[ { "title": "Crystal structure of human SCO1: implications for redox signaling by a mitochondrial cytochrome c oxidase `assembly` protein.", "journal": "The Journal of biological chemistry", "date": "2005-04-15", "authors": "Williams John C, Sue Carolyn, Banting Graham S, Yang Hua, Glerum D Moira, Hendrickson Wayne A, Schon Eric A", "reference": { "type": "PubMed", "id": "15659396", "url": "https://pubmed.ncbi.nlm.nih.gov/15659396" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75880-1", "protein_name": "Cytochrome c oxidase assembly factor SCO1", "gene_name": "SCO1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75880", "url": "https://www.uniprot.org/uniprotkb/O75880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15659396", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A hint for the function of human Sco1 from different structures.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006-06-06", "authors": "Banci Lucia, Bertini Ivano, Calderone Vito, Ciofi-Baffoni Simone, Mangani Stefano, Martinelli Manuele, Palumaa Peep, Wang Shenlin", "reference": { "type": "PubMed", "id": "16735468", "url": "https://pubmed.ncbi.nlm.nih.gov/16735468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75880-1", "protein_name": "Cytochrome c oxidase assembly factor SCO1", "gene_name": "SCO1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75880", "url": "https://www.uniprot.org/uniprotkb/O75880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16735468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Sco1 functional studies and pathological implications of the P174L mutant.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Banci L, Bertini I, Ciofi-Baffoni S, Leontari I, Martinelli M, Palumaa P, Sillard R, Wang S", "reference": { "type": "PubMed", "id": "17182746", "url": "https://pubmed.ncbi.nlm.nih.gov/17182746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75880-1", "protein_name": "Cytochrome c oxidase assembly factor SCO1", "gene_name": "SCO1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P81045-1", "protein_name": "Cytochrome c oxidase copper chaperone", "gene_name": "COX17", "tax_name": "Pig" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75880", "url": "https://www.uniprot.org/uniprotkb/O75880" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17182746", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in RNF135, a gene within the NF1 microdeletion region, cause phenotypic abnormalities including overgrowth.", "journal": "Nature genetics", "date": "2007", "authors": "Douglas J, Cilliers D, Coleman K, Tatton-Brown K, Barker K, Bernhard B, Burn J, Huson S, Josifova D, Lacombe D, Malik M, Mansour S, Reid E, Cormier-Daire V, Cole T, Rahman N", "reference": { "type": "PubMed", "id": "17632510", "url": "https://pubmed.ncbi.nlm.nih.gov/17632510" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IUD6", "url": "https://www.uniprot.org/uniprotkb/Q8IUD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17632510", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A pan-cancer analysis of ring finger protein 135 and its relationship to triple-negative breast cancer proliferation and metastasis.", "journal": "Aging", "date": "2022-12-10", "authors": "Yao Yiqun, Gong Guanyu, Guo Zijian, Zhang Dianlong", "reference": { "type": "PubMed", "id": "36495591", "url": "https://pubmed.ncbi.nlm.nih.gov/36495591" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IUD6", "url": "https://www.uniprot.org/uniprotkb/Q8IUD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36495591", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The E3 ubiquitin ligase RNF135 modulates chemotherapy resistance to oxaliplatin for colorectal cancer by modulating autophagy.", "journal": "Tissue & cell", "date": "2024-02", "authors": "Qiu Zhen, He Shuyan, Lu Boyi, Sun Yuejun, Zhang Ting, Lv Wei, Shen Dong", "reference": { "type": "PubMed", "id": "38056362", "url": "https://pubmed.ncbi.nlm.nih.gov/38056362" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IUD6", "url": "https://www.uniprot.org/uniprotkb/Q8IUD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38056362", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plasma methylated GNB4 and Riplet as a novel dual-marker panel for the detection of hepatocellular carcinoma.", "journal": "Epigenetics", "date": "2024-12", "authors": "Zhao Yanteng, Zhao Lei, Jin Huifang, Xie Ying, Chen Liyinghui, Zhang Wei, Dong Lanlan, Zhang Lianglu, Huang Yue, Wan Kangkang, Yang Qiankun, Wang Shaochi", "reference": { "type": "PubMed", "id": "38154055", "url": "https://pubmed.ncbi.nlm.nih.gov/38154055" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAV0-1", "protein_name": "Guanine nucleotide-binding protein subunit beta-4", "gene_name": "GNB4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IUD6", "url": "https://www.uniprot.org/uniprotkb/Q8IUD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38154055", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNF135 promotes cell proliferation and autophagy in lung adenocarcinoma by promoting the phosphorylation of ULK1.", "journal": "Allergologia et immunopathologia", "date": "2024", "authors": "Zhuang Lichun, Shi Guanhui, Sun Yuejun", "reference": { "type": "PubMed", "id": "38459884", "url": "https://pubmed.ncbi.nlm.nih.gov/38459884" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IUD6", "url": "https://www.uniprot.org/uniprotkb/Q8IUD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38459884", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNF135 Promotes Human Osteosarcoma Cell Growth and Inhibits Apoptosis by Upregulating the PI3K/AKT Pathway.", "journal": "Cancer reports (Hoboken, N.J.)", "date": "2024-08", "authors": "Chen Bingyao, Zhang Yinglong, Song Guangze, Wei Xing", "reference": { "type": "PubMed", "id": "39118262", "url": "https://pubmed.ncbi.nlm.nih.gov/39118262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IUD6-1", "protein_name": "E3 ubiquitin-protein ligase RNF135", "gene_name": "RNF135", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IUD6", "url": "https://www.uniprot.org/uniprotkb/Q8IUD6" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39118262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Single nucleotide polymorphisms in the coding regions of human CXC-chemokine receptors CXCR1, CXCR2 and CXCR3.", "journal": "Genes Immun.", "date": "2000", "authors": "Kato H, Tsuchiya N, Tokunaga K", "reference": { "type": "PubMed", "id": "11196695", "url": "https://pubmed.ncbi.nlm.nih.gov/11196695" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49682-1", "protein_name": "C-X-C chemokine receptor type 3", "gene_name": "CXCR3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25024-1", "protein_name": "C-X-C chemokine receptor type 1", "gene_name": "CXCR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11196695", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of two high affinity human interleukin-8 receptors.", "journal": "J. Biol. Chem.", "date": "1992", "authors": "Lee J, Horuk R, Rice GC, Bennett GL, Camerato T, Wood WI", "reference": { "type": "PubMed", "id": "1379593", "url": "https://pubmed.ncbi.nlm.nih.gov/1379593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25024-1", "protein_name": "C-X-C chemokine receptor type 1", "gene_name": "CXCR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1379593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Staphylococcus aureus Staphopain A inhibits CXCR2-dependent neutrophil activation and chemotaxis.", "journal": "The EMBO journal", "date": "2012", "authors": "Laarman AJ, Mijnheer G, Mootz JM, van Rooijen WJ, Ruyken M, Malone CL, Heezius EC, Ward R, Milligan G, van Strijp JA, de Haas CJ, Horswill AR, van Kessel KP, Rooijakkers SH", "reference": { "type": "PubMed", "id": "22850671", "url": "https://pubmed.ncbi.nlm.nih.gov/22850671" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22850671", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rare and low-frequency coding variants in CXCR2 and other genes are associated with hematological traits.", "journal": "Nat. Genet.", "date": "2014", "authors": "Auer Paul L, Teumer Alexander, Schick Ursula, O'Shaughnessy Andrew, Lo Ken Sin, Chami Nathalie, Carlson Chris, de Denus Simon, Dub\u00e9 Marie-Pierre, Haessler Jeff, Jackson Rebecca D, Kooperberg Charles, Perreault Louis-Philippe Lemieux, Nauck Matthias, Peters Ulrike, Rioux John D, Schmidt Frank, Turcot Val\u00e9rie, V\u00f6lker Uwe, V\u00f6lzke Henry, Greinacher Andreas, Hsu Li, Tardif Jean-Claude, Diaz George A, Reiner Alexander P, Lettre Guillaume", "reference": { "type": "PubMed", "id": "24777453", "url": "https://pubmed.ncbi.nlm.nih.gov/24777453" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24777453", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein visualization and manipulation in Drosophila through the use of epitope tags recognized by nanobodies.", "journal": "eLife", "date": "2022-01-25", "authors": "Xu Jun, Kim Ah-Ram, Cheloha Ross W, Fischer Fabian A, Li Joshua Shing Shun, Feng Yuan, Stoneburner Emily, Binari Richard, Mohr Stephanie E, Zirin Jonathan, Ploegh Hidde L, Perrimon Norbert", "reference": { "type": "PubMed", "id": "35076390", "url": "https://pubmed.ncbi.nlm.nih.gov/35076390" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35076390", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure, genomic organization, and expression of the human interleukin-8 receptor B gene.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Sprenger H, Lloyd A R, Lautens L L, Bonner T I, Kelvin D J", "reference": { "type": "PubMed", "id": "7512557", "url": "https://pubmed.ncbi.nlm.nih.gov/7512557" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7512557", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparison of the genomic organization and promoter function for human interleukin-8 receptors A and B.", "journal": "J. Biol. Chem.", "date": "1994", "authors": "Ahuja S K, Shetty A, Tiffany H L, Murphy P M", "reference": { "type": "PubMed", "id": "7929358", "url": "https://pubmed.ncbi.nlm.nih.gov/7929358" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25024-1", "protein_name": "C-X-C chemokine receptor type 1", "gene_name": "CXCR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7929358", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of receptors for human interleukin-8, GRO/melanoma growth-stimulatory activity and neutrophil activating peptide-2.", "journal": "Mol. Immunol.", "date": "1993", "authors": "Cerretti D P, Kozlosky C J, Vanden Bos T, Nelson N, Gearing D P, Beckmann M P", "reference": { "type": "PubMed", "id": "8384312", "url": "https://pubmed.ncbi.nlm.nih.gov/8384312" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25024-1", "protein_name": "C-X-C chemokine receptor type 1", "gene_name": "CXCR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8384312", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Physical association of Gi2alpha with interleukin-8 receptors.", "journal": "The Journal of biological chemistry", "date": "1996-05-31", "authors": "Damaj B B, McColl S R, Mahana W, Crouch M F, Naccache P H", "reference": { "type": "PubMed", "id": "8662698", "url": "https://pubmed.ncbi.nlm.nih.gov/8662698" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P04899-1", "protein_name": "Guanine nucleotide-binding protein G(i) subunit alpha-2", "gene_name": "GNAI2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P10145-1", "protein_name": "Interleukin-8", "gene_name": "CXCL8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P25024-1", "protein_name": "C-X-C chemokine receptor type 1", "gene_name": "CXCR1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8662698", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ligand-induced desensitization of the human CXC chemokine receptor-2 is modulated by multiple serine residues in the carboxyl-terminal domain of the receptor.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Mueller SG, White JR, Schraw WP, Lam V, Richmond A", "reference": { "type": "PubMed", "id": "9079638", "url": "https://pubmed.ncbi.nlm.nih.gov/9079638" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P25025-1", "protein_name": "C-X-C chemokine receptor type 2", "gene_name": "CXCR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 347, "end_pos": 347, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" }, { "database": "PubMed", "id": "9079638", "url": "https://pubmed.ncbi.nlm.nih.gov/9079638" }, { "database": "iPTMnet", "id": "P25025", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25025" } ], "site_lbl": "Ser347", "uniprot_canonical_ac": "P25025-1" }, { "start_pos": 351, "end_pos": 351, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" }, { "database": "PubMed", "id": "9079638", "url": "https://pubmed.ncbi.nlm.nih.gov/9079638" }, { "database": "iPTMnet", "id": "P25025", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25025" } ], "site_lbl": "Ser351", "uniprot_canonical_ac": "P25025-1" }, { "start_pos": 352, "end_pos": 352, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" }, { "database": "PubMed", "id": "9079638", "url": "https://pubmed.ncbi.nlm.nih.gov/9079638" }, { "database": "iPTMnet", "id": "P25025", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25025" } ], "site_lbl": "Ser352", "uniprot_canonical_ac": "P25025-1" }, { "start_pos": 353, "end_pos": 353, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P25025", "url": "https://www.uniprot.org/uniprotkb/P25025" }, { "database": "PubMed", "id": "9079638", "url": "https://pubmed.ncbi.nlm.nih.gov/9079638" }, { "database": "iPTMnet", "id": "P25025", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P25025" } ], "site_lbl": "Ser353", "uniprot_canonical_ac": "P25025-1" } ], "record_id": "pubmed.9079638", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The DNA double-strand break repair gene hMRE11 is mutated in individuals with an ataxia-telangiectasia-like disorder.", "journal": "Cell", "date": "1999", "authors": "Stewart GS, Maser RS, Stankovic T, Bressan DA, Kaplan MI, Jaspers NG, Raams A, Byrd PJ, Petrini JH, Taylor AM", "reference": { "type": "PubMed", "id": "10612394", "url": "https://pubmed.ncbi.nlm.nih.gov/10612394" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs137852760", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137852760" }, { "id": "rs137852760", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137852760" }, { "id": "rs137852760", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs137852760#frequency_tab" }, { "id": "rs137852760", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs137852760" }, { "id": "10612394", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10612394" }, { "id": "11371508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371508" }, { "id": "8684395", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8684395" }, { "id": "rs137852760", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs137852760" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 117, "end_pos": 117, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 filters: n-glyco-sequon-gain (NLN->NLS).", "chr_id": "11", "chr_pos": "94479726", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N117", "disease": [ { "disease_id": "DOID:0081384", "recommended_name": { "id": "DOID:0081384", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0081384", "name": "ataxia-telangiectasia-like disorder 1", "description": "An autosomal recessive cerebellar ataxia that is characterized clinically by progressive cerebellar degeneration resulting in ataxia and oculomotor apraxia and that has_material_basis_in homozygous or compound heterozygous mutation in the MRE11A gene (MRE11) on chromosome 11q21." }, "synonyms": [ { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder 1", "description": "Any ataxia-telangiectasia-like disorder in which the cause of the disease is a mutation in the MRE11 gene." }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "MRE11 ataxia - telangiectasia-like disorder", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "MRE11 ataxia-telangiectasia-like disorder", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia - telangiectasia-like disorder caused by mutation in MRE11", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder 1", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder caused by mutation in MRE11", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ATLD1", "description": "" }, { "id": "MIM:604391", "resource": "MIM", "url": "https://www.omim.org/entry/604391", "name": "Ataxia-telangiectasia-like disorder 1", "description": "Ataxia-telangiectasia-like disorder 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "604391", "database": "MIM", "url": "https://www.omim.org/entry/604391" }, { "id": "0081384", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081384" } ] } ], "keywords": [ "ebi", "somatic", "disease" ], "filter_code": "001000000000000000000.00000000000000.000000000001000000.00101.01.000.110", "uniprot_canonical_ac": "P49959-1" } ], "record_id": "pubmed.10612394", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Alterations of the double-strand break repair gene MRE11 in cancer.", "journal": "Cancer research", "date": "2001", "authors": "Fukuda T, Sumiyoshi T, Takahashi M, Kataoka T, Asahara T, Inui H, Watatani M, Yasutomi M, Kamada N, Miyagawa K", "reference": { "type": "PubMed", "id": "11196167", "url": "https://pubmed.ncbi.nlm.nih.gov/11196167" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11196167", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "hMRE11: