the nonclassical processing of regulatory peptides.", "journal": "The Journal of biological chemistry", "date": "2003-04-25", "authors": "Mzhavia Nino, Pan Hui, Che Fa-Yun, Fricker Lloyd D, Devi Lakshmi A", "reference": { "type": "PubMed", "id": "12560336", "url": "https://pubmed.ncbi.nlm.nih.gov/12560336" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DPD6-4", "protein_name": "Endothelin-converting enzyme 2", "gene_name": "ECE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPD6", "url": "https://www.uniprot.org/uniprotkb/P0DPD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12560336", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Polymorphism in endothelin-related genes limits exercise-induced decreases in arterial stiffness in older subjects.", "journal": "Hypertension (Dallas, Tex. : 1979)", "date": "2006", "authors": "Iemitsu M, Maeda S, Otsuki T, Sugawara J, Tanabe T, Jesmin S, Kuno S, Ajisaka R, Miyauchi T, Matsuda M", "reference": { "type": "PubMed", "id": "16567585", "url": "https://pubmed.ncbi.nlm.nih.gov/16567585" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DPD6-4", "protein_name": "Endothelin-converting enzyme 2", "gene_name": "ECE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPD6", "url": "https://www.uniprot.org/uniprotkb/P0DPD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16567585", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alterations in immunological and neurological gene expression patterns in Alzheimer's disease tissues.", "journal": "Experimental cell research", "date": "2007", "authors": "Weeraratna AT, Kalehua A, Deleon I, Bertak D, Maher G, Wade MS, Lustig A, Becker KG, Wood W 3rd, Walker DG, Beach TG, Taub DD", "reference": { "type": "PubMed", "id": "17188679", "url": "https://pubmed.ncbi.nlm.nih.gov/17188679" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DPD6-4", "protein_name": "Endothelin-converting enzyme 2", "gene_name": "ECE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPD6", "url": "https://www.uniprot.org/uniprotkb/P0DPD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17188679", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endothelin-converting enzymes degrade alpha-synuclein and are reduced in dementia with Lewy bodies.", "journal": "Journal of neurochemistry", "date": "2017", "authors": "Miners JS, Love S", "reference": { "type": "PubMed", "id": "28171705", "url": "https://pubmed.ncbi.nlm.nih.gov/28171705" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DPD6-4", "protein_name": "Endothelin-converting enzyme 2", "gene_name": "ECE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P37840-1", "protein_name": "Alpha-synuclein", "gene_name": "SNCA", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPD6", "url": "https://www.uniprot.org/uniprotkb/P0DPD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 129, "end_pos": 129, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by GRK2, PLK2, CK2, CK1 and GRK5", "evidence": [ { "database": "UniProtKB", "id": "P37840", "url": "https://www.uniprot.org/uniprotkb/P37840" }, { "database": "iPTMnet", "id": "P37840", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P37840" }, { "database": "PubMed", "id": "10617630", "url": "https://pubmed.ncbi.nlm.nih.gov/10617630" }, { "database": "PubMed", "id": "10852916", "url": "https://pubmed.ncbi.nlm.nih.gov/10852916" }, { "database": "IEDB", "id": "P37840", "url": "https://www.iedb.org/epitope/P37840" }, { "database": "PubMed", "id": "34648304", "url": "https://pubmed.ncbi.nlm.nih.gov/34648304" }, { "database": "PubMed", "id": "17868672", "url": "https://pubmed.ncbi.nlm.nih.gov/17868672" }, { "database": "PubMed", "id": "18451726", "url": "https://pubmed.ncbi.nlm.nih.gov/18451726" }, { "database": "PubMed", "id": "16092093", "url": "https://pubmed.ncbi.nlm.nih.gov/16092093" }, { "database": "PubMed", "id": "17146290", "url": "https://pubmed.ncbi.nlm.nih.gov/17146290" }, { "database": "PubMed", "id": "18562315", "url": "https://pubmed.ncbi.nlm.nih.gov/18562315" }, { "database": "PubMed", "id": "19203374", "url": "https://pubmed.ncbi.nlm.nih.gov/19203374" }, { "database": "PubMed", "id": "19410557", "url": "https://pubmed.ncbi.nlm.nih.gov/19410557" }, { "database": "PubMed", "id": "19493164", "url": "https://pubmed.ncbi.nlm.nih.gov/19493164" }, { "database": "PubMed", "id": "19576176", "url": "https://pubmed.ncbi.nlm.nih.gov/19576176" }, { "database": "PubMed", "id": "19855133", "url": "https://pubmed.ncbi.nlm.nih.gov/19855133" }, { "database": "PubMed", "id": "19889641", "url": "https://pubmed.ncbi.nlm.nih.gov/19889641" }, { "database": "PubMed", "id": "20725866", "url": "https://pubmed.ncbi.nlm.nih.gov/20725866" }, { "database": "PubMed", "id": "20849899", "url": "https://pubmed.ncbi.nlm.nih.gov/20849899" }, { "database": "PubMed", "id": "21162130", "url": "https://pubmed.ncbi.nlm.nih.gov/21162130" }, { "database": "PubMed", "id": "21945393", "url": "https://pubmed.ncbi.nlm.nih.gov/21945393" }, { "database": "PubMed", "id": "22090514", "url": "https://pubmed.ncbi.nlm.nih.gov/22090514" }, { "database": "PubMed", "id": "22357655", "url": "https://pubmed.ncbi.nlm.nih.gov/22357655" }, { "database": "PubMed", "id": "22860160", "url": "https://pubmed.ncbi.nlm.nih.gov/22860160" }, { "database": "PubMed", "id": "22892036", "url": "https://pubmed.ncbi.nlm.nih.gov/22892036" }, { "database": "PubMed", "id": "23314528", "url": "https://pubmed.ncbi.nlm.nih.gov/23314528" }, { "database": "PubMed", "id": "23576548", "url": "https://pubmed.ncbi.nlm.nih.gov/23576548" }, { "database": "PubMed", "id": "23677647", "url": "https://pubmed.ncbi.nlm.nih.gov/23677647" }, { "database": "PubMed", "id": "23681749", "url": "https://pubmed.ncbi.nlm.nih.gov/23681749" }, { "database": "PubMed", "id": "24434619", "url": "https://pubmed.ncbi.nlm.nih.gov/24434619" }, { "database": "PubMed", "id": "24860424", "url": "https://pubmed.ncbi.nlm.nih.gov/24860424" }, { "database": "PubMed", "id": "25109238", "url": "https://pubmed.ncbi.nlm.nih.gov/25109238" }, { "database": "PubMed", "id": "25394490", "url": "https://pubmed.ncbi.nlm.nih.gov/25394490" }, { "database": "PubMed", "id": "25452767", "url": "https://pubmed.ncbi.nlm.nih.gov/25452767" }, { "database": "PubMed", "id": "25589666", "url": "https://pubmed.ncbi.nlm.nih.gov/25589666" }, { "database": "PubMed", "id": "25637461", "url": "https://pubmed.ncbi.nlm.nih.gov/25637461" }, { "database": "PubMed", "id": "25657004", "url": "https://pubmed.ncbi.nlm.nih.gov/25657004" }, { "database": "PubMed", "id": "26114655", "url": "https://pubmed.ncbi.nlm.nih.gov/26114655" }, { "database": "PubMed", "id": "26220523", "url": "https://pubmed.ncbi.nlm.nih.gov/26220523" }, { "database": "PubMed", "id": "26306801", "url": "https://pubmed.ncbi.nlm.nih.gov/26306801" }, { "database": "PubMed", "id": "26346361", "url": "https://pubmed.ncbi.nlm.nih.gov/26346361" }, { "database": "PubMed", "id": "26453202", "url": "https://pubmed.ncbi.nlm.nih.gov/26453202" }, { "database": "PubMed", "id": "26475692", "url": "https://pubmed.ncbi.nlm.nih.gov/26475692" }, { "database": "PubMed", "id": "26666838", "url": "https://pubmed.ncbi.nlm.nih.gov/26666838" }, { "database": "PubMed", "id": "26719332", "url": "https://pubmed.ncbi.nlm.nih.gov/26719332" }, { "database": "PubMed", "id": "26782965", "url": "https://pubmed.ncbi.nlm.nih.gov/26782965" }, { "database": "PubMed", "id": "27003784", "url": "https://pubmed.ncbi.nlm.nih.gov/27003784" }, { "database": "PubMed", "id": "27030050", "url": "https://pubmed.ncbi.nlm.nih.gov/27030050" }, { "database": "PubMed", "id": "27322472", "url": "https://pubmed.ncbi.nlm.nih.gov/27322472" }, { "database": "PubMed", "id": "27341336", "url": "https://pubmed.ncbi.nlm.nih.gov/27341336" }, { "database": "PubMed", "id": "27863657", "url": "https://pubmed.ncbi.nlm.nih.gov/27863657" }, { "database": "PubMed", "id": "27938414", "url": "https://pubmed.ncbi.nlm.nih.gov/27938414" }, { "database": "PubMed", "id": "28171705", "url": "https://pubmed.ncbi.nlm.nih.gov/28171705" }, { "database": "PubMed", "id": "28550528", "url": "https://pubmed.ncbi.nlm.nih.gov/28550528" }, { "database": "PubMed", "id": "28855681", "url": "https://pubmed.ncbi.nlm.nih.gov/28855681" }, { "database": "PubMed", "id": "28877262", "url": "https://pubmed.ncbi.nlm.nih.gov/28877262" }, { "database": "PubMed", "id": "28990084", "url": "https://pubmed.ncbi.nlm.nih.gov/28990084" }, { "database": "PubMed", "id": "29589283", "url": "https://pubmed.ncbi.nlm.nih.gov/29589283" }, { "database": "PubMed", "id": "29669601", "url": "https://pubmed.ncbi.nlm.nih.gov/29669601" }, { "database": "PubMed", "id": "29725300", "url": "https://pubmed.ncbi.nlm.nih.gov/29725300" }, { "database": "PubMed", "id": "30096435", "url": "https://pubmed.ncbi.nlm.nih.gov/30096435" }, { "database": "PubMed", "id": "30219847", "url": "https://pubmed.ncbi.nlm.nih.gov/30219847" }, { "database": "PubMed", "id": "30478174", "url": "https://pubmed.ncbi.nlm.nih.gov/30478174" }, { "database": "PubMed", "id": "30805666", "url": "https://pubmed.ncbi.nlm.nih.gov/30805666" }, { "database": "PubMed", "id": "30877431", "url": "https://pubmed.ncbi.nlm.nih.gov/30877431" }, { "database": "PubMed", "id": "31068782", "url": "https://pubmed.ncbi.nlm.nih.gov/31068782" }, { "database": "PubMed", "id": "31257259", "url": "https://pubmed.ncbi.nlm.nih.gov/31257259" }, { "database": "PubMed", "id": "31507364", "url": "https://pubmed.ncbi.nlm.nih.gov/31507364" }, { "database": "PubMed", "id": "31555088", "url": "https://pubmed.ncbi.nlm.nih.gov/31555088" }, { "database": "PubMed", "id": "32143619", "url": "https://pubmed.ncbi.nlm.nih.gov/32143619" }, { "database": "PubMed", "id": "32356200", "url": "https://pubmed.ncbi.nlm.nih.gov/32356200" }, { "database": "PubMed", "id": "32426502", "url": "https://pubmed.ncbi.nlm.nih.gov/32426502" }, { "database": "PubMed", "id": "