genomic structure and a null mutation identified in a transcript protected from nonsense-mediated mRNA decay.", "journal": "Human molecular genetics", "date": "2001-05-15", "authors": "Pitts S A, Kullar H S, Stankovic T, Stewart G S, Last J I, Bedenham T, Armstrong S J, Piane M, Chessa L, Taylor A M, Byrd P J", "reference": { "type": "PubMed", "id": "11371508", "url": "https://pubmed.ncbi.nlm.nih.gov/11371508" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs137852760", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137852760" }, { "id": "rs137852760", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137852760" }, { "id": "rs137852760", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs137852760#frequency_tab" }, { "id": "rs137852760", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs137852760" }, { "id": "10612394", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10612394" }, { "id": "11371508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371508" }, { "id": "8684395", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8684395" }, { "id": "rs137852760", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs137852760" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 117, "end_pos": 117, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 filters: n-glyco-sequon-gain (NLN->NLS).", "chr_id": "11", "chr_pos": "94479726", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N117", "disease": [ { "disease_id": "DOID:0081384", "recommended_name": { "id": "DOID:0081384", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0081384", "name": "ataxia-telangiectasia-like disorder 1", "description": "An autosomal recessive cerebellar ataxia that is characterized clinically by progressive cerebellar degeneration resulting in ataxia and oculomotor apraxia and that has_material_basis_in homozygous or compound heterozygous mutation in the MRE11A gene (MRE11) on chromosome 11q21." }, "synonyms": [ { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder 1", "description": "Any ataxia-telangiectasia-like disorder in which the cause of the disease is a mutation in the MRE11 gene." }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "MRE11 ataxia - telangiectasia-like disorder", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "MRE11 ataxia-telangiectasia-like disorder", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia - telangiectasia-like disorder caused by mutation in MRE11", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder 1", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder caused by mutation in MRE11", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ATLD1", "description": "" }, { "id": "MIM:604391", "resource": "MIM", "url": "https://www.omim.org/entry/604391", "name": "Ataxia-telangiectasia-like disorder 1", "description": "Ataxia-telangiectasia-like disorder 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "604391", "database": "MIM", "url": "https://www.omim.org/entry/604391" }, { "id": "0081384", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081384" } ] } ], "keywords": [ "ebi", "somatic", "disease" ], "filter_code": "001000000000000000000.00000000000000.000000000001000000.00101.01.000.110", "uniprot_canonical_ac": "P49959-1" } ], "record_id": "pubmed.11371508", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Rad50/Mre11 is a flexible complex that can tether DNA ends.", "journal": "Molecular cell", "date": "2001-11", "authors": "de Jager M, van Noort J, van Gent D C, Dekker C, Kanaar R, Wyman C", "reference": { "type": "PubMed", "id": "11741547", "url": "https://pubmed.ncbi.nlm.nih.gov/11741547" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q92878-1", "protein_name": "DNA repair protein RAD50", "gene_name": "RAD50", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11741547", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Adenovirus oncoproteins inactivate the Mre11-Rad50-NBS1 DNA repair complex.", "journal": "Nature", "date": "2002-07-18", "authors": "Stracker Travis H, Carson Christian T, Weitzman Matthew D", "reference": { "type": "PubMed", "id": "12124628", "url": "https://pubmed.ncbi.nlm.nih.gov/12124628" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12124628", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Mre11 complex is required for ATM activation and the G2/M checkpoint.", "journal": "The EMBO journal", "date": "2003-12-15", "authors": "Carson Christian T, Schwartz Rachel A, Stracker Travis H, Lilley Caroline E, Lee Darwin V, Weitzman Matthew D", "reference": { "type": "PubMed", "id": "14657032", "url": "https://pubmed.ncbi.nlm.nih.gov/14657032" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14657032", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MRE11 mutations and impaired ATM-dependent responses in an Italian family with ataxia-telangiectasia-like disorder.", "journal": "Human molecular genetics", "date": "2004", "authors": "Delia D, Piane M, Buscemi G, Savio C, Palmeri S, Lulli P, Carlessi L, Fontanella E, Chessa L", "reference": { "type": "PubMed", "id": "15269180", "url": "https://pubmed.ncbi.nlm.nih.gov/15269180" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 1981, "end_pos": 1981, "kinase_uniprot_canonical_ac": "Q13315-1", "kinase_gene_name": "ATM", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13315", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13315" }, { "database": "PubMed", "id": "12556884", "url": "https://pubmed.ncbi.nlm.nih.gov/12556884" }, { "database": "PubMed", "id": "15159397", "url": "https://pubmed.ncbi.nlm.nih.gov/15159397" }, { "database": "PubMed", "id": "16293623", "url": "https://pubmed.ncbi.nlm.nih.gov/16293623" }, { "database": "PubMed", "id": "16858402", "url": "https://pubmed.ncbi.nlm.nih.gov/16858402" }, { "database": "PubMed", "id": "16906133", "url": "https://pubmed.ncbi.nlm.nih.gov/16906133" }, { "database": "PubMed", "id": "17486112", "url": "https://pubmed.ncbi.nlm.nih.gov/17486112" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "15269180", "url": "https://pubmed.ncbi.nlm.nih.gov/15269180" }, { "database": "PubMed", "id": "15498871", "url": "https://pubmed.ncbi.nlm.nih.gov/15498871" }, { "database": "PubMed", "id": "16426903", "url": "https://pubmed.ncbi.nlm.nih.gov/16426903" }, { "database": "PubMed", "id": "17200553", "url": "https://pubmed.ncbi.nlm.nih.gov/17200553" }, { "database": "PubMed", "id": "17998902", "url": "https://pubmed.ncbi.nlm.nih.gov/17998902" }, { "database": "PubMed", "id": "18515798", "url": "https://pubmed.ncbi.nlm.nih.gov/18515798" }, { "database": "PubMed", "id": "19431188", "url": "https://pubmed.ncbi.nlm.nih.gov/19431188" }, { "database": "PubMed", "id": "19583974", "url": "https://pubmed.ncbi.nlm.nih.gov/19583974" }, { "database": "PubMed", "id": "20026654", "url": "https://pubmed.ncbi.nlm.nih.gov/20026654" }, { "database": "PubMed", "id": "22653913", "url": "https://pubmed.ncbi.nlm.nih.gov/22653913" }, { "database": "PubMed", "id": "26097887", "url": "https://pubmed.ncbi.nlm.nih.gov/26097887" }, { "database": "PubMed", "id": "21149446", "url": "https://pubmed.ncbi.nlm.nih.gov/21149446" }, { "database": "UniProtKB", "id": "Q13315", "url": "https://www.uniprot.org/uniprotkb/Q13315" } ], "site_lbl": "Ser1981", "uniprot_canonical_ac": "Q13315-1" } ], "record_id": "pubmed.15269180", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and functional consequences of a novel MRE11 mutation affecting 10 Saudi Arabian patients with the ataxia telangiectasia-like disorder.", "journal": "Human molecular genetics", "date": "2005-01-15", "authors": "Fernet Marie, Gribaa Moez, Salih Mustafa A M, Seidahmed Mohamed Zein, Hall Janet, Koenig Michel", "reference": { "type": "PubMed", "id": "15574463", "url": "https://pubmed.ncbi.nlm.nih.gov/15574463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs137852763", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137852763" }, { "id": "rs137852763", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs137852763" }, { "id": "15574463", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15574463" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 210, "end_pos": 210, "sequence_org": "W", "sequence_mut": "C", "comment": "Germline mutation passed 1 filters: n-glyco-sequon-gain (NSW->NSC).", "chr_id": "11", "chr_pos": "94476318", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "W210", "disease": [ { "disease_id": "DOID:0081384", "recommended_name": { "id": "DOID:0081384", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0081384", "name": "ataxia-telangiectasia-like disorder 1", "description": "An autosomal recessive cerebellar ataxia that is characterized clinically by progressive cerebellar degeneration resulting in ataxia and oculomotor apraxia and that has_material_basis_in homozygous or compound heterozygous mutation in the MRE11A gene (MRE11) on chromosome 11q21." }, "synonyms": [ { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder 1", "description": "Any ataxia-telangiectasia-like disorder in which the cause of the disease is a mutation in the MRE11 gene." }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "MRE11 ataxia - telangiectasia-like disorder", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "MRE11 ataxia-telangiectasia-like disorder", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia - telangiectasia-like disorder caused by mutation in MRE11", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder 1", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder caused by mutation in MRE11", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ATLD1", "description": "" }, { "id": "MIM:604391", "resource": "MIM", "url": "https://www.omim.org/entry/604391", "name": "Ataxia-telangiectasia-like disorder 1", "description": "Ataxia-telangiectasia-like disorder 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "604391", "database": "MIM", "url": "https://www.omim.org/entry/604391" }, { "id": "0081384", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081384" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000000000000001000.00000000000000.000000000001000000.00001.10.000.100", "uniprot_canonical_ac": "P49959-1" } ], "record_id": "pubmed.15574463", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein kinase CK2 interacts with Chk2 and phosphorylates Mre11 on serine 649.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Kim ST", "reference": { "type": "PubMed", "id": "15845385", "url": "https://pubmed.ncbi.nlm.nih.gov/15845385" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 649, "end_pos": 649, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PLK1", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "iPTMnet", "id": "P49959", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49959" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "15845385", "url": "https://pubmed.ncbi.nlm.nih.gov/15845385" }, { "database": "PubMed", "id": "28512243", "url": "https://pubmed.ncbi.nlm.nih.gov/28512243" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" } ], "site_lbl": "Ser649", "uniprot_canonical_ac": "P49959-1" } ], "record_id": "pubmed.15845385", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ATM and ATR promote Mre11 dependent restart of collapsed replication forks and prevent accumulation of DNA breaks.", "journal": "The EMBO journal", "date": "2006-04-19", "authors": "Trenz Kristina, Smith Eloise, Smith Sarah, Costanzo Vincenzo", "reference": { "type": "PubMed", "id": "16601701", "url": "https://pubmed.ncbi.nlm.nih.gov/16601701" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16601701", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aberrations of the MRE11-RAD50-NBS1 DNA damage sensor complex in human breast cancer: MRE11 as a candidate familial cancer-predisposing gene.", "journal": "Molecular oncology", "date": "2008", "authors": "Bartkova J, Tommiska J, Oplustilova L, Aaltonen K, Tamminen A, Heikkinen T, Mistrik M, Aittomaki K, Blomqvist C, Heikkila P, Lukas J, Nevanlinna H, Bartek J", "reference": { "type": "PubMed", "id": "19383352", "url": "https://pubmed.ncbi.nlm.nih.gov/19383352" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19383352", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two brothers with ataxia-telangiectasia-like disorder with lung adenocarcinoma.", "journal": "The Journal of pediatrics", "date": "2009-09", "authors": "Uchisaka Naoki, Takahashi Naomi, Sato Masaki, Kikuchi Akira, Mochizuki Shinji, Imai Kohsuke, Nonoyama Shigeaki, Ohara Osamu, Watanabe Fumiaki, Mizutani Shuki, Hanada Ryoji, Morio Tomohiro", "reference": { "type": "PubMed", "id": "19732584", "url": "https://pubmed.ncbi.nlm.nih.gov/19732584" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19732584", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of human Mre11: understanding tumorigenic mutations.", "journal": "Structure (London, England : 1993)", "date": "2011-11-09", "authors": "Park Young Bong, Chae Jina, Kim Young Chang, Cho Yunje", "reference": { "type": "PubMed", "id": "22078559", "url": "https://pubmed.ncbi.nlm.nih.gov/22078559" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 117, "end_pos": 117, "sequence_org": "N", "sequence_mut": "L", "comment": "Abolished interaction with NBN.", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "22078559", "url": "https://pubmed.ncbi.nlm.nih.gov/22078559" } ], "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 121, "end_pos": 121, "sequence_org": "P", "sequence_mut": "G", "comment": "Abolished interaction with NBN.", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "22078559", "url": "https://pubmed.ncbi.nlm.nih.gov/22078559" } ], "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 80, "end_pos": 80, "sequence_org": "R", "sequence_mut": "A", "comment": "Abolished interaction with NBN.", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "22078559", "url": "https://pubmed.ncbi.nlm.nih.gov/22078559" } ], "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 87, "end_pos": 117, "sequence_org": "RPVQFEILSDQSVNFGFSKFPWVNYQDGNLN", "sequence_mut": "", "comment": "Abolished interaction with NBN.", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "22078559", "url": "https://pubmed.ncbi.nlm.nih.gov/22078559" } ], "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 88, "end_pos": 88, "sequence_org": "P", "sequence_mut": "W", "comment": "Does not affect interaction with NBN.", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "22078559", "url": "https://pubmed.ncbi.nlm.nih.gov/22078559" } ], "uniprot_canonical_ac": "P49959-1" } ], "record_id": "pubmed.22078559", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mre11 ATLD17/18 mutation retains Tel1/ATM activity but blocks DNA double-strand break repair.", "journal": "Nucleic acids research", "date": "2012-12", "authors": "Limbo Oliver, Moiani Davide, Kertokalio Aryandi, Wyman Claire, Tainer John A, Russell Paul", "reference": { "type": "PubMed", "id": "23080121", "url": "https://pubmed.ncbi.nlm.nih.gov/23080121" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12753-1", "protein_name": "DNA repair protein RAD50", "gene_name": "RAD50", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P32829-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 239, "end_pos": 239, "sequence_org": "W", "sequence_mut": "R", "comment": "Meiotic defects due to inability to DNA double-strand break repair. Decreased interaction with RAD50.", "evidence": [ { "database": "UniProtKB", "id": "P32829", "url": "https://www.uniprot.org/uniprotkb/P32829" }, { "database": "PubMed", "id": "23080121", "url": "https://pubmed.ncbi.nlm.nih.gov/23080121" } ], "uniprot_canonical_ac": "P32829-1" } ], "record_id": "pubmed.23080121", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA double-strand break repair pathway choice is directed by distinct MRE11 nuclease activities.", "journal": "Molecular cell", "date": "2014-01-09", "authors": "Shibata Atsushi, Moiani Davide, Arvai Andrew S, Perry Jefferson, Harding Shane M, Genois Marie-Michelle, Maity Ranjan, van Rossum-Fikkert Sari, Kertokalio Aryandi, Romoli Filippo, Ismail Amani, Ismalaj Ermal, Petricci Elena, Neale Matthew J, Bristow Robert G, Masson Jean-Yves, Wyman Claire, Jeggo Penny A, Tainer John A", "reference": { "type": "PubMed", "id": "24316220", "url": "https://pubmed.ncbi.nlm.nih.gov/24316220" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24316220", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Exome sequencing reveals a novel MRE11 mutation in a patient with progressive myoclonic ataxia.", "journal": "Journal of the neurological sciences", "date": "2014-02-15", "authors": "Miyamoto Ryosuke, Morino Hiroyuki, Yoshizawa Akio, Miyazaki Yoshimichi, Maruyama Hirofumi, Murakami Nagahisa, Fukada Kei, Izumi Yuishin, Matsuura Shinya, Kaji Ryuji, Kawakami Hideshi", "reference": { "type": "PubMed", "id": "24332946", "url": "https://pubmed.ncbi.nlm.nih.gov/24332946" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24332946", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ATM-dependent phosphorylation of MRE11 controls extent of resection during homology directed repair by signalling through Exonuclease 1.", "journal": "Nucleic acids research", "date": "2015", "authors": "Kijas AW, Lim YC, Bolderson E, Cerosaletti K, Gatei M, Jakob B, Tobias F, Taucher-Scholz G, Gueven N, Oakley G, Concannon P, Wolvetang E, Khanna KK, Wiesmuller L, Lavin MF", "reference": { "type": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 531, "end_pos": 531, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect phosphorylation by ATM; when associated with A-590.", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" } ], "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 590, "end_pos": 590, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not affect phosphorylation by ATM; when associated with A-531.", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" } ], "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 676, "end_pos": 678, "sequence_org": "SQS", "sequence_mut": "AQA", "comment": "Impaired phosphorylation by ATM, preventing interaction with C1QBP.", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" }, { "database": "PubMed", "id": "31353207", "url": "https://pubmed.ncbi.nlm.nih.gov/31353207" } ], "uniprot_canonical_ac": "P49959-1" } ], "phosphorylation": [ { "start_pos": 531, "end_pos": 531, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49959", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49959" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" } ], "site_lbl": "Ser531", "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 590, "end_pos": 590, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49959", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49959" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" } ], "site_lbl": "Ser590", "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 676, "end_pos": 676, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "iPTMnet", "id": "P49959", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49959" }, { "database": "PubMed", "id": "18077418", "url": "https://pubmed.ncbi.nlm.nih.gov/18077418" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" } ], "site_lbl": "Ser676", "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 678, "end_pos": 678, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by ATM", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "iPTMnet", "id": "P49959", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49959" }, { "database": "PubMed", "id": "17525332", "url": "https://pubmed.ncbi.nlm.nih.gov/17525332" }, { "database": "PubMed", "id": "18077418", "url": "https://pubmed.ncbi.nlm.nih.gov/18077418" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" } ], "site_lbl": "Ser678", "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 1981, "end_pos": 1981, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q13315", "url": "https://www.uniprot.org/uniprotkb/Q13315" }, { "database": "IntAct", "id": "Q13315", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13315*" }, { "database": "iPTMnet", "id": "Q13315", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13315" }, { "database": "PubMed", "id": "19851285", "url": "https://pubmed.ncbi.nlm.nih.gov/19851285" }, { "database": "PubMed", "id": "16858402", "url": "https://pubmed.ncbi.nlm.nih.gov/16858402" }, { "database": "PRO", "id": "Q13315", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q13315" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "12556884", "url": "https://pubmed.ncbi.nlm.nih.gov/12556884" }, { "database": "PubMed", "id": "14695167", "url": "https://pubmed.ncbi.nlm.nih.gov/14695167" }, { "database": "PubMed", "id": "14871926", "url": "https://pubmed.ncbi.nlm.nih.gov/14871926" }, { "database": "PubMed", "id": "15048089", "url": "https://pubmed.ncbi.nlm.nih.gov/15048089" }, { "database": "PubMed", "id": "15140942", "url": "https://pubmed.ncbi.nlm.nih.gov/15140942" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15177184", "url": "https://pubmed.ncbi.nlm.nih.gov/15177184" }, { "database": "PubMed", "id": "15269203", "url": "https://pubmed.ncbi.nlm.nih.gov/15269203" }, { "database": "PubMed", "id": "15313175", "url": "https://pubmed.ncbi.nlm.nih.gov/15313175" }, { "database": "PubMed", "id": "15314656", "url": "https://pubmed.ncbi.nlm.nih.gov/15314656" }, { "database": "PubMed", "id": "15489221", "url": "https://pubmed.ncbi.nlm.nih.gov/15489221" }, { "database": "PubMed", "id": "15510216", "url": "https://pubmed.ncbi.nlm.nih.gov/15510216" }, { "database": "PubMed", "id": "15846060", "url": "https://pubmed.ncbi.nlm.nih.gov/15846060" }, { "database": "PubMed", "id": "16293623", "url": "https://pubmed.ncbi.nlm.nih.gov/16293623" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16452482", "url": "https://pubmed.ncbi.nlm.nih.gov/16452482" }, { "database": "PubMed", "id": "16528719", "url": "https://pubmed.ncbi.nlm.nih.gov/16528719" }, { "database": "PubMed", "id": "16533058", "url": "https://pubmed.ncbi.nlm.nih.gov/16533058" }, { "database": "PubMed", "id": "16556909", "url": "https://pubmed.ncbi.nlm.nih.gov/16556909" }, { "database": "PubMed", "id": "16628011", "url": "https://pubmed.ncbi.nlm.nih.gov/16628011" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16861926", "url": "https://pubmed.ncbi.nlm.nih.gov/16861926" }, { "database": "PubMed", "id": "16906133", "url": "https://pubmed.ncbi.nlm.nih.gov/16906133" }, { "database": "PubMed", "id": "16940754", "url": "https://pubmed.ncbi.nlm.nih.gov/16940754" }, { "database": "PubMed", "id": "16997395", "url": "https://pubmed.ncbi.nlm.nih.gov/16997395" }, { "database": "PubMed", "id": "17016017", "url": "https://pubmed.ncbi.nlm.nih.gov/17016017" }, { "database": "PubMed", "id": "17124492", "url": "https://pubmed.ncbi.nlm.nih.gov/17124492" }, { "database": "PubMed", "id": "17406032", "url": "https://pubmed.ncbi.nlm.nih.gov/17406032" }, { "database": "PubMed", "id": "17486112", "url": "https://pubmed.ncbi.nlm.nih.gov/17486112" }, { "database": "PubMed", "id": "17638905", "url": "https://pubmed.ncbi.nlm.nih.gov/17638905" }, { "database": "PubMed", "id": "17700524", "url": "https://pubmed.ncbi.nlm.nih.gov/17700524" }, { "database": "PubMed", "id": "18048416", "url": "https://pubmed.ncbi.nlm.nih.gov/18048416" }, { "database": "PubMed", "id": "18059176", "url": "https://pubmed.ncbi.nlm.nih.gov/18059176" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18344987", "url": "https://pubmed.ncbi.nlm.nih.gov/18344987" }, { "database": "PubMed", "id": "18431490", "url": "https://pubmed.ncbi.nlm.nih.gov/18431490" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18571408", "url": "https://pubmed.ncbi.nlm.nih.gov/18571408" }, { "database": "PubMed", "id": "18593910", "url": "https://pubmed.ncbi.nlm.nih.gov/18593910" }, { "database": "PubMed", "id": "18596698", "url": "https://pubmed.ncbi.nlm.nih.gov/18596698" }, { "database": "PubMed", "id": "18619531", "url": "https://pubmed.ncbi.nlm.nih.gov/18619531" }, { "database": "PubMed", "id": "18663430", "url": "https://pubmed.ncbi.nlm.nih.gov/18663430" }, { "database": "PubMed", "id": "18762365", "url": "https://pubmed.ncbi.nlm.nih.gov/18762365" }, { "database": "PubMed", "id": "18959818", "url": "https://pubmed.ncbi.nlm.nih.gov/18959818" }, { "database": "PubMed", "id": "18985806", "url": "https://pubmed.ncbi.nlm.nih.gov/18985806" }, { "database": "PubMed", "id": "19401701", "url": "https://pubmed.ncbi.nlm.nih.gov/19401701" }, { "database": "PubMed", "id": "19411853", "url": "https://pubmed.ncbi.nlm.nih.gov/19411853" }, { "database": "PubMed", "id": "19451263", "url": "https://pubmed.ncbi.nlm.nih.gov/19451263" }, { "database": "PubMed", "id": "19605351", "url": "https://pubmed.ncbi.nlm.nih.gov/19605351" }, { "database": "PubMed", "id": "19621083", "url": "https://pubmed.ncbi.nlm.nih.gov/19621083" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19671522", "url": "https://pubmed.ncbi.nlm.nih.gov/19671522" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19798429", "url": "https://pubmed.ncbi.nlm.nih.gov/19798429" }, { "database": "PubMed", "id": "20014310", "url": "https://pubmed.ncbi.nlm.nih.gov/20014310" }, { "database": "PubMed", "id": "20126263", "url": "https://pubmed.ncbi.nlm.nih.gov/20126263" }, { "database": "PubMed", "id": "20205745", "url": "https://pubmed.ncbi.nlm.nih.gov/20205745" }, { "database": "PubMed", "id": "20660628", "url": "https://pubmed.ncbi.nlm.nih.gov/20660628" }, { "database": "PubMed", "id": "20678255", "url": "https://pubmed.ncbi.nlm.nih.gov/20678255" }, { "database": "PubMed", "id": "20700484", "url": "https://pubmed.ncbi.nlm.nih.gov/20700484" }, { "database": "PubMed", "id": "20711462", "url": "https://pubmed.ncbi.nlm.nih.gov/20711462" }, { "database": "PubMed", "id": "20959117", "url": "https://pubmed.ncbi.nlm.nih.gov/20959117" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "20978201", "url": "https://pubmed.ncbi.nlm.nih.gov/20978201" }, { "database": "PubMed", "id": "21078189", "url": "https://pubmed.ncbi.nlm.nih.gov/21078189" }, { "database": "PubMed", "id": "21157431", "url": "https://pubmed.ncbi.nlm.nih.gov/21157431" }, { "database": "PubMed", "id": "21219611", "url": "https://pubmed.ncbi.nlm.nih.gov/21219611" }, { "database": "PubMed", "id": "21292467", "url": "https://pubmed.ncbi.nlm.nih.gov/21292467" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21824286", "url": "https://pubmed.ncbi.nlm.nih.gov/21824286" }, { "database": "PubMed", "id": "21997193", "url": "https://pubmed.ncbi.nlm.nih.gov/21997193" }, { "database": "PubMed", "id": "22323184", "url": "https://pubmed.ncbi.nlm.nih.gov/22323184" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22493319", "url": "https://pubmed.ncbi.nlm.nih.gov/22493319" }, { "database": "PubMed", "id": "22498490", "url": "https://pubmed.ncbi.nlm.nih.gov/22498490" }, { "database": "PubMed", "id": "22655027", "url": "https://pubmed.ncbi.nlm.nih.gov/22655027" }, { "database": "PubMed", "id": "22739265", "url": "https://pubmed.ncbi.nlm.nih.gov/22739265" }, { "database": "PubMed", "id": "22761798", "url": "https://pubmed.ncbi.nlm.nih.gov/22761798" }, { "database": "PubMed", "id": "22837425", "url": "https://pubmed.ncbi.nlm.nih.gov/22837425" }, { "database": "PubMed", "id": "22841545", "url": "https://pubmed.ncbi.nlm.nih.gov/22841545" }, { "database": "PubMed", "id": "22952040", "url": "https://pubmed.ncbi.nlm.nih.gov/22952040" }, { "database": "PubMed", "id": "23146902", "url": "https://pubmed.ncbi.nlm.nih.gov/23146902" }, { "database": "PubMed", "id": "23166842", "url": "https://pubmed.ncbi.nlm.nih.gov/23166842" }, { "database": "PubMed", "id": "23185347", "url": "https://pubmed.ncbi.nlm.nih.gov/23185347" }, { "database": "PubMed", "id": "23193277", "url": "https://pubmed.ncbi.nlm.nih.gov/23193277" }, { "database": "PubMed", "id": "23365634", "url": "https://pubmed.ncbi.nlm.nih.gov/23365634" }, { "database": "PubMed", "id": "23383259", "url": "https://pubmed.ncbi.nlm.nih.gov/23383259" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23552604", "url": "https://pubmed.ncbi.nlm.nih.gov/23552604" }, { "database": "PubMed", "id": "23620287", "url": "https://pubmed.ncbi.nlm.nih.gov/23620287" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23900392", "url": "https://pubmed.ncbi.nlm.nih.gov/23900392" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24113180", "url": "https://pubmed.ncbi.nlm.nih.gov/24113180" }, { "database": "PubMed", "id": "24268576", "url": "https://pubmed.ncbi.nlm.nih.gov/24268576" }, { "database": "PubMed", "id": "24280901", "url": "https://pubmed.ncbi.nlm.nih.gov/24280901" }, { "database": "PubMed", "id": "24505404", "url": "https://pubmed.ncbi.nlm.nih.gov/24505404" }, { "database": "PubMed", "id": "24763056", "url": "https://pubmed.ncbi.nlm.nih.gov/24763056" }, { "database": "PubMed", "id": "24812435", "url": "https://pubmed.ncbi.nlm.nih.gov/24812435" }, { "database": "PubMed", "id": "24933654", "url": "https://pubmed.ncbi.nlm.nih.gov/24933654" }, { "database": "PubMed", "id": "24988892", "url": "https://pubmed.ncbi.nlm.nih.gov/24988892" }, { "database": "PubMed", "id": "25003995", "url": "https://pubmed.ncbi.nlm.nih.gov/25003995" }, { "database": "PubMed", "id": "25077176", "url": "https://pubmed.ncbi.nlm.nih.gov/25077176" }, { "database": "PubMed", "id": "25088203", "url": "https://pubmed.ncbi.nlm.nih.gov/25088203" }, { "database": "PubMed", "id": "25111195", "url": "https://pubmed.ncbi.nlm.nih.gov/25111195" }, { "database": "PubMed", "id": "25240135", "url": "https://pubmed.ncbi.nlm.nih.gov/25240135" }, { "database": "PubMed", "id": "25527123", "url": "https://pubmed.ncbi.nlm.nih.gov/25527123" }, { "database": "PubMed", "id": "25611382", "url": "https://pubmed.ncbi.nlm.nih.gov/25611382" }, { "database": "PubMed", "id": "25821946", "url": "https://pubmed.ncbi.nlm.nih.gov/25821946" }, { "database": "PubMed", "id": "25826455", "url": "https://pubmed.ncbi.nlm.nih.gov/25826455" }, { "database": "PubMed", "id": "25865756", "url": "https://pubmed.ncbi.nlm.nih.gov/25865756" }, { "database": "PubMed", "id": "25904696", "url": "https://pubmed.ncbi.nlm.nih.gov/25904696" }, { "database": "PubMed", "id": "25923214", "url": "https://pubmed.ncbi.nlm.nih.gov/25923214" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "26158765", "url": "https://pubmed.ncbi.nlm.nih.gov/26158765" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" }, { "database": "PubMed", "id": "26275218", "url": "https://pubmed.ncbi.nlm.nih.gov/26275218" }, { "database": "PubMed", "id": "26416514", "url": "https://pubmed.ncbi.nlm.nih.gov/26416514" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26438152", "url": "https://pubmed.ncbi.nlm.nih.gov/26438152" }, { "database": "PubMed", "id": "26517194", "url": "https://pubmed.ncbi.nlm.nih.gov/26517194" }, { "database": "PubMed", "id": "26517239", "url": "https://pubmed.ncbi.nlm.nih.gov/26517239" }, { "database": "PubMed", "id": "26556501", "url": "https://pubmed.ncbi.nlm.nih.gov/26556501" }, { "database": "PubMed", "id": "26677768", "url": "https://pubmed.ncbi.nlm.nih.gov/26677768" }, { "database": "PubMed", "id": "26683224", "url": "https://pubmed.ncbi.nlm.nih.gov/26683224" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26860083", "url": "https://pubmed.ncbi.nlm.nih.gov/26860083" }, { "database": "PubMed", "id": "26875667", "url": "https://pubmed.ncbi.nlm.nih.gov/26875667" }, { "database": "PubMed", "id": "26919204", "url": "https://pubmed.ncbi.nlm.nih.gov/26919204" }, { "database": "PubMed", "id": "27029031", "url": "https://pubmed.ncbi.nlm.nih.gov/27029031" }, { "database": "PubMed", "id": "27089984", "url": "https://pubmed.ncbi.nlm.nih.gov/27089984" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27258787", "url": "https://pubmed.ncbi.nlm.nih.gov/27258787" }, { "database": "PubMed", "id": "27259260", "url": "https://pubmed.ncbi.nlm.nih.gov/27259260" }, { "database": "PubMed", "id": "27273218", "url": "https://pubmed.ncbi.nlm.nih.gov/27273218" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27462418", "url": "https://pubmed.ncbi.nlm.nih.gov/27462418" }, { "database": "PubMed", "id": "27468685", "url": "https://pubmed.ncbi.nlm.nih.gov/27468685" }, { "database": "PubMed", "id": "27524627", "url": "https://pubmed.ncbi.nlm.nih.gov/27524627" }, { "database": "PubMed", "id": "27602502", "url": "https://pubmed.ncbi.nlm.nih.gov/27602502" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27613518", "url": "https://pubmed.ncbi.nlm.nih.gov/27613518" }, { "database": "PubMed", "id": "27705915", "url": "https://pubmed.ncbi.nlm.nih.gov/27705915" }, { "database": "PubMed", "id": "27907109", "url": "https://pubmed.ncbi.nlm.nih.gov/27907109" }, { "database": "PubMed", "id": "27959319", "url": "https://pubmed.ncbi.nlm.nih.gov/27959319" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28202068", "url": "https://pubmed.ncbi.nlm.nih.gov/28202068" }, { "database": "PubMed", "id": "28250390", "url": "https://pubmed.ncbi.nlm.nih.gov/28250390" }, { "database": "PubMed", "id": "28259977", "url": "https://pubmed.ncbi.nlm.nih.gov/28259977" }, { "database": "PubMed", "id": "28387728", "url": "https://pubmed.ncbi.nlm.nih.gov/28387728" }, { "database": "PubMed", "id": "28412751", "url": "https://pubmed.ncbi.nlm.nih.gov/28412751" }, { "database": "PubMed", "id": "28477111", "url": "https://pubmed.ncbi.nlm.nih.gov/28477111" }, { "database": "PubMed", "id": "28477132", "url": "https://pubmed.ncbi.nlm.nih.gov/28477132" }, { "database": "PubMed", "id": "28648892", "url": "https://pubmed.ncbi.nlm.nih.gov/28648892" }, { "database": "PubMed", "id": "28881600", "url": "https://pubmed.ncbi.nlm.nih.gov/28881600" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29088817", "url": "https://pubmed.ncbi.nlm.nih.gov/29088817" }, { "database": "PubMed", "id": "29147215", "url": "https://pubmed.ncbi.nlm.nih.gov/29147215" }, { "database": "PubMed", "id": "29294106", "url": "https://pubmed.ncbi.nlm.nih.gov/29294106" }, { "database": "PubMed", "id": "29399146", "url": "https://pubmed.ncbi.nlm.nih.gov/29399146" }, { "database": "PubMed", "id": "29540829", "url": "https://pubmed.ncbi.nlm.nih.gov/29540829" }, { "database": "PubMed", "id": "29615613", "url": "https://pubmed.ncbi.nlm.nih.gov/29615613" }, { "database": "PubMed", "id": "30088201", "url": "https://pubmed.ncbi.nlm.nih.gov/30088201" }, { "database": "PubMed", "id": "30237520", "url": "https://pubmed.ncbi.nlm.nih.gov/30237520" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30258062", "url": "https://pubmed.ncbi.nlm.nih.gov/30258062" }, { "database": "PubMed", "id": "30297868", "url": "https://pubmed.ncbi.nlm.nih.gov/30297868" }, { "database": "PubMed", "id": "30473536", "url": "https://pubmed.ncbi.nlm.nih.gov/30473536" }, { "database": "PubMed", "id": "30565836", "url": "https://pubmed.ncbi.nlm.nih.gov/30565836" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30679601", "url": "https://pubmed.ncbi.nlm.nih.gov/30679601" }, { "database": "PubMed", "id": "30783677", "url": "https://pubmed.ncbi.nlm.nih.gov/30783677" }, { "database": "PubMed", "id": "30886146", "url": "https://pubmed.ncbi.nlm.nih