32568772", "url": "https://pubmed.ncbi.nlm.nih.gov/32568772" }, { "database": "PubMed", "id": "32595456", "url": "https://pubmed.ncbi.nlm.nih.gov/32595456" }, { "database": "PubMed", "id": "32624505", "url": "https://pubmed.ncbi.nlm.nih.gov/32624505" }, { "database": "PubMed", "id": "32971383", "url": "https://pubmed.ncbi.nlm.nih.gov/32971383" }, { "database": "PubMed", "id": "33138150", "url": "https://pubmed.ncbi.nlm.nih.gov/33138150" }, { "database": "PubMed", "id": "33357908", "url": "https://pubmed.ncbi.nlm.nih.gov/33357908" }, { "database": "PubMed", "id": "33718373", "url": "https://pubmed.ncbi.nlm.nih.gov/33718373" }, { "database": "PubMed", "id": "34220490", "url": "https://pubmed.ncbi.nlm.nih.gov/34220490" }, { "database": "PubMed", "id": "34973339", "url": "https://pubmed.ncbi.nlm.nih.gov/34973339" }, { "database": "PubMed", "id": "34974168", "url": "https://pubmed.ncbi.nlm.nih.gov/34974168" }, { "database": "PubMed", "id": "35682892", "url": "https://pubmed.ncbi.nlm.nih.gov/35682892" }, { "database": "PubMed", "id": "35853942", "url": "https://pubmed.ncbi.nlm.nih.gov/35853942" }, { "database": "PubMed", "id": "35905887", "url": "https://pubmed.ncbi.nlm.nih.gov/35905887" }, { "database": "PubMed", "id": "36114228", "url": "https://pubmed.ncbi.nlm.nih.gov/36114228" }, { "database": "PubMed", "id": "36304930", "url": "https://pubmed.ncbi.nlm.nih.gov/36304930" }, { "database": "PubMed", "id": "11813001", "url": "https://pubmed.ncbi.nlm.nih.gov/11813001" }, { "database": "PubMed", "id": "24936070", "url": "https://pubmed.ncbi.nlm.nih.gov/24936070" } ], "site_lbl": "Ser129", "uniprot_canonical_ac": "P37840-1" } ], "record_id": "pubmed.28171705", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of endothelin-converting enzyme-2 as an autoantigen in autoimmune polyendocrine syndrome type 1.", "journal": "Autoimmunity", "date": "2017", "authors": "Smith-Anttila CJA, Bensing S, Alimohammadi M, Dalin F, Oscarson M, Zhang MD, Perheentupa J, Husebye ES, Gustafsson J, Bjorklund P, Fransson A, Nordmark G, Ronnblom L, Meloni A, Scott RJ, Hokfelt T, Crock PA, Kampe O", "reference": { "type": "PubMed", "id": "28557628", "url": "https://pubmed.ncbi.nlm.nih.gov/28557628" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DPD6-4", "protein_name": "Endothelin-converting enzyme 2", "gene_name": "ECE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPD6", "url": "https://www.uniprot.org/uniprotkb/P0DPD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28557628", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of Alzheimer's disease-associated rare coding variants in the ECE2 gene.", "journal": "JCI insight", "date": "2020", "authors": "Liao X, Cai F, Sun Z, Zhang Y, Wang J, Jiao B, Guo J, Li J, Liu X, Guo L, Zhou Y, Wang J, Yan X, Jiang H, Xia K, Li J, Tang B, Shen L, Song W", "reference": { "type": "PubMed", "id": "32102983", "url": "https://pubmed.ncbi.nlm.nih.gov/32102983" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P0DPD6-4", "protein_name": "Endothelin-converting enzyme 2", "gene_name": "ECE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P0DPD6", "url": "https://www.uniprot.org/uniprotkb/P0DPD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32102983", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]