.gov/30886146" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30967632", "url": "https://pubmed.ncbi.nlm.nih.gov/30967632" }, { "database": "PubMed", "id": "31114877", "url": "https://pubmed.ncbi.nlm.nih.gov/31114877" }, { "database": "PubMed", "id": "31164689", "url": "https://pubmed.ncbi.nlm.nih.gov/31164689" }, { "database": "PubMed", "id": "31307507", "url": "https://pubmed.ncbi.nlm.nih.gov/31307507" }, { "database": "PubMed", "id": "31372798", "url": "https://pubmed.ncbi.nlm.nih.gov/31372798" }, { "database": "PubMed", "id": "31481733", "url": "https://pubmed.ncbi.nlm.nih.gov/31481733" }, { "database": "PubMed", "id": "31759252", "url": "https://pubmed.ncbi.nlm.nih.gov/31759252" }, { "database": "PubMed", "id": "31805725", "url": "https://pubmed.ncbi.nlm.nih.gov/31805725" }, { "database": "PubMed", "id": "31827702", "url": "https://pubmed.ncbi.nlm.nih.gov/31827702" }, { "database": "PubMed", "id": "31857852", "url": "https://pubmed.ncbi.nlm.nih.gov/31857852" }, { "database": "PubMed", "id": "32015321", "url": "https://pubmed.ncbi.nlm.nih.gov/32015321" }, { "database": "PubMed", "id": "32059363", "url": "https://pubmed.ncbi.nlm.nih.gov/32059363" }, { "database": "PubMed", "id": "32203529", "url": "https://pubmed.ncbi.nlm.nih.gov/32203529" }, { "database": "PubMed", "id": "32226530", "url": "https://pubmed.ncbi.nlm.nih.gov/32226530" }, { "database": "PubMed", "id": "32377397", "url": "https://pubmed.ncbi.nlm.nih.gov/32377397" }, { "database": "PubMed", "id": "32444694", "url": "https://pubmed.ncbi.nlm.nih.gov/32444694" }, { "database": "PubMed", "id": "32479542", "url": "https://pubmed.ncbi.nlm.nih.gov/32479542" }, { "database": "PubMed", "id": "32665601", "url": "https://pubmed.ncbi.nlm.nih.gov/32665601" }, { "database": "PubMed", "id": "32752095", "url": "https://pubmed.ncbi.nlm.nih.gov/32752095" }, { "database": "PubMed", "id": "32879366", "url": "https://pubmed.ncbi.nlm.nih.gov/32879366" }, { "database": "PubMed", "id": "33024871", "url": "https://pubmed.ncbi.nlm.nih.gov/33024871" }, { "database": "PubMed", "id": "33039867", "url": "https://pubmed.ncbi.nlm.nih.gov/33039867" }, { "database": "PubMed", "id": "33096336", "url": "https://pubmed.ncbi.nlm.nih.gov/33096336" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33437944", "url": "https://pubmed.ncbi.nlm.nih.gov/33437944" }, { "database": "PubMed", "id": "33628174", "url": "https://pubmed.ncbi.nlm.nih.gov/33628174" }, { "database": "PubMed", "id": "33802884", "url": "https://pubmed.ncbi.nlm.nih.gov/33802884" }, { "database": "PubMed", "id": "16141325", "url": "https://pubmed.ncbi.nlm.nih.gov/16141325" }, { "database": "PubMed", "id": "17525332", "url": "https://pubmed.ncbi.nlm.nih.gov/17525332" }, { "database": "PubMed", "id": "21144835", "url": "https://pubmed.ncbi.nlm.nih.gov/21144835" }, { "database": "PubMed", "id": "30944854", "url": "https://pubmed.ncbi.nlm.nih.gov/30944854" } ], "site_lbl": "Ser1981", "uniprot_canonical_ac": "Q13315-1" } ], "record_id": "pubmed.26240375", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EXD2 promotes homologous recombination by facilitating DNA end resection.", "journal": "Nat. Cell Biol.", "date": "2016", "authors": "Broderick R, Nieminuszczy J, Baddock HT, Deshpande R, Gileadi O, Paull TT, McHugh PJ, Niedzwiedz W", "reference": { "type": "PubMed", "id": "26807646", "url": "https://pubmed.ncbi.nlm.nih.gov/26807646" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NVH0-1", "protein_name": "Exonuclease 3'-5' domain-containing protein 2", "gene_name": "EXD2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "P38398-1", "protein_name": "Breast cancer type 1 susceptibility protein", "gene_name": "BRCA1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 108, "end_pos": 110, "sequence_org": "DCE", "sequence_mut": "ACA", "comment": "Loss of 3'-5' exonuclease activity. Impaired ability to stabilize and restart stalled replication forks in response to replication stress.", "evidence": [ { "database": "UniProtKB", "id": "Q9NVH0", "url": "https://www.uniprot.org/uniprotkb/Q9NVH0" }, { "database": "PubMed", "id": "26807646", "url": "https://pubmed.ncbi.nlm.nih.gov/26807646" }, { "database": "PubMed", "id": "31255466", "url": "https://pubmed.ncbi.nlm.nih.gov/31255466" } ], "uniprot_canonical_ac": "Q9NVH0-1" } ], "record_id": "pubmed.26807646", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MRE11 stability is regulated by CK2-dependent interaction with R2TP complex.", "journal": "Oncogene", "date": "2017", "authors": "von Morgen P, Burdova K, Flower TG, O'Reilly NJ, Boulton SJ, Smerdon SJ, Macurek L, Horejsi Z", "reference": { "type": "PubMed", "id": "28436950", "url": "https://pubmed.ncbi.nlm.nih.gov/28436950" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 558, "end_pos": 558, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49959", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49959" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "28436950", "url": "https://pubmed.ncbi.nlm.nih.gov/28436950" } ], "site_lbl": "Ser558", "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 561, "end_pos": 561, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P49959", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49959" }, { "database": "PubMed", "id": "28436950", "url": "https://pubmed.ncbi.nlm.nih.gov/28436950" } ], "site_lbl": "Ser561", "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 688, "end_pos": 688, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by CDK2", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "iPTMnet", "id": "P49959", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49959" }, { "database": "PubMed", "id": "15302935", "url": "https://pubmed.ncbi.nlm.nih.gov/15302935" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18491316", "url": "https://pubmed.ncbi.nlm.nih.gov/18491316" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://pubmed.ncbi.nlm.nih.gov/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://pubmed.ncbi.nlm.nih.gov/20166139" }, { "database": "PubMed", "id": "28436950", "url": "https://pubmed.ncbi.nlm.nih.gov/28436950" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" } ], "site_lbl": "Ser688", "uniprot_canonical_ac": "P49959-1" }, { "start_pos": 689, "end_pos": 689, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "21406692", "url": "https://pubmed.ncbi.nlm.nih.gov/21406692" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "19690332", "url": "https://pubmed.ncbi.nlm.nih.gov/19690332" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "iPTMnet", "id": "P49959", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P49959" }, { "database": "PubMed", "id": "15302935", "url": "https://pubmed.ncbi.nlm.nih.gov/15302935" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18491316", "url": "https://pubmed.ncbi.nlm.nih.gov/18491316" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://pubmed.ncbi.nlm.nih.gov/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "28436950", "url": "https://pubmed.ncbi.nlm.nih.gov/28436950" } ], "site_lbl": "Ser689", "uniprot_canonical_ac": "P49959-1" } ], "record_id": "pubmed.28436950", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SAMHD1 promotes DNA end resection to facilitate DNA repair by homologous recombination.", "journal": "Cell Rep.", "date": "2017", "authors": "Daddacha W, Koyen AE, Bastien AJ, Head PE, Dhere VR, Nabeta GN, Connolly EC, Werner E, Madden MZ, Daly MB, Minten EV, Whelan DR, Schlafstein AJ, Zhang H, Anand R, Doronio C, Withers AE, Shepard C, Sundaram RK, Deng X, Dynan WS, Wang Y, Bindra RS, Cejka P, Rothenberg E, Doetsch PW, Kim B, Yu DS", "reference": { "type": "PubMed", "id": "28834754", "url": "https://pubmed.ncbi.nlm.nih.gov/28834754" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q99708-1", "protein_name": "DNA endonuclease RBBP8", "gene_name": "RBBP8", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 206, "end_pos": 207, "sequence_org": "HD", "sequence_mut": "RN", "comment": "Abolishes zinc binding and dNTPase activity. Does not affect ability to promote DNA end resection at stalled replication forks.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y3Z3", "url": "https://www.uniprot.org/uniprotkb/Q9Y3Z3" }, { "database": "PubMed", "id": "24141705", "url": "https://pubmed.ncbi.nlm.nih.gov/24141705" }, { "database": "PubMed", "id": "28834754", "url": "https://pubmed.ncbi.nlm.nih.gov/28834754" }, { "database": "PubMed", "id": "26101257", "url": "https://pubmed.ncbi.nlm.nih.gov/26101257" }, { "database": "PubMed", "id": "21613998", "url": "https://pubmed.ncbi.nlm.nih.gov/21613998" }, { "database": "PubMed", "id": "23602554", "url": "https://pubmed.ncbi.nlm.nih.gov/23602554" } ], "uniprot_canonical_ac": "Q9Y3Z3-1" } ], "record_id": "pubmed.28834754", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SAMHD1 acts at stalled replication forks to prevent interferon induction.", "journal": "Nature", "date": "2018", "authors": "Coquel F, Silva MJ, Techer H, Zadorozhny K, Sharma S, Nieminuszczy J, Mettling C, Dardillac E, Barthe A, Schmitz AL, Promonet A, Cribier A, Sarrazin A, Niedzwiedz W, Lopez B, Costanzo V, Krejci L, Chabes A, Benkirane M, Lin YL, Pasero P", "reference": { "type": "PubMed", "id": "29670289", "url": "https://pubmed.ncbi.nlm.nih.gov/29670289" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9Y3Z3-1", "protein_name": "Deoxynucleoside triphosphate triphosphohydrolase SAMHD1", "gene_name": "SAMHD1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 312, "end_pos": 312, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes dNTPase activity; when associated with A-315 and A-366. Does not affect ability to promote DNA end resection at stalled replication forks; when associated with A-315.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y3Z3", "url": "https://www.uniprot.org/uniprotkb/Q9Y3Z3" }, { "database": "PubMed", "id": "24141705", "url": "https://pubmed.ncbi.nlm.nih.gov/24141705" }, { "database": "PubMed", "id": "29670289", "url": "https://pubmed.ncbi.nlm.nih.gov/29670289" } ], "uniprot_canonical_ac": "Q9Y3Z3-1" }, { "start_pos": 315, "end_pos": 315, "sequence_org": "Y", "sequence_mut": "A", "comment": "Abolished ability to restrict infection by viruses. Abolishes dNTPase activity; when associated with A-312 and A-366. Does not affect ability to promote DNA end resection at stalled replication forks; when associated with A-312.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y3Z3", "url": "https://www.uniprot.org/uniprotkb/Q9Y3Z3" }, { "database": "PubMed", "id": "24141705", "url": "https://pubmed.ncbi.nlm.nih.gov/24141705" }, { "database": "PubMed", "id": "26431200", "url": "https://pubmed.ncbi.nlm.nih.gov/26431200" }, { "database": "PubMed", "id": "29670289", "url": "https://pubmed.ncbi.nlm.nih.gov/29670289" } ], "uniprot_canonical_ac": "Q9Y3Z3-1" }, { "start_pos": 592, "end_pos": 592, "sequence_org": "T", "sequence_mut": "A", "comment": "Impaired ability to promote DNA end resection at stalled replication forks. Promotes dNTPase activity and ability to restrict infection by viruses.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y3Z3", "url": "https://www.uniprot.org/uniprotkb/Q9Y3Z3" }, { "database": "PubMed", "id": "26294762", "url": "https://pubmed.ncbi.nlm.nih.gov/26294762" }, { "database": "PubMed", "id": "26431200", "url": "https://pubmed.ncbi.nlm.nih.gov/26431200" }, { "database": "PubMed", "id": "23601106", "url": "https://pubmed.ncbi.nlm.nih.gov/23601106" }, { "database": "PubMed", "id": "29610582", "url": "https://pubmed.ncbi.nlm.nih.gov/29610582" }, { "database": "PubMed", "id": "29670289", "url": "https://pubmed.ncbi.nlm.nih.gov/29670289" }, { "database": "PubMed", "id": "23602554", "url": "https://pubmed.ncbi.nlm.nih.gov/23602554" } ], "uniprot_canonical_ac": "Q9Y3Z3-1" }, { "start_pos": 592, "end_pos": 592, "sequence_org": "T", "sequence_mut": "E", "comment": "Mimicks phosphorylation state, retains ability to promote DNA end resection at stalled replication forks. Induces large conformational changes that impair homotetramerization, leading to reduced dNTPase activity and decreased ability to restrict infection by viruses.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y3Z3", "url": "https://www.uniprot.org/uniprotkb/Q9Y3Z3" }, { "database": "PubMed", "id": "26101257", "url": "https://pubmed.ncbi.nlm.nih.gov/26101257" }, { "database": "PubMed", "id": "26294762", "url": "https://pubmed.ncbi.nlm.nih.gov/26294762" }, { "database": "PubMed", "id": "26431200", "url": "https://pubmed.ncbi.nlm.nih.gov/26431200" }, { "database": "PubMed", "id": "23601106", "url": "https://pubmed.ncbi.nlm.nih.gov/23601106" }, { "database": "PubMed", "id": "29610582", "url": "https://pubmed.ncbi.nlm.nih.gov/29610582" }, { "database": "PubMed", "id": "29670289", "url": "https://pubmed.ncbi.nlm.nih.gov/29670289" }, { "database": "PubMed", "id": "23602554", "url": "https://pubmed.ncbi.nlm.nih.gov/23602554" } ], "uniprot_canonical_ac": "Q9Y3Z3-1" }, { "start_pos": 592, "end_pos": 592, "sequence_org": "T", "sequence_mut": "V", "comment": "Impaired ability to promote DNA end resection at stalled replication forks. Promotes dNTPase activity and ability to restrict infection by viruses.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y3Z3", "url": "https://www.uniprot.org/uniprotkb/Q9Y3Z3" }, { "database": "PubMed", "id": "26294762", "url": "https://pubmed.ncbi.nlm.nih.gov/26294762" }, { "database": "PubMed", "id": "26431200", "url": "https://pubmed.ncbi.nlm.nih.gov/26431200" }, { "database": "PubMed", "id": "23601106", "url": "https://pubmed.ncbi.nlm.nih.gov/23601106" }, { "database": "PubMed", "id": "29610582", "url": "https://pubmed.ncbi.nlm.nih.gov/29610582" }, { "database": "PubMed", "id": "29670289", "url": "https://pubmed.ncbi.nlm.nih.gov/29670289" }, { "database": "PubMed", "id": "23602554", "url": "https://pubmed.ncbi.nlm.nih.gov/23602554" } ], "uniprot_canonical_ac": "Q9Y3Z3-1" } ], "phosphorylation": [ { "start_pos": 592, "end_pos": 592, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "Q9Y3Z3", "url": "https://www.uniprot.org/uniprotkb/Q9Y3Z3" }, { "database": "iPTMnet", "id": "Q9Y3Z3", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9Y3Z3" }, { "database": "PubMed", "id": "17081983", "url": "https://pubmed.ncbi.nlm.nih.gov/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" }, { "database": "PubMed", "id": "19413330", "url": "https://pubmed.ncbi.nlm.nih.gov/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://pubmed.ncbi.nlm.nih.gov/19651622" }, { "database": "PubMed", "id": "19664994", "url": "https://pubmed.ncbi.nlm.nih.gov/19664994" }, { "database": "PubMed", "id": "20068231", "url": "https://pubmed.ncbi.nlm.nih.gov/20068231" }, { "database": "PubMed", "id": "23601106", "url": "https://pubmed.ncbi.nlm.nih.gov/23601106" }, { "database": "PubMed", "id": "23602554", "url": "https://pubmed.ncbi.nlm.nih.gov/23602554" }, { "database": "PubMed", "id": "24035396", "url": "https://pubmed.ncbi.nlm.nih.gov/24035396" }, { "database": "PubMed", "id": "24445253", "url": "https://pubmed.ncbi.nlm.nih.gov/24445253" }, { "database": "PubMed", "id": "25038827", "url": "https://pubmed.ncbi.nlm.nih.gov/25038827" }, { "database": "PubMed", "id": "25158827", "url": "https://pubmed.ncbi.nlm.nih.gov/25158827" }, { "database": "PubMed", "id": "26101257", "url": "https://pubmed.ncbi.nlm.nih.gov/26101257" }, { "database": "PubMed", "id": "26121641", "url": "https://pubmed.ncbi.nlm.nih.gov/26121641" }, { "database": "PubMed", "id": "26294762", "url": "https://pubmed.ncbi.nlm.nih.gov/26294762" }, { "database": "PubMed", "id": "26431200", "url": "https://pubmed.ncbi.nlm.nih.gov/26431200" }, { "database": "PubMed", "id": "26851491", "url": "https://pubmed.ncbi.nlm.nih.gov/26851491" }, { "database": "PubMed", "id": "26923586", "url": "https://pubmed.ncbi.nlm.nih.gov/26923586" }, { "database": "PubMed", "id": "27229711", "url": "https://pubmed.ncbi.nlm.nih.gov/27229711" }, { "database": "PubMed", "id": "27511536", "url": "https://pubmed.ncbi.nlm.nih.gov/27511536" }, { "database": "PubMed", "id": "27815502", "url": "https://pubmed.ncbi.nlm.nih.gov/27815502" }, { "database": "PubMed", "id": "28321930", "url": "https://pubmed.ncbi.nlm.nih.gov/28321930" }, { "database": "PubMed", "id": "28793904", "url": "https://pubmed.ncbi.nlm.nih.gov/28793904" }, { "database": "PubMed", "id": "29084722", "url": "https://pubmed.ncbi.nlm.nih.gov/29084722" }, { "database": "PubMed", "id": "29321329", "url": "https://pubmed.ncbi.nlm.nih.gov/29321329" }, { "database": "PubMed", "id": "29515139", "url": "https://pubmed.ncbi.nlm.nih.gov/29515139" }, { "database": "PubMed", "id": "29587790", "url": "https://pubmed.ncbi.nlm.nih.gov/29587790" }, { "database": "PubMed", "id": "29610582", "url": "https://pubmed.ncbi.nlm.nih.gov/29610582" }, { "database": "PubMed", "id": "29698322", "url": "https://pubmed.ncbi.nlm.nih.gov/29698322" }, { "database": "PubMed", "id": "29884836", "url": "https://pubmed.ncbi.nlm.nih.gov/29884836" }, { "database": "PubMed", "id": "30039733", "url": "https://pubmed.ncbi.nlm.nih.gov/30039733" }, { "database": "PubMed", "id": "30044979", "url": "https://pubmed.ncbi.nlm.nih.gov/30044979" }, { "database": "PubMed", "id": "30104243", "url": "https://pubmed.ncbi.nlm.nih.gov/30104243" }, { "database": "PubMed", "id": "31291580", "url": "https://pubmed.ncbi.nlm.nih.gov/31291580" }, { "database": "PubMed", "id": "31375673", "url": "https://pubmed.ncbi.nlm.nih.gov/31375673" }, { "database": "PubMed", "id": "31797533", "url": "https://pubmed.ncbi.nlm.nih.gov/31797533" }, { "database": "PubMed", "id": "31950591", "url": "https://pubmed.ncbi.nlm.nih.gov/31950591" }, { "database": "PubMed", "id": "32209460", "url": "https://pubmed.ncbi.nlm.nih.gov/32209460" }, { "database": "PubMed", "id": "34321470", "url": "https://pubmed.ncbi.nlm.nih.gov/34321470" }, { "database": "PubMed", "id": "34513928", "url": "https://pubmed.ncbi.nlm.nih.gov/34513928" }, { "database": "PubMed", "id": "35801923", "url": "https://pubmed.ncbi.nlm.nih.gov/35801923" }, { "database": "PubMed", "id": "36309692", "url": "https://pubmed.ncbi.nlm.nih.gov/36309692" }, { "database": "PubMed", "id": "19369195", "url": "https://pubmed.ncbi.nlm.nih.gov/19369195" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "PubMed", "id": "24275569", "url": "https://pubmed.ncbi.nlm.nih.gov/24275569" }, { "database": "PubMed", "id": "29670289", "url": "https://pubmed.ncbi.nlm.nih.gov/29670289" } ], "site_lbl": "Thr592", "uniprot_canonical_ac": "Q9Y3Z3-1" } ], "record_id": "pubmed.29670289", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MRE11 UFMylation promotes ATM activation.", "journal": "Nucleic acids research", "date": "2019", "authors": "Wang Z, Gong Y, Peng B, Shi R, Fan D, Zhao H, Zhu M, Zhang H, Lou Z, Zhou J, Zhu WG, Cong YS, Xu X", "reference": { "type": "PubMed", "id": "30783677", "url": "https://pubmed.ncbi.nlm.nih.gov/30783677" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9NUQ7-1", "protein_name": "Ufm1-specific protease 2", "gene_name": "UFSP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O94874-1", "protein_name": "E3 UFM1-protein ligase 1", "gene_name": "UFL1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13315-1", "protein_name": "Serine-protein kinase ATM", "gene_name": "ATM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 282, "end_pos": 282, "sequence_org": "K", "sequence_mut": "R", "comment": "Abolished ufmylation.", "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" }, { "database": "PubMed", "id": "30783677", "url": "https://pubmed.ncbi.nlm.nih.gov/30783677" } ], "uniprot_canonical_ac": "P49959-1" } ], "phosphorylation": [ { "start_pos": 1981, "end_pos": 1981, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by autocatalysis", "evidence": [ { "database": "UniProtKB", "id": "Q13315", "url": "https://www.uniprot.org/uniprotkb/Q13315" }, { "database": "IntAct", "id": "Q13315", "url": "https://www.ebi.ac.uk/intact/interactors/id:Q13315*" }, { "database": "iPTMnet", "id": "Q13315", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13315" }, { "database": "PubMed", "id": "19851285", "url": "https://pubmed.ncbi.nlm.nih.gov/19851285" }, { "database": "PubMed", "id": "16858402", "url": "https://pubmed.ncbi.nlm.nih.gov/16858402" }, { "database": "PRO", "id": "Q13315", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=Q13315" }, { "database": "PubMed", "id": "22099307", "url": "https://pubmed.ncbi.nlm.nih.gov/22099307" }, { "database": "PubMed", "id": "12556884", "url": "https://pubmed.ncbi.nlm.nih.gov/12556884" }, { "database": "PubMed", "id": "14695167", "url": "https://pubmed.ncbi.nlm.nih.gov/14695167" }, { "database": "PubMed", "id": "14871926", "url": "https://pubmed.ncbi.nlm.nih.gov/14871926" }, { "database": "PubMed", "id": "15048089", "url": "https://pubmed.ncbi.nlm.nih.gov/15048089" }, { "database": "PubMed", "id": "15140942", "url": "https://pubmed.ncbi.nlm.nih.gov/15140942" }, { "database": "PubMed", "id": "15177039", "url": "https://pubmed.ncbi.nlm.nih.gov/15177039" }, { "database": "PubMed", "id": "15177184", "url": "https://pubmed.ncbi.nlm.nih.gov/15177184" }, { "database": "PubMed", "id": "15269203", "url": "https://pubmed.ncbi.nlm.nih.gov/15269203" }, { "database": "PubMed", "id": "15313175", "url": "https://pubmed.ncbi.nlm.nih.gov/15313175" }, { "database": "PubMed", "id": "15314656", "url": "https://pubmed.ncbi.nlm.nih.gov/15314656" }, { "database": "PubMed", "id": "15489221", "url": "https://pubmed.ncbi.nlm.nih.gov/15489221" }, { "database": "PubMed", "id": "15510216", "url": "https://pubmed.ncbi.nlm.nih.gov/15510216" }, { "database": "PubMed", "id": "15846060", "url": "https://pubmed.ncbi.nlm.nih.gov/15846060" }, { "database": "PubMed", "id": "16293623", "url": "https://pubmed.ncbi.nlm.nih.gov/16293623" }, { "database": "PubMed", "id": "16319535", "url": "https://pubmed.ncbi.nlm.nih.gov/16319535" }, { "database": "PubMed", "id": "16452482", "url": "https://pubmed.ncbi.nlm.nih.gov/16452482" }, { "database": "PubMed", "id": "16528719", "url": "https://pubmed.ncbi.nlm.nih.gov/16528719" }, { "database": "PubMed", "id": "16533058", "url": "https://pubmed.ncbi.nlm.nih.gov/16533058" }, { "database": "PubMed", "id": "16556909", "url": "https://pubmed.ncbi.nlm.nih.gov/16556909" }, { "database": "PubMed", "id": "16628011", "url": "https://pubmed.ncbi.nlm.nih.gov/16628011" }, { "database": "PubMed", "id": "16636671", "url": "https://pubmed.ncbi.nlm.nih.gov/16636671" }, { "database": "PubMed", "id": "16861926", "url": "https://pubmed.ncbi.nlm.nih.gov/16861926" }, { "database": "PubMed", "id": "16906133", "url": "https://pubmed.ncbi.nlm.nih.gov/16906133" }, { "database": "PubMed", "id": "16940754", "url": "https://pubmed.ncbi.nlm.nih.gov/16940754" }, { "database": "PubMed", "id": "16997395", "url": "https://pubmed.ncbi.nlm.nih.gov/16997395" }, { "database": "PubMed", "id": "17016017", "url": "https://pubmed.ncbi.nlm.nih.gov/17016017" }, { "database": "PubMed", "id": "17124492", "url": "https://pubmed.ncbi.nlm.nih.gov/17124492" }, { "database": "PubMed", "id": "17406032", "url": "https://pubmed.ncbi.nlm.nih.gov/17406032" }, { "database": "PubMed", "id": "17486112", "url": "https://pubmed.ncbi.nlm.nih.gov/17486112" }, { "database": "PubMed", "id": "17638905", "url": "https://pubmed.ncbi.nlm.nih.gov/17638905" }, { "database": "PubMed", "id": "17700524", "url": "https://pubmed.ncbi.nlm.nih.gov/17700524" }, { "database": "PubMed", "id": "18048416", "url": "https://pubmed.ncbi.nlm.nih.gov/18048416" }, { "database": "PubMed", "id": "18059176", "url": "https://pubmed.ncbi.nlm.nih.gov/18059176" }, { "database": "PubMed", "id": "18248856", "url": "https://pubmed.ncbi.nlm.nih.gov/18248856" }, { "database": "PubMed", "id": "18344987", "url": "https://pubmed.ncbi.nlm.nih.gov/18344987" }, { "database": "PubMed", "id": "18431490", "url": "https://pubmed.ncbi.nlm.nih.gov/18431490" }, { "database": "PubMed", "id": "18560558", "url": "https://pubmed.ncbi.nlm.nih.gov/18560558" }, { "database": "PubMed", "id": "18571408", "url": "https://pubmed.ncbi.nlm.nih.gov/18571408" }, { "database": "PubMed", "id": "18593910", "url": "https://pubmed.ncbi.nlm.nih.gov/18593910" }, { "database": "PubMed", "id": "18596698", "url": "https://pubmed.ncbi.nlm.nih.gov/18596698" }, { "database": "PubMed", "id": "18619531", "url": "https://pubmed.ncbi.nlm.nih.gov/18619531" }, { "database": "PubMed", "id": "18663430", "url": "https://pubmed.ncbi.nlm.nih.gov/18663430" }, { "database": "PubMed", "id": "18762365", "url": "https://pubmed.ncbi.nlm.nih.gov/18762365" }, { "database": "PubMed", "id": "18959818", "url": "https://pubmed.ncbi.nlm.nih.gov/18959818" }, { "database": "PubMed", "id": "18985806", "url": "https://pubmed.ncbi.nlm.nih.gov/18985806" }, { "database": "PubMed", "id": "19401701", "url": "https://pubmed.ncbi.nlm.nih.gov/19401701" }, { "database": "PubMed", "id": "19411853", "url": "https://pubmed.ncbi.nlm.nih.gov/19411853" }, { "database": "PubMed", "id": "19451263", "url": "https://pubmed.ncbi.nlm.nih.gov/19451263" }, { "database": "PubMed", "id": "19605351", "url": "https://pubmed.ncbi.nlm.nih.gov/19605351" }, { "database": "PubMed", "id": "19621083", "url": "https://pubmed.ncbi.nlm.nih.gov/19621083" }, { "database": "PubMed", "id": "19625493", "url": "https://pubmed.ncbi.nlm.nih.gov/19625493" }, { "database": "PubMed", "id": "19658174", "url": "https://pubmed.ncbi.nlm.nih.gov/19658174" }, { "database": "PubMed", "id": "19671522", "url": "https://pubmed.ncbi.nlm.nih.gov/19671522" }, { "database": "PubMed", "id": "19744477", "url": "https://pubmed.ncbi.nlm.nih.gov/19744477" }, { "database": "PubMed", "id": "19798429", "url": "https://pubmed.ncbi.nlm.nih.gov/19798429" }, { "database": "PubMed", "id": "20014310", "url": "https://pubmed.ncbi.nlm.nih.gov/20014310" }, { "database": "PubMed", "id": "20126263", "url": "https://pubmed.ncbi.nlm.nih.gov/20126263" }, { "database": "PubMed", "id": "20205745", "url": "https://pubmed.ncbi.nlm.nih.gov/20205745" }, { "database": "PubMed", "id": "20660628", "url": "https://pubmed.ncbi.nlm.nih.gov/20660628" }, { "database": "PubMed", "id": "20678255", "url": "https://pubmed.ncbi.nlm.nih.gov/20678255" }, { "database": "PubMed", "id": "20700484", "url": "https://pubmed.ncbi.nlm.nih.gov/20700484" }, { "database": "PubMed", "id": "20711462", "url": "https://pubmed.ncbi.nlm.nih.gov/20711462" }, { "database": "PubMed", "id": "20959117", "url": "https://pubmed.ncbi.nlm.nih.gov/20959117" }, { "database": "PubMed", "id": "20976220", "url": "https://pubmed.ncbi.nlm.nih.gov/20976220" }, { "database": "PubMed", "id": "20978201", "url": "https://pubmed.ncbi.nlm.nih.gov/20978201" }, { "database": "PubMed", "id": "21078189", "url": "https://pubmed.ncbi.nlm.nih.gov/21078189" }, { "database": "PubMed", "id": "21157431", "url": "https://pubmed.ncbi.nlm.nih.gov/21157431" }, { "database": "PubMed", "id": "21219611", "url": "https://pubmed.ncbi.nlm.nih.gov/21219611" }, { "database": "PubMed", "id": "21292467", "url": "https://pubmed.ncbi.nlm.nih.gov/21292467" }, { "database": "PubMed", "id": "21338495", "url": "https://pubmed.ncbi.nlm.nih.gov/21338495" }, { "database": "PubMed", "id": "21390062", "url": "https://pubmed.ncbi.nlm.nih.gov/21390062" }, { "database": "PubMed", "id": "21573174", "url": "https://pubmed.ncbi.nlm.nih.gov/21573174" }, { "database": "PubMed", "id": "21824286", "url": "https://pubmed.ncbi.nlm.nih.gov/21824286" }, { "database": "PubMed", "id": "21997193", "url": "https://pubmed.ncbi.nlm.nih.gov/21997193" }, { "database": "PubMed", "id": "22323184", "url": "https://pubmed.ncbi.nlm.nih.gov/22323184" }, { "database": "PubMed", "id": "22416035", "url": "https://pubmed.ncbi.nlm.nih.gov/22416035" }, { "database": "PubMed", "id": "22493319", "url": "https://pubmed.ncbi.nlm.nih.gov/22493319" }, { "database": "PubMed", "id": "22498490", "url": "https://pubmed.ncbi.nlm.nih.gov/22498490" }, { "database": "PubMed", "id": "22655027", "url": "https://pubmed.ncbi.nlm.nih.gov/22655027" }, { "database": "PubMed", "id": "22739265", "url": "https://pubmed.ncbi.nlm.nih.gov/22739265" }, { "database": "PubMed", "id": "22761798", "url": "https://pubmed.ncbi.nlm.nih.gov/22761798" }, { "database": "PubMed", "id": "22837425", "url": "https://pubmed.ncbi.nlm.nih.gov/22837425" }, { "database": "PubMed", "id": "22841545", "url": "https://pubmed.ncbi.nlm.nih.gov/22841545" }, { "database": "PubMed", "id": "22952040", "url": "https://pubmed.ncbi.nlm.nih.gov/22952040" }, { "database": "PubMed", "id": "23146902", "url": "https://pubmed.ncbi.nlm.nih.gov/23146902" }, { "database": "PubMed", "id": "23166842", "url": "https://pubmed.ncbi.nlm.nih.gov/23166842" }, { "database": "PubMed", "id": "23185347", "url": "https://pubmed.ncbi.nlm.nih.gov/23185347" }, { "database": "PubMed", "id": "23193277", "url": "https://pubmed.ncbi.nlm.nih.gov/23193277" }, { "database": "PubMed", "id": "23365634", "url": "https://pubmed.ncbi.nlm.nih.gov/23365634" }, { "database": "PubMed", "id": "23383259", "url": "https://pubmed.ncbi.nlm.nih.gov/23383259" }, { "database": "PubMed", "id": "23533526", "url": "https://pubmed.ncbi.nlm.nih.gov/23533526" }, { "database": "PubMed", "id": "23552604", "url": "https://pubmed.ncbi.nlm.nih.gov/23552604" }, { "database": "PubMed", "id": "23620287", "url": "https://pubmed.ncbi.nlm.nih.gov/23620287" }, { "database": "PubMed", "id": "23666059", "url": "https://pubmed.ncbi.nlm.nih.gov/23666059" }, { "database": "PubMed", "id": "23705030", "url": "https://pubmed.ncbi.nlm.nih.gov/23705030" }, { "database": "PubMed", "id": "23900392", "url": "https://pubmed.ncbi.nlm.nih.gov/23900392" }, { "database": "PubMed", "id": "24086335", "url": "https://pubmed.ncbi.nlm.nih.gov/24086335" }, { "database": "PubMed", "id": "24113180", "url": "https://pubmed.ncbi.nlm.nih.gov/24113180" }, { "database": "PubMed", "id": "24268576", "url": "https://pubmed.ncbi.nlm.nih.gov/24268576" }, { "database": "PubMed", "id": "24280901", "url": "https://pubmed.ncbi.nlm.nih.gov/24280901" }, { "database": "PubMed", "id": "24505404", "url": "https://pubmed.ncbi.nlm.nih.gov/24505404" }, { "database": "PubMed", "id": "24763056", "url": "https://pubmed.ncbi.nlm.nih.gov/24763056" }, { "database": "PubMed", "id": "24812435", "url": "https://pubmed.ncbi.nlm.nih.gov/24812435" }, { "database": "PubMed", "id": "24933654", "url": "https://pubmed.ncbi.nlm.nih.gov/24933654" }, { "database": "PubMed", "id": "24988892", "url": "https://pubmed.ncbi.nlm.nih.gov/24988892" }, { "database": "PubMed", "id": "25003995", "url": "https://pubmed.ncbi.nlm.nih.gov/25003995" }, { "database": "PubMed", "id": "25077176", "url": "https://pubmed.ncbi.nlm.nih.gov/25077176" }, { "database": "PubMed", "id": "25088203", "url": "https://pubmed.ncbi.nlm.nih.gov/25088203" }, { "database": "PubMed", "id": "25111195", "url": "https://pubmed.ncbi.nlm.nih.gov/25111195" }, { "database": "PubMed", "id": "25240135", "url": "https://pubmed.ncbi.nlm.nih.gov/25240135" }, { "database": "PubMed", "id": "25527123", "url": "https://pubmed.ncbi.nlm.nih.gov/25527123" }, { "database": "PubMed", "id": "25611382", "url": "https://pubmed.ncbi.nlm.nih.gov/25611382" }, { "database": "PubMed", "id": "25821946", "url": "https://pubmed.ncbi.nlm.nih.gov/25821946" }, { "database": "PubMed", "id": "25826455", "url": "https://pubmed.ncbi.nlm.nih.gov/25826455" }, { "database": "PubMed", "id": "25865756", "url": "https://pubmed.ncbi.nlm.nih.gov/25865756" }, { "database": "PubMed", "id": "25904696", "url": "https://pubmed.ncbi.nlm.nih.gov/25904696" }, { "database": "PubMed", "id": "25923214", "url": "https://pubmed.ncbi.nlm.nih.gov/25923214" }, { "database": "PubMed", "id": "25977998", "url": "https://pubmed.ncbi.nlm.nih.gov/25977998" }, { "database": "PubMed", "id": "26158765", "url": "https://pubmed.ncbi.nlm.nih.gov/26158765" }, { "database": "PubMed", "id": "26240375", "url": "https://pubmed.ncbi.nlm.nih.gov/26240375" }, { "database": "PubMed", "id": "26275218", "url": "https://pubmed.ncbi.nlm.nih.gov/26275218" }, { "database": "PubMed", "id": "26416514", "url": "https://pubmed.ncbi.nlm.nih.gov/26416514" }, { "database": "PubMed", "id": "26427042", "url": "https://pubmed.ncbi.nlm.nih.gov/26427042" }, { "database": "PubMed", "id": "26431963", "url": "https://pubmed.ncbi.nlm.nih.gov/26431963" }, { "database": "PubMed", "id": "26438152", "url": "https://pubmed.ncbi.nlm.nih.gov/26438152" }, { "database": "PubMed", "id": "26517194", "url": "https://pubmed.ncbi.nlm.nih.gov/26517194" }, { "database": "PubMed", "id": "26517239", "url": "https://pubmed.ncbi.nlm.nih.gov/26517239" }, { "database": "PubMed", "id": "26556501", "url": "https://pubmed.ncbi.nlm.nih.gov/26556501" }, { "database": "PubMed", "id": "26677768", "url": "https://pubmed.ncbi.nlm.nih.gov/26677768" }, { "database": "PubMed", "id": "26683224", "url": "https://pubmed.ncbi.nlm.nih.gov/26683224" }, { "database": "PubMed", "id": "26751069", "url": "https://pubmed.ncbi.nlm.nih.gov/26751069" }, { "database": "PubMed", "id": "26824362", "url": "https://pubmed.ncbi.nlm.nih.gov/26824362" }, { "database": "PubMed", "id": "26860083", "url": "https://pubmed.ncbi.nlm.nih.gov/26860083" }, { "database": "PubMed", "id": "26875667", "url": "https://pubmed.ncbi.nlm.nih.gov/26875667" }, { "database": "PubMed", "id": "26919204", "url": "https://pubmed.ncbi.nlm.nih.gov/26919204" }, { "database": "PubMed", "id": "27029031", "url": "https://pubmed.ncbi.nlm.nih.gov/27029031" }, { "database": "PubMed", "id": "27089984", "url": "https://pubmed.ncbi.nlm.nih.gov/27089984" }, { "database": "PubMed", "id": "27097159", "url": "https://pubmed.ncbi.nlm.nih.gov/27097159" }, { "database": "PubMed", "id": "27258787", "url": "https://pubmed.ncbi.nlm.nih.gov/27258787" }, { "database": "PubMed", "id": "27259260", "url": "https://pubmed.ncbi.nlm.nih.gov/27259260" }, { "database": "PubMed", "id": "27273218", "url": "https://pubmed.ncbi.nlm.nih.gov/27273218" }, { "database": "PubMed", "id": "27391441", "url": "https://pubmed.ncbi.nlm.nih.gov/27391441" }, { "database": "PubMed", "id": "27462418", "url": "https://pubmed.ncbi.nlm.nih.gov/27462418" }, { "database": "PubMed", "id": "27468685", "url": "https://pubmed.ncbi.nlm.nih.gov/27468685" }, { "database": "PubMed", "id": "27524627", "url": "https://pubmed.ncbi.nlm.nih.gov/27524627" }, { "database": "PubMed", "id": "27602502", "url": "https://pubmed.ncbi.nlm.nih.gov/27602502" }, { "database": "PubMed", "id": "27603133", "url": "https://pubmed.ncbi.nlm.nih.gov/27603133" }, { "database": "PubMed", "id": "27613518", "url": "https://pubmed.ncbi.nlm.nih.gov/27613518" }, { "database": "PubMed", "id": "27705915", "url": "https://pubmed.ncbi.nlm.nih.gov/27705915" }, { "database": "PubMed", "id": "27907109", "url": "https://pubmed.ncbi.nlm.nih.gov/27907109" }, { "database": "PubMed", "id": "27959319", "url": "https://pubmed.ncbi.nlm.nih.gov/27959319" }, { "database": "PubMed", "id": "28182994", "url": "https://pubmed.ncbi.nlm.nih.gov/28182994" }, { "database": "PubMed", "id": "28202068", "url": "https://pubmed.ncbi.nlm.nih.gov/28202068" }, { "database": "PubMed", "id": "28250390", "url": "https://pubmed.ncbi.nlm.nih.gov/28250390" }, { "database": "PubMed", "id": "28259977", "url": "https://pubmed.ncbi.nlm.nih.gov/28259977" }, { "database": "PubMed", "id": "28387728", "url": "https://pubmed.ncbi.nlm.nih.gov/28387728" }, { "database": "PubMed", "id": "28412751", "url": "https://pubmed.ncbi.nlm.nih.gov/28412751" }, { "database": "PubMed", "id": "28477111", "url": "https://pubmed.ncbi.nlm.nih.gov/28477111" }, { "database": "PubMed", "id": "28477132", "url": "https://pubmed.ncbi.nlm.nih.gov/28477132" }, { "database": "PubMed", "id": "28648892", "url": "https://pubmed.ncbi.nlm.nih.gov/28648892" }, { "database": "PubMed", "id": "28881600", "url": "https://pubmed.ncbi.nlm.nih.gov/28881600" }, { "database": "PubMed", "id": "28973009", "url": "https://pubmed.ncbi.nlm.nih.gov/28973009" }, { "database": "PubMed", "id": "29048667", "url": "https://pubmed.ncbi.nlm.nih.gov/29048667" }, { "database": "PubMed", "id": "29088817", "url": "https://pubmed.ncbi.nlm.nih.gov/29088817" }, { "database": "PubMed", "id": "29147215", "url": "https://pubmed.ncbi.nlm.nih.gov/29147215" }, { "database": "PubMed", "id": "29294106", "url": "https://pubmed.ncbi.nlm.nih.gov/29294106" }, { "database": "PubMed", "id": "29399146", "url": "https://pubmed.ncbi.nlm.nih.gov/29399146" }, { "database": "PubMed", "id": "29540829", "url": "https://pubmed.ncbi.nlm.nih.gov/29540829" }, { "database": "PubMed", "id": "29615613", "url": "https://pubmed.ncbi.nlm.nih.gov/29615613" }, { "database": "PubMed", "id": "30088201", "url": "https://pubmed.ncbi.nlm.nih.gov/30088201" }, { "database": "PubMed", "id": "30237520", "url": "https://pubmed.ncbi.nlm.nih.gov/30237520" }, { "database": "PubMed", "id": "30245854", "url": "https://pubmed.ncbi.nlm.nih.gov/30245854" }, { "database": "PubMed", "id": "30258062", "url": "https://pubmed.ncbi.nlm.nih.gov/30258062" }, { "database": "PubMed", "id": "30297868", "url": "https://pubmed.ncbi.nlm.nih.gov/30297868" }, { "database": "PubMed", "id": "30473536", "url": "https://pubmed.ncbi.nlm.nih.gov/30473536" }, { "database": "PubMed", "id": "30565836", "url": "https://pubmed.ncbi.nlm.nih.gov/30565836" }, { "database": "PubMed", "id": "30577494", "url": "https://pubmed.ncbi.nlm.nih.gov/30577494" }, { "database": "PubMed", "id": "30679601", "url": "https://pubmed.ncbi.nlm.nih.gov/30679601" }, { "database": "PubMed", "id": "30783677", "url": "https://pubmed.ncbi.nlm.nih.gov/30783677" }, { "database": "PubMed", "id": "30886146", "url": "https://pubmed.ncbi.nlm.nih.gov/30886146" }, { "database": "PubMed", "id": "30943920", "url": "https://pubmed.ncbi.nlm.nih.gov/30943920" }, { "database": "PubMed", "id": "30967632", "url": "https://pubmed.ncbi.nlm.nih.gov/30967632" }, { "database": "PubMed", "id": "31114877", "url": "https://pubmed.ncbi.nlm.nih.gov/31114877" }, { "database": "PubMed", "id": "31164689", "url": "https://pubmed.ncbi.nlm.nih.gov/31164689" }, { "database": "PubMed", "id": "31307507", "url": "https://pubmed.ncbi.nlm.nih.gov/31307507" }, { "database": "PubMed", "id": "31372798", "url": "https://pubmed.ncbi.nlm.nih.gov/31372798" }, { "database": "PubMed", "id": "31481733", "url": "https://pubmed.ncbi.nlm.nih.gov/31481733" }, { "database": "PubMed", "id": "31759252", "url": "https://pubmed.ncbi.nlm.nih.gov/31759252" }, { "database": "PubMed", "id": "31805725", "url": "https://pubmed.ncbi.nlm.nih.gov/31805725" }, { "database": "PubMed", "id": "31827702", "url": "https://pubmed.ncbi.nlm.nih.gov/31827702" }, { "database": "PubMed", "id": "31857852", "url": "https://pubmed.ncbi.nlm.nih.gov/31857852" }, { "database": "PubMed", "id": "32015321", "url": "https://pubmed.ncbi.nlm.nih.gov/32015321" }, { "database": "PubMed", "id": "32059363", "url": "https://pubmed.ncbi.nlm.nih.gov/32059363" }, { "database": "PubMed", "id": "32203529", "url": "https://pubmed.ncbi.nlm.nih.gov/32203529" }, { "database": "PubMed", "id": "32226530", "url": "https://pubmed.ncbi.nlm.nih.gov/32226530" }, { "database": "PubMed", "id": "32377397", "url": "https://pubmed.ncbi.nlm.nih.gov/32377397" }, { "database": "PubMed", "id": "32444694", "url": "https://pubmed.ncbi.nlm.nih.gov/32444694" }, { "database": "PubMed", "id": "32479542", "url": "https://pubmed.ncbi.nlm.nih.gov/32479542" }, { "database": "PubMed", "id": "32665601", "url": "https://pubmed.ncbi.nlm.nih.gov/32665601" }, { "database": "PubMed", "id": "32752095", "url": "https://pubmed.ncbi.nlm.nih.gov/32752095" }, { "database": "PubMed", "id": "32879366", "url": "https://pubmed.ncbi.nlm.nih.gov/32879366" }, { "database": "PubMed", "id": "33024871", "url": "https://pubmed.ncbi.nlm.nih.gov/33024871" }, { "database": "PubMed", "id": "33039867", "url": "https://pubmed.ncbi.nlm.nih.gov/33039867" }, { "database": "PubMed", "id": "33096336", "url": "https://pubmed.ncbi.nlm.nih.gov/33096336" }, { "database": "PubMed", "id": "33245190", "url": "https://pubmed.ncbi.nlm.nih.gov/33245190" }, { "database": "PubMed", "id": "33437944", "url": "https://pubmed.ncbi.nlm.nih.gov/33437944" }, { "database": "PubMed", "id": "33628174", "url": "https://pubmed.ncbi.nlm.nih.gov/33628174" }, { "database": "PubMed", "id": "33802884", "url": "https://pubmed.ncbi.nlm.nih.gov/33802884" }, { "database": "PubMed", "id": "16141325", "url": "https://pubmed.ncbi.nlm.nih.gov/16141325" }, { "database": "PubMed", "id": "17525332", "url": "https://pubmed.ncbi.nlm.nih.gov/17525332" }, { "database": "PubMed", "id": "21144835", "url": "https://pubmed.ncbi.nlm.nih.gov/21144835" }, { "database": "PubMed", "id": "30944854", "url": "https://pubmed.ncbi.nlm.nih.gov/30944854" } ], "site_lbl": "Ser1981", "uniprot_canonical_ac": "Q13315-1" } ], "record_id": "pubmed.30783677", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MRE11A: a novel negative regulator of human DNA mismatch repair.", "journal": "Cellular & molecular biology letters", "date": "2024-03-14", "authors": "Du Demin, Yang Yueyan, Zhang Yuanyuan, Wang Guanxiong, Chen Liying, Guan Xiaowei, Rasmussen Lene Juel, Liu Dekang", "reference": { "type": "PubMed", "id": "38486171", "url": "https://pubmed.ncbi.nlm.nih.gov/38486171" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38486171", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of the human MRE11 homologue.", "journal": "Genomics", "date": "1995", "authors": "Petrini JH, Walsh ME, DiMare C, Chen XN, Korenberg JR, Weaver DT", "reference": { "type": "PubMed", "id": "8530104", "url": "https://pubmed.ncbi.nlm.nih.gov/8530104" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8530104", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ataxia without telangiectasia masquerading as benign hereditary chorea.", "journal": "Movement disorders : official journal of the Movement Disorder Society", "date": "1996-03", "authors": "Klein C, Wenning G K, Quinn N P, Marsden C D", "reference": { "type": "PubMed", "id": "8684395", "url": "https://pubmed.ncbi.nlm.nih.gov/8684395" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P49959-1", "protein_name": "Double-strand break repair protein MRE11", "gene_name": "MRE11", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P49959", "url": "https://www.uniprot.org/uniprotkb/P49959" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs137852760", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137852760" }, { "id": "rs137852760", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs137852760" }, { "id": "rs137852760", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs137852760#frequency_tab" }, { "id": "rs137852760", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs137852760" }, { "id": "10612394", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/10612394" }, { "id": "11371508", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/11371508" }, { "id": "8684395", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/8684395" }, { "id": "rs137852760", "database": "COSMIC", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs137852760" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 117, "end_pos": 117, "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 filters: n-glyco-sequon-gain (NLN->NLS).", "chr_id": "11", "chr_pos": "94479726", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N117", "disease": [ { "disease_id": "DOID:0081384", "recommended_name": { "id": "DOID:0081384", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0081384", "name": "ataxia-telangiectasia-like disorder 1", "description": "An autosomal recessive cerebellar ataxia that is characterized clinically by progressive cerebellar degeneration resulting in ataxia and oculomotor apraxia and that has_material_basis_in homozygous or compound heterozygous mutation in the MRE11A gene (MRE11) on chromosome 11q21." }, "synonyms": [ { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder 1", "description": "Any ataxia-telangiectasia-like disorder in which the cause of the disease is a mutation in the MRE11 gene." }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "MRE11 ataxia - telangiectasia-like disorder", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "MRE11 ataxia-telangiectasia-like disorder", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia - telangiectasia-like disorder caused by mutation in MRE11", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder 1", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ataxia-telangiectasia-like disorder caused by mutation in MRE11", "description": "" }, { "id": "MONDO:0024557", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0024557", "name": "ATLD1", "description": "" }, { "id": "MIM:604391", "resource": "MIM", "url": "https://www.omim.org/entry/604391", "name": "Ataxia-telangiectasia-like disorder 1", "description": "Ataxia-telangiectasia-like disorder 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "604391", "database": "MIM", "url": "https://www.omim.org/entry/604391" }, { "id": "0081384", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0081384" } ] } ], "keywords": [ "ebi", "somatic", "disease" ], "filter_code": "001000000000000000000.00000000000000.000000000001000000.00101.01.000.110", "uniprot_canonical_ac": "P49959-1" } ], "record_id": "pubmed.8684395", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells.", "journal": "Scientific reports", "date": "2014", "authors": "Aomatsu E, Takahashi N, Sawada S, Okubo N, Hasegawa T, Taira M, Miura H, Ishisaki A, Chosa N", "reference": { "type": "PubMed", "id": "24413464", "url": "https://pubmed.ncbi.nlm.nih.gov/24413464" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75711-1", "protein_name": "Scrapie-responsive protein 1", "gene_name": "SCRG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75711", "url": "https://www.uniprot.org/uniprotkb/O75711" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24413464", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "linc-SCRG1 accelerates liver fibrosis by decreasing RNA-binding protein tristetraprolin.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2019", "authors": "Wu JC, Luo SZ, Liu T, Lu LG, Xu MY", "reference": { "type": "PubMed", "id": "30226813", "url": "https://pubmed.ncbi.nlm.nih.gov/30226813" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75711-1", "protein_name": "Scrapie-responsive protein 1", "gene_name": "SCRG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75711", "url": "https://www.uniprot.org/uniprotkb/O75711" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30226813", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Haploinsufficiency of the basic helix-loop-helix transcription factor HAND2 causes congenital heart defects.", "journal": "American journal of medical genetics. Part A", "date": "2020", "authors": "Cohen ASA, Simotas C, Webb BD, Shi H, Khan WA, Edelmann L, Scott SA, Singh R", "reference": { "type": "PubMed", "id": "32134193", "url": "https://pubmed.ncbi.nlm.nih.gov/32134193" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75711-1", "protein_name": "Scrapie-responsive protein 1", "gene_name": "SCRG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75711", "url": "https://www.uniprot.org/uniprotkb/O75711" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32134193", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of SCRG1 as a Potential Therapeutic Target for Human Synovial Inflammation.", "journal": "Frontiers in immunology", "date": "2022", "authors": "Liu G, He G, Zhang J, Zhang Z, Wang L", "reference": { "type": "PubMed", "id": "35720295", "url": "https://pubmed.ncbi.nlm.nih.gov/35720295" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75711-1", "protein_name": "Scrapie-responsive protein 1", "gene_name": "SCRG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75711", "url": "https://www.uniprot.org/uniprotkb/O75711" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35720295", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of a Novel Angiogenesis Signalling circSCRG1/miR-1268b/NR4A1 Pathway in Atherosclerosis and the Regulatory Effects of TMP-PF In Vitro.", "journal": "Molecules (Basel, Switzerland)", "date": "2023-01-28", "authors": "Yuan Rong, Xin Qiqi, Ma Xiaochang, Yu Meng, Miao Yu, Chen Keji, Cong Weihong", "reference": { "type": "PubMed", "id": "36770940", "url": "https://pubmed.ncbi.nlm.nih.gov/36770940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75711-1", "protein_name": "Scrapie-responsive protein 1", "gene_name": "SCRG1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75711", "url": "https://www.uniprot.org/uniprotkb/O75711" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36770940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the human analogue of a scrapie-responsive gene.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Dron M, Dandoy-Dron F, Guillo F, Benboudjema L, Hauw JJ, Lebon P, Dormont D, Tovey MG", "reference": { "type": "PubMed", "id": "9660755", "url": "https://pubmed.ncbi.nlm.nih.gov/9660755" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O75711-1", "protein_name": "Scrapie-responsive protein 1", "gene_name": "SCRG1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O88745-1", "protein_name": "Scrapie-responsive protein 1", "gene_name": "Scrg1", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75711", "url": "https://www.uniprot.org/uniprotkb/O75711" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9660755", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TMEM147 interacts with lamin B receptor, regulates its localization and levels, and affects cholesterol homeostasis.", "journal": "Journal of cell science", "date": "2020", "authors": "Christodoulou A, Maimaris G, Makrigiorgi A, Charidemou E, Luchtenborg C, Ververis A, Georgiou R, Lederer CW, Haffner C, Brugger B, Santama N", "reference": { "type": "PubMed", "id": "32694168", "url": "https://pubmed.ncbi.nlm.nih.gov/32694168" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BVK8-1", "protein_name": "BOS complex subunit TMEM147", "gene_name": "TMEM147", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BQJ4-1", "protein_name": "Transmembrane protein 47", "gene_name": "TMEM47", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BVK8", "url": "https://www.uniprot.org/uniprotkb/Q9BVK8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32694168", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of ER Composition and Extent, and Putative Action in Protein Networks by ER/NE Protein TMEM147.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Maimaris G, Christodoulou A, Santama N, Lederer CW", "reference": { "type": "PubMed", "id": "34638576", "url": "https://pubmed.ncbi.nlm.nih.gov/34638576" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BVK8-1", "protein_name": "BOS complex subunit TMEM147", "gene_name": "TMEM147", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BVK8", "url": "https://www.uniprot.org/uniprotkb/Q9BVK8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34638576", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bi-allelic loss-of-function variants in TMEM147 cause moderate to profound intellectual disability with facial dysmorphism and pseudo-Pelger-Hu\u00ebt anomaly.", "journal": "American journal of human genetics", "date": "2022-10-06", "authors": "Thomas Quentin, Motta Marialetizia, Gautier Thierry, Zaki Maha S, Ciolfi Andrea, Paccaud Julien, Girodon Fran\u00e7ois, Boespflug-Tanguy Odile, Besnard Thomas, Kerkhof Jennifer, McConkey Haley, Masson Aymeric, Denomm\u00e9-Pichon Anne-Sophie, Cogn\u00e9 Benjamin, Trochu Eva, Vignard Virginie, El It Fatima, Rodan Lance H, Alkhateeb Mohammad Ayman, Jamra Rami Abou, Duplomb Laurence, Tisserant Emilie, Duffourd Yannis, Bruel Ange-Line, Jackson Adam, Banka Siddharth, McEntagart Meriel, Saggar Anand, Gleeson Joseph G, Sievert David, Bae Hyunwoo, Lee Beom Hee, Kwon Kisang, Seo Go Hun, Lee Hane, Saeed Anjum, Anjum Nadeem, Cheema Huma, Alawbathani Salem, Khan Imran, Pinto-Basto Jorge, Teoh Joyce, Wong Jasmine, Sahari Umar Bin Mohamad, Houlden Henry, Zhelcheska Kristina, Pannetier Melanie, Awad Mona A, Lesieur-Sebellin Marion, Barcia Giulia, Amiel Jeanne, Delanne Julian, Philippe Christophe, Faivre Laurence, Odent Sylvie, Bertoli-Avella Aida, Thauvin Christel, Sadikovic Bekim, Reversade Bruno, Maroofian Reza, Govin J\u00e9r\u00f4me, Tartaglia Marco, Vitobello Antonio", "reference": { "type": "PubMed", "id": "36044892", "url": "https://pubmed.ncbi.nlm.nih.gov/36044892" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BVK8-1", "protein_name": "BOS complex subunit TMEM147", "gene_name": "TMEM147", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BVK8", "url": "https://www.uniprot.org/uniprotkb/Q9BVK8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36044892", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TMEM147 Correlates with Immune Infiltration and Serve as a Potential Prognostic Biomarker in Hepatocellular Carcinoma.", "journal": "Analytical cellular pathology (Amsterdam)", "date": "2023", "authors": "Cheng Sheng, Li Jutang, Xu Ming, Bao Qun, Wu Jiaoxiang, Sun Peng, Han Bo", "reference": { "type": "PubMed", "id": "37305689", "url": "https://pubmed.ncbi.nlm.nih.gov/37305689" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BVK8-1", "protein_name": "BOS complex subunit TMEM147", "gene_name": "TMEM147", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BVK8", "url": "https://www.uniprot.org/uniprotkb/Q9BVK8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37305689", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A biallelic loss-of-function variant in TMEM147 causes profound intellectual disability and spasticity.", "journal": "Neurogenetics", "date": "2023-10", "authors": "Ghorashi Tahereh, Darvish Hossein, Bakhtiari Somayeh, Tafakhori Abbas, Kruer Michael C, Mozdarani Hossein", "reference": { "type": "PubMed", "id": "37668766", "url": "https://pubmed.ncbi.nlm.nih.gov/37668766" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BVK8-1", "protein_name": "BOS complex subunit TMEM147", "gene_name": "TMEM147", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BVK8", "url": "https://www.uniprot.org/uniprotkb/Q9BVK8" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37668766", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Secondary structure of human granulocyte colony-stimulating factor derived from NMR spectroscopy.", "journal": "FEBS Lett.", "date": "1992", "authors": "Zink T, Ross A, Ambrosius D, Rudolph R, Holak TA", "reference": { "type": "PubMed", "id": "1281794", "url": "https://pubmed.ncbi.nlm.nih.gov/1281794" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1281794", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Change in the accessibility of an epitope of the human granulocyte-colony stimulating factor after binding to receptors.", "journal": "Cytokine", "date": "2003-04", "authors": "Marino Ver\u00f3nica J, Sterin-Prync A\u00edda E, Roguin Leonor P", "reference": { "type": "PubMed", "id": "12946100", "url": "https://pubmed.ncbi.nlm.nih.gov/12946100" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12946100", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Granulocyte colony-stimulating factor expression as a prognostic biomarker in non-small cell lung cancer.", "journal": "Oncology reports", "date": "2011", "authors": "Stathopoulos GP, Armakolas A, Tranga T, Marinou H, Stathopoulos J, Chandrinou H", "reference": { "type": "PubMed", "id": "21431281", "url": "https://pubmed.ncbi.nlm.nih.gov/21431281" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "biomarkers": [ { "best_biomarker_role": [ "prognostic" ], "biomarker_canonical_id": "AN6332", "assessed_biomarker_entity": [ "Granulocyte colony-stimulating factor" ], "biomarker_id": "AN6332-1", "biomarker": [ "increased CSF3 level" ], "condition": { "id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "name_list": [ "lung cancer", "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "adenocarcinoma of lung, somatic", "cancer of lung", "lung cancer, protection against, autosomal dominant, somatic mutation", "lung cancer, resistance to, autosomal dominant, somatic mutation", "lung cancer, somatic", "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "malignant lung neoplasm", "malignant lung tumor", "malignant lung tumour", "malignant neoplasm of lung", "malignant neoplasm of the lung", "malignant tumor of lung", "malignant tumor of the lung", "malignant tumour of lung", "malignant tumour of the lung", "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "nonsmall cell lung cancer, somatic", "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "lung cancer susceptibility 1", "LNCR1", "lung cancer susceptibility", "lung cancer susceptibility 3", "LNCR3", "lung cancer susceptibility 4", "LNCR4", "lung cancer susceptibility 5", "LNCR5", "Lung cancer" ], "id_list": [ "DOID:1324", "MONDO:0008903", "MONDO:0012159", "MONDO:0012942", "MONDO:0012955", "MONDO:0013631", "MIM:211980" ] } } ], "record_id": "pubmed.21431281", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recombinant human granulocyte colony-stimulating factor: effects on normal and leukemic myeloid cells.", "journal": "Science", "date": "1986", "authors": "Souza L M, Boone T C, Gabrilove J, Lai P H, Zsebo K M, Murdock D C, Chazin V R, Bruszewski J, Lu H, Chen K K, Barendt J, Platzer E, Moore M A S, Mertelsmann R, Welte K", "reference": { "type": "PubMed", "id": "2420009", "url": "https://pubmed.ncbi.nlm.nih.gov/2420009" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2420009", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The chromosomal gene structure and two mRNAs for human granulocyte colony-stimulating factor.", "journal": "EMBO J.", "date": "1986", "authors": "Nagata S, Tsuchiya M, Asano S, Yamamoto O, Hirata Y, Kubota N, Oheda M, Nomura H, Yamazaki T", "reference": { "type": "PubMed", "id": "2423327", "url": "https://pubmed.ncbi.nlm.nih.gov/2423327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2423327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and expression of cDNA for human granulocyte colony-stimulating factor.", "journal": "Nature", "date": "1986", "authors": "Nagata S, Tsuchiya M, Asano S, Kaziro Y, Yamazaki T, Yamamoto O, Hirata Y, Kubota N, Oheda M, Nomura H", "reference": { "type": "PubMed", "id": "3484805", "url": "https://pubmed.ncbi.nlm.nih.gov/3484805" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3484805", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of granulocyte colony-stimulating factor by human cell lines.", "journal": "J. Leukoc. Biol.", "date": "1987", "authors": "Devlin J J, Devlin P E, Myambo K, Lilly M B, Rado T A, Warren M K", "reference": { "type": "PubMed", "id": "3494801", "url": "https://pubmed.ncbi.nlm.nih.gov/3494801" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.3494801", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Elevated G-CSF, IL8, and HGF in patients with definite Meniere's disease may indicate the role of NET formation in triggering autoimmunity and autoinflammation.", "journal": "Scientific reports", "date": "2022", "authors": "Zou J, Zhao Z, Song X, Zhang G, Li H, Zhang Q, Pyykko I", "reference": { "type": "PubMed", "id": "36175465", "url": "https://pubmed.ncbi.nlm.nih.gov/36175465" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36175465", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tumor-derived GCSF Alters Tumor and Systemic Immune System Cell Subset Composition and Signaling.", "journal": "Cancer research communications", "date": "2023-03", "authors": "Matos Israel, Barvalia Maunish, Chehal Manreet K, Robertson A Gordon, Kulic Iva, Silva Jessica A F D, Ranganathan Abhinandan, Short Amy, Huang Yu-Hsuan, Long Erin, Priatel John J, Dhanji Salim, Nelson Brad H, Krebs Danielle L, Harder Kenneth W", "reference": { "type": "PubMed", "id": "36911097", "url": "https://pubmed.ncbi.nlm.nih.gov/36911097" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36911097", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G-CSF reshapes the cytosolic PCNA scaffold and modulates glycolysis in neutrophils.", "journal": "Journal of leukocyte biology", "date": "2024-01-19", "authors": "Aymonnier Karen, Bosetta Enzo, Leborgne Nathan G F, Ullmer Audrey, Le Gall Morgane, De Chiara Alessia, Salnot Virginie, Many Souganya, Scapini Patrizia, Wicks Ian, Chatfield Simon, Martin Katherine R, Witko-Sarsat V\u00e9ronique", "reference": { "type": "PubMed", "id": "37824822", "url": "https://pubmed.ncbi.nlm.nih.gov/37824822" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37824822", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Serum cytokines MCP-1 and GCS-F as potential biomarkers in pediatric inflammatory bowel disease.", "journal": "PloS one", "date": "2023", "authors": "Ott Andrea, Tutdibi Erol, Goedicke-Fritz Sybelle, Sch\u00f6pe Jakob, Zemlin Michael, Nourkami-Tutdibi Nasenien", "reference": { "type": "PubMed", "id": "37922289", "url": "https://pubmed.ncbi.nlm.nih.gov/37922289" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37922289", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure and dynamics of the human granulocyte colony-stimulating factor determined by NMR spectroscopy. Loop mobility in a four-helix-bundle protein.", "journal": "Biochemistry", "date": "1994", "authors": "Zink T, Ross A, L\u00fcers K, Cieslar C, Rudolph R, Holak T A", "reference": { "type": "PubMed", "id": "7518249", "url": "https://pubmed.ncbi.nlm.nih.gov/7518249" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7518249", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structure of granulocyte-colony-stimulating factor and its relationship to other growth factors.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1993", "authors": "Hill C P, Osslund T D, Eisenberg D", "reference": { "type": "PubMed", "id": "7685117", "url": "https://pubmed.ncbi.nlm.nih.gov/7685117" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7685117", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glycosidase digestion, electrophoresis and chromatographic analysis of recombinant human granulocyte colony-stimulating factor glycoforms produced in Chinese hamster ovary cells.", "journal": "J. Chromatogr. A", "date": "1993", "authors": "Clogston C L, Hu S, Boone T C, Lu H S", "reference": { "type": "PubMed", "id": "7685769", "url": "https://pubmed.ncbi.nlm.nih.gov/7685769" }, "referenced_glycans": [ { "glytoucan_ac": "G65191ST" }, { "glytoucan_ac": "G56299XO" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "P09919-1", "protein_name": "Granulocyte colony-stimulating factor", "gene_name": "CSF3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P09919", "url": "https://www.uniprot.org/uniprotkb/P09919" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7685769", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cloning of a mammalian transcriptional activator that binds unmethylated CpG motifs and shares a CXXC domain with DNA methyltransferase, human trithorax, and methyl-CpG binding domain protein 1.", "journal": "Mol. Cell. Biol.", "date": "2000", "authors": "Voo K S, Carlone D L, Jacobsen B M, Flodin A, Skalnik D G", "reference": { "type": "PubMed", "id": "10688657", "url": "https://pubmed.ncbi.nlm.nih.gov/10688657" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0U4-1", "protein_name": "CXXC-type zinc finger protein 1", "gene_name": "CXXC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10688657", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PCCX1, a novel DNA-binding protein with PHD finger and CXXC domain, is regulated by proteolysis.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2000", "authors": "Fujino T, Hasegawa M, Shibata S, Kishimoto T, Imai S, Takano T", "reference": { "type": "PubMed", "id": "10799292", "url": "https://pubmed.ncbi.nlm.nih.gov/10799292" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0U4-1", "protein_name": "CXXC-type zinc finger protein 1", "gene_name": "CXXC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10799292", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification and characterization of the DNA binding domain of CpG-binding protein.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Lee JH, Voo KS, Skalnik DG", "reference": { "type": "PubMed", "id": "11572867", "url": "https://pubmed.ncbi.nlm.nih.gov/11572867" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0U4-1", "protein_name": "CXXC-type zinc finger protein 1", "gene_name": "CXXC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 169, "end_pos": 169, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of DNA binding activity. No effect on localization in nuclear speckles.", "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" }, { "database": "PubMed", "id": "11572867", "url": "https://pubmed.ncbi.nlm.nih.gov/11572867" } ], "uniprot_canonical_ac": "Q9P0U4-1" }, { "start_pos": 208, "end_pos": 208, "sequence_org": "C", "sequence_mut": "A", "comment": "Complete loss of DNA binding activity. No effect on localization in nuclear speckles.", "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" }, { "database": "PubMed", "id": "11572867", "url": "https://pubmed.ncbi.nlm.nih.gov/11572867" } ], "uniprot_canonical_ac": "Q9P0U4-1" } ], "record_id": "pubmed.11572867", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CpG-binding protein is a nuclear matrix- and euchromatin-associated protein localized to nuclear speckles containing human trithorax. Identification of nuclear matrix targeting signals.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Lee Jeong-Heon, Skalnik David G", "reference": { "type": "PubMed", "id": "12200428", "url": "https://pubmed.ncbi.nlm.nih.gov/12200428" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0U4-1", "protein_name": "CXXC-type zinc finger protein 1", "gene_name": "CXXC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12200428", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structural basis for selective binding of non-methylated CpG islands by the CFP1 CXXC domain.", "journal": "Nature communications", "date": "2011", "authors": "Xu Chao, Bian Chuanbing, Lam Robert, Dong Aiping, Min Jinrong", "reference": { "type": "PubMed", "id": "21407193", "url": "https://pubmed.ncbi.nlm.nih.gov/21407193" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0U4-1", "protein_name": "CXXC-type zinc finger protein 1", "gene_name": "CXXC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21407193", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analyzing the impact of CFP1 mutational landscape on epigenetic signaling.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2021", "authors": "Yang Y, Yang Y, Chan K, Couture JF", "reference": { "type": "PubMed", "id": "34320252", "url": "https://pubmed.ncbi.nlm.nih.gov/34320252" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0U4-1", "protein_name": "CXXC-type zinc finger protein 1", "gene_name": "CXXC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34320252", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CpG-binding protein CFP1 promotes ovarian cancer cell proliferation by regulating BST2 transcription.", "journal": "Cancer gene therapy", "date": "2022-12", "authors": "Yang Liu-Qing, Hu Han-Yin, Han Yao, Tang Ze-Yi, Gao Jie, Zhou Qi-Yin, Liu Yi-Xuan, Chen Hao-Sa, Xu Tu-Nan, Ao Lei, Xu Ying, Che Xuan, Jiang Ya-Bo, Xu Chun-Wei, Zhang Xian-Chao, Jiang Yu-Xin, Heger Michal, Wang Xiao-Min, Cheng Shu-Qun, Pan Wei-Wei", "reference": { "type": "PubMed", "id": "35864225", "url": "https://pubmed.ncbi.nlm.nih.gov/35864225" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0U4-1", "protein_name": "CXXC-type zinc finger protein 1", "gene_name": "CXXC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35864225", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cfp1 Controls Cardiomyocyte Maturation by Modifying Histone H3K4me3 of Structural, Metabolic, and Contractile Related Genes.", "journal": "Advanced science (Weinheim, Baden-Wurttemberg, Germany)", "date": "2024-01-09", "authors": "Li Changzhu, Zhang Yang, Shen Jingling, Bao Hairong, Zhao Yue, Li Desheng, Li Sijia, Liu Yining, Yang Jiming, Zhou Zhiwen, Gao Kangyi, Zhao Lexin, Pei Yao, Lu Yanjie, Pan Zhenwei, Cai Benzhi", "reference": { "type": "PubMed", "id": "38196272", "url": "https://pubmed.ncbi.nlm.nih.gov/38196272" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9P0U4-1", "protein_name": "CXXC-type zinc finger protein 1", "gene_name": "CXXC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9P0U4", "url": "https://www.uniprot.org/uniprotkb/Q9P0U4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38196272", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dephosphorylation of specific sites in the kinase-specificity sequence domain leads to ubiquitin-mediated degradation of the tyrosine phosphatase STEP.", "journal": "The Biochemical journal", "date": "2011", "authors": "Mukherjee S, Poddar R, Deb I, Paul S", "reference": { "type": "PubMed", "id": "21777200", "url": "https://pubmed.ncbi.nlm.nih.gov/21777200" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P54829-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 5", "gene_name": "PTPN5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P54829", "url": "https://www.uniprot.org/uniprotkb/P54829" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 245, "end_pos": 245, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "P54829", "url": "https://www.uniprot.org/uniprotkb/P54829" }, { "database": "iPTMnet", "id": "P54829", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54829" }, { "database": "PubMed", "id": "21777200", "url": "https://pubmed.ncbi.nlm.nih.gov/21777200" } ], "site_lbl": "Ser245", "uniprot_canonical_ac": "P54829-1" }, { "start_pos": 255, "end_pos": 255, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MAPK", "evidence": [ { "database": "UniProtKB", "id": "P54829", "url": "https://www.uniprot.org/uniprotkb/P54829" }, { "database": "iPTMnet", "id": "P54829", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54829" }, { "database": "PubMed", "id": "21777200", "url": "https://pubmed.ncbi.nlm.nih.gov/21777200" } ], "site_lbl": "Thr255", "uniprot_canonical_ac": "P54829-1" }, { "start_pos": 268, "end_pos": 268, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK", "evidence": [ { "database": "UniProtKB", "id": "P54829", "url": "https://www.uniprot.org/uniprotkb/P54829" }, { "database": "iPTMnet", "id": "P54829", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P54829" }, { "database": "PubMed", "id": "21777200", "url": "https://pubmed.ncbi.nlm.nih.gov/21777200" } ], "site_lbl": "Ser268", "uniprot_canonical_ac": "P54829-1" } ], "record_id": "pubmed.21777200", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Inhibition of striatal-enriched protein tyrosine phosphatase (STEP) activity reverses behavioral deficits in a rodent model of autism.", "journal": "Behavioural brain research", "date": "2020", "authors": "Chatterjee M, Singh P, Xu J, Lombroso PJ, Kurup PK", "reference": { "type": "PubMed", "id": "32461127", "url": "https://pubmed.ncbi.nlm.nih.gov/32461127" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P54829-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 5", "gene_name": "PTPN5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P54829", "url": "https://www.uniprot.org/uniprotkb/P54829" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32461127", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PTPN5 promotes follicle-stimulating hormone secretion through regulating intracellular calcium homeostasis.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2021", "authors": "Wang H, Bu S, Tang J, Li Y, Liu C, Dong J", "reference": { "type": "PubMed", "id": "34270805", "url": "https://pubmed.ncbi.nlm.nih.gov/34270805" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P54829-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 5", "gene_name": "PTPN5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P54829", "url": "https://www.uniprot.org/uniprotkb/P54829" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34270805", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of the human homolog of a striatum-enriched phosphatase (STEP) gene and chromosomal mapping of the human and murine loci.", "journal": "Genomics", "date": "1995", "authors": "Li X, Luna J, Lombroso PJ, Francke U", "reference": { "type": "PubMed", "id": "7490079", "url": "https://pubmed.ncbi.nlm.nih.gov/7490079" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P54829-1", "protein_name": "Tyrosine-protein phosphatase non-receptor type 5", "gene_name": "PTPN5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P54829", "url": "https://www.uniprot.org/uniprotkb/P54829" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7490079", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Processing and transport of matrix gamma-carboxyglutamic acid protein and bone morphogenetic protein-2 in cultured human vascular smooth muscle cells: evidence for an uptake mechanism for serum fetuin.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wajih N, Borras T, Xue W, Hutson SM, Wallin R", "reference": { "type": "PubMed", "id": "15280384", "url": "https://pubmed.ncbi.nlm.nih.gov/15280384" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGM5-1", "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGM5", "url": "https://www.uniprot.org/uniprotkb/Q9UGM5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15280384", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fetuin-B, a liver-derived plasma protein is essential for fertilization.", "journal": "Dev. Cell", "date": "2013", "authors": "Dietzel E, Wessling J, Floehr J, Schafer C, Ensslen S, Denecke B, Rosing B, Neulen J, Veitinger T, Spehr M, Tropartz T, Tolba R, Renne T, Egert A, Schorle H, Gottenbusch Y, Hildebrand A, Yiallouros I, Stocker W, Weiskirchen R, Jahnen-Dechent W", "reference": { "type": "PubMed", "id": "23562279", "url": "https://pubmed.ncbi.nlm.nih.gov/23562279" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGM5-1", "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXC1-1", "protein_name": "Fetuin-B", "gene_name": "Fetub", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGM5", "url": "https://www.uniprot.org/uniprotkb/Q9UGM5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23562279", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fetuin-B regulates vascular plaque rupture via TGF-beta receptor-mediated Smad pathway in vascular smooth muscle cells.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2020", "authors": "Jung SH, Lee D, Jin H, Lee HM, Ko HM, Lee KJ, Kim SJ, Ryu Y, Choi WS, Kim B, Won KJ", "reference": { "type": "PubMed", "id": "32382986", "url": "https://pubmed.ncbi.nlm.nih.gov/32382986" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGM5-1", "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGM5", "url": "https://www.uniprot.org/uniprotkb/Q9UGM5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32382986", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fetuin B overexpression suppresses proliferation, migration, and invasion in prostate cancer by inhibiting the PI3K/AKT signaling pathway.", "journal": "Biomedicine & pharmacotherapy = Biomedecine & pharmacotherapie", "date": "2020", "authors": "Zhan K, Liu R, Tong H, Gao S, Yang G, Hossain A, Li T, He W", "reference": { "type": "PubMed", "id": "32892030", "url": "https://pubmed.ncbi.nlm.nih.gov/32892030" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGM5-1", "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGM5", "url": "https://www.uniprot.org/uniprotkb/Q9UGM5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32892030", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hepatokine Fetuin B expression is regulated by leptin-STAT3 signalling and associated with leptin in obesity.", "journal": "Scientific reports", "date": "2022", "authors": "Wang D, Wu M, Zhang X, Li L, Lin M, Shi X, Zhao Y, Huang C, Li X", "reference": { "type": "PubMed", "id": "35896788", "url": "https://pubmed.ncbi.nlm.nih.gov/35896788" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGM5-1", "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGM5", "url": "https://www.uniprot.org/uniprotkb/Q9UGM5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35896788", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fetuin-B Overexpression Promotes Inflammation in Diabetic Retinopathy Through Activating Microglia and the NF-\u03baB Signaling Pathway.", "journal": "Current eye research", "date": "2024-02", "authors": "Zhang Wenyi, Yao Jing, Chen Chen, Wang Jianming, Zhou Aiyi", "reference": { "type": "PubMed", "id": "37883127", "url": "https://pubmed.ncbi.nlm.nih.gov/37883127" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9UGM5-1", "protein_name": "Fetuin-B", "gene_name": "FETUB", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9QXC1-1", "protein_name": "Fetuin-B", "gene_name": "Fetub", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9UGM5", "url": "https://www.uniprot.org/uniprotkb/Q9UGM5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37883127", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The landscape of genetic diseases in Saudi Arabia based on the first 1000 diagnostic panels and exomes.", "journal": "Hum. Genet.", "date": "2017", "authors": "Monies Dorota, Abouelhoda Mohamed, AlSayed Moeenaldeen, Alhassnan Zuhair, Alotaibi Maha, Kayyali Husam, Al-Owain Mohammed, Shah Ayaz, Rahbeeni Zuhair, Al-Muhaizea Mohammad A, Alzaidan Hamad I, Cupler Edward, Bohlega Saeed, Faqeih Eissa, Faden Maha, Alyounes Banan, Jaroudi Dyala, Goljan Ewa, Elbardisy Hadeel, Akilan Asma, Albar Renad, Aldhalaan Hesham, Gulab Shamshad, Chedrawi Aziza, Al Saud Bandar K, Kurdi Wesam, Makhseed Nawal, Alqasim Tahani, El Khashab Heba Y, Al-Mousa Hamoud, Alhashem Amal, Kanaan Imaduddin, Algoufi Talal, Alsaleem Khalid, Basha Talal A, Al-Murshedi Fathiya, Khan Sameena, Al-Kindy Adila, Alnemer Maha, Al-Hajjar Sami, Alyamani Suad, Aldhekri Hasan, Al-Mehaidib Ali, Arnaout Rand, Dabbagh Omar, Shagrani Mohammad, Broering Dieter, Tulbah Maha, Alqassmi Amal, Almugbel Maisoon, AlQuaiz Mohammed, Alsaman Abdulaziz, Al-Thihli Khalid, Sulaiman Raashda A, Al-Dekhail Wajeeh, Alsaegh Abeer, Bashiri Fahad A, Qari Alya, Alhomadi Suzan, Alkuraya Hisham, Alsebayel Mohammed, Hamad Muddathir H, Szonyi Laszlo, Abaalkhail Faisal, Al-Mayouf Sulaiman M, Almojalli Hamad, Alqadi Khalid S, Elsiesy Hussien, Shuaib Taghreed M, Seidahmed Mohammed Zain, Abosoudah Ibraheem, Akleh Hana, AlGhonaium Abdulaziz, Alkharfy Turki M, Al Mutairi Fuad, Eyaid Wafa, Alshanbary Abdullah, Sheikh Farrukh R, Alsohaibani Fahad I, Alsonbul Abdullah, Al Tala Saeed, Balkhy Soher, Bassiouni Randa, Alenizi Ahmed S, Hussein Maged H, Hassan Saeed, Khalil Mohamed, Tabarki Brahim, Alshahwan Saad, Oshi Amira, Sabr Yasser, Alsaadoun Saad, Salih Mustafa A, Mohamed Sarar, Sultana Habiba, Tamim Abdullah, El-Haj Moayad, Alshahrani Saif, Bubshait Dalal K, Alfadhel Majid, Faquih Tariq, El-Kalioby Mohamed, Subhani Shazia, Shah Zeeshan, Moghrabi Nabil, Meyer Brian F, Alkuraya Fowzan S", "reference": { "type": "PubMed", "id": "28600779", "url": "https://pubmed.ncbi.nlm.nih.gov/28600779" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BQA9-1", "protein_name": "Cytochrome b-245 chaperone 1", "gene_name": "CYBC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P23763-1", "protein_name": "Vesicle-associated membrane protein 1", "gene_name": "VAMP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BQA9", "url": "https://www.uniprot.org/uniprotkb/Q9BQA9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28600779", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A homozygous loss-of-function mutation leading to CYBC1 deficiency causes chronic granulomatous disease.", "journal": "Nature communications", "date": "2018", "authors": "Arnadottir GA, Norddahl GL, Gudmundsdottir S, Agustsdottir AB, Sigurdsson S, Jensson BO, Bjarnadottir K, Theodors F, Benonisdottir S, Ivarsdottir EV, Oddsson A, Kristjansson RP, Sulem G, Alexandersson KF, Juliusdottir T, Gudmundsson KR, Saemundsdottir J, Jonasdottir A, Jonasdottir A, Sigurdsson A, Manzanillo P, Gudjonsson SA, Thorisson GA, Magnusson OT, Masson G, Orvar KB, Holm H, Bjornsson S, Arngrimsson R, Gudbjartsson DF, Thorsteinsdottir U, Jonsdottir I, Haraldsson A, Sulem P, Stefansson K", "reference": { "type": "PubMed", "id": "30361506", "url": "https://pubmed.ncbi.nlm.nih.gov/30361506" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BQA9-1", "protein_name": "Cytochrome b-245 chaperone 1", "gene_name": "CYBC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BQA9", "url": "https://www.uniprot.org/uniprotkb/Q9BQA9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30361506", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "HSCT in two brothers with CGD arising from mutations in CYBC1 corrects the defect in neutrophil function.", "journal": "Clinical immunology (Orlando, Fla.)", "date": "2021", "authors": "Perez-Heras I, Tsilifis C, Slatter MA, Brynjolfsson SF, Haraldsson A, Gennery AR", "reference": { "type": "PubMed", "id": "34280579", "url": "https://pubmed.ncbi.nlm.nih.gov/34280579" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BQA9-1", "protein_name": "Cytochrome b-245 chaperone 1", "gene_name": "CYBC1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BQA9", "url": "https://www.uniprot.org/uniprotkb/Q9BQA9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34280579", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DCUN1D3, a novel UVC-responsive gene that is involved in cell cycle progression and cell growth.", "journal": "Cancer science", "date": "2008", "authors": "Ma T, Shi T, Huang J, Wu L, Hu F, He P, Deng W, Gao P, Zhang Y, Song Q, Ma D, Qiu X", "reference": { "type": "PubMed", "id": "18823379", "url": "https://pubmed.ncbi.nlm.nih.gov/18823379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWE4-1", "protein_name": "DCN1-like protein 3", "gene_name": "DCUN1D3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWE4", "url": "https://www.uniprot.org/uniprotkb/Q8IWE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18823379", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DCUN1D3 activates SCFSKP2 ubiquitin E3 ligase activity and cell cycle progression under UV damage.", "journal": "Oncotarget", "date": "2016", "authors": "Zhang S, Huang J, Shi T, Hu F, Zhang L, Zhou PK, Ma D, Ma T, Qiu X", "reference": { "type": "PubMed", "id": "27542266", "url": "https://pubmed.ncbi.nlm.nih.gov/27542266" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWE4-1", "protein_name": "DCN1-like protein 3", "gene_name": "DCUN1D3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWE4", "url": "https://www.uniprot.org/uniprotkb/Q8IWE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27542266", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Bladder Cancer Progression Is Suppressed Through the Heart and Neural Crest Derivatives Expressed 2-Antisense RNA 1/microRNA-93-5p/Defective in Cullin Neddylation 1 Domain Containing 3 Axis.", "journal": "Applied biochemistry and biotechnology", "date": "2023-07", "authors": "Wu Xiang, Xu Qingjiang, Li Tao, Wei Yongbao, Zeng Rong, Lin Rongcheng, Xu Lina, Ye Liefu, Liu Zhihua", "reference": { "type": "PubMed", "id": "36656536", "url": "https://pubmed.ncbi.nlm.nih.gov/36656536" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8IWE4-1", "protein_name": "DCN1-like protein 3", "gene_name": "DCUN1D3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8IWE4", "url": "https://www.uniprot.org/uniprotkb/Q8IWE4" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36656536", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "G protein beta 3 gene: structure, promoter, and additional polymorphisms.", "journal": "Hypertension", "date": "2000", "authors": "Rosskopf D, Busch S, Manthey I, Siffert W", "reference": { "type": "PubMed", "id": "10904009", "url": "https://pubmed.ncbi.nlm.nih.gov/10904009" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16520", "url": "https://www.uniprot.org/uniprotkb/P16520" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10904009", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the splice variant Gbeta3v of the human G-protein Gbeta3 subunit.", "journal": "Biochimica et biophysica acta", "date": "2003", "authors": "Rosskopf D, Kielbik M, Manthey I, Bilmen G, Eisenhardt A, Siffert W", "reference": { "type": "PubMed", "id": "12697327", "url": "https://pubmed.ncbi.nlm.nih.gov/12697327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16520", "url": "https://www.uniprot.org/uniprotkb/P16520" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12697327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of beta 3 subunit, a third form of the G protein beta-subunit polypeptide.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1990", "authors": "Levine M A, Smallwood P M, Moen P T, Helman L J, Ahn T G", "reference": { "type": "PubMed", "id": "2107550", "url": "https://pubmed.ncbi.nlm.nih.gov/2107550" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16520", "url": "https://www.uniprot.org/uniprotkb/P16520" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.2107550", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biallelic Mutations in GNB3 Cause a Unique Form of Autosomal-Recessive Congenital Stationary Night Blindness.", "journal": "American journal of human genetics", "date": "2016", "authors": "Vincent A, Audo I, Tavares E, Maynes JT, Tumber A, Wright T, Li S, Michiels C, Condroyer C, MacDonald H, Verdet R, Sahel JA, Hamel CP, Zeitz C, Heon E", "reference": { "type": "PubMed", "id": "27063057", "url": "https://pubmed.ncbi.nlm.nih.gov/27063057" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16520", "url": "https://www.uniprot.org/uniprotkb/P16520" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27063057", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of miRNA targetome variants in LAMC1 and GNB3 genes with colorectal cancer and obesity.", "journal": "Cancer medicine", "date": "2022-11", "authors": "Gholami Morteza, Zoughi Marziyeh, Behboo Roobic, Taslimi Reza, Kazemeini Alireza, Bastami Milad, Hasani-Ranjbar Shirin, Larijani Bagher, Amoli Mahsa M", "reference": { "type": "PubMed", "id": "35373932", "url": "https://pubmed.ncbi.nlm.nih.gov/35373932" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16520", "url": "https://www.uniprot.org/uniprotkb/P16520" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35373932", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Endothelium function biomarkers and carotid intima-media thickness changes in relation to NOS3 (rs2070744) and GNB3 (rs5443) genes polymorphism in the essential arterial hypertension.", "journal": "Endocrine regulations", "date": "2022", "authors": "Sydorchuk AR, Sydorchuk LP, Gutnitska AF, Dzhuryak VS, Kryvetska II, Sydorchuk RI, Ursuliak YV, Iftoda OM", "reference": { "type": "PubMed", "id": "35489051", "url": "https://pubmed.ncbi.nlm.nih.gov/35489051" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16520", "url": "https://www.uniprot.org/uniprotkb/P16520" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35489051", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of GNB3, ACE polymorphisms with POAG and NTG.", "journal": "Ophthalmic genetics", "date": "2024-02", "authors": "Samoylov Alexander N, Tumanova Polina, Pankratova Sofya A, Ashryatova Liana Sh, Plotnikov Denis", "reference": { "type": "PubMed", "id": "37997634", "url": "https://pubmed.ncbi.nlm.nih.gov/37997634" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P16520-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3", "gene_name": "GNB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P16520", "url": "https://www.uniprot.org/uniprotkb/P16520" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37997634", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]