[ { "title": "An association between the Trp64Arg polymorphism in the beta3-adrenergic receptor gene and endometrial cancer and obesity.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2004", "authors": "Babol K, Przybylowska K, Lukaszek M, Pertynski T, Blasiak J", "reference": { "type": "PubMed", "id": "15743038", "url": "https://pubmed.ncbi.nlm.nih.gov/15743038" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15743038", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The ADRB3 Trp64Arg variant and obesity in African-American breast cancer cases.", "journal": "International journal of obesity (2005)", "date": "2007", "authors": "McKean-Cowdin R, Li X, Bernstein L, McTiernan A, Ballard-Barbash R, Gauderman WJ, Gilliland F", "reference": { "type": "PubMed", "id": "17264845", "url": "https://pubmed.ncbi.nlm.nih.gov/17264845" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17264845", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of adrenergic receptor gene polymorphisms in gallbladder cancer susceptibility in a North Indian population.", "journal": "Journal of cancer research and clinical oncology", "date": "2014", "authors": "Rai R, Sharma KL, Misra S, Kumar A, Mittal B", "reference": { "type": "PubMed", "id": "24556804", "url": "https://pubmed.ncbi.nlm.nih.gov/24556804" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24556804", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of an ADRB3 Variant with Coronary Artery Disease Within the Chinese Han Population: Construction of a Predictive Nomogram Model.", "journal": "Genetic testing and molecular biomarkers", "date": "2023-03", "authors": "Zhang Jin-Yu, Zhao Qian, Li Xiao-Mei, Liu Fen, Zhao Qiang, Men Li, Chen Qing-Jie, Zhai Hui, Yang Yi-Ning", "reference": { "type": "PubMed", "id": "36989522", "url": "https://pubmed.ncbi.nlm.nih.gov/36989522" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36989522", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Effects of the Trp64Arg Polymorphism in the ADRB3 Gene on Body Composition, Cardiorespiratory Fitness, and Physical Activity in Healthy Adults.", "journal": "Genes", "date": "2023-07-27", "authors": "Potocka Natalia, Skrzypa Marzena, Zadarko-Domaradzka Maria, Barabasz Zbigniew, Penar-Zadarko Beata, Sakowicz Agata, Zadarko Emilian, Zawlik Izabela", "reference": { "type": "PubMed", "id": "37628593", "url": "https://pubmed.ncbi.nlm.nih.gov/37628593" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37628593", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Urinary beta 3-adrenoceptor as a diagnostic biomarker for overactive bladder in women.", "journal": "Scientific reports", "date": "2023-11-08", "authors": "Liang Ching-Chung, Hsieh Wu-Chiao, Lo Tsia-Shu, Huang Ting-Xuan, Chou Yi-Chun, Huang Jing-Yi, Huang Yung-Hsin", "reference": { "type": "PubMed", "id": "37938600", "url": "https://pubmed.ncbi.nlm.nih.gov/37938600" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37938600", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association between rs4994 variant in \u03b23-Adrenergic receptor and obesity in Vietnamese preschool-age children, independent of eating behaviors.", "journal": "BMC pediatrics", "date": "2024-09-18", "authors": "Hanh Nguyen Thi Hong, Trang Do Thi Nhu, Thu Nguyen Thi Trung, Tuyet Le Thi", "reference": { "type": "PubMed", "id": "39294633", "url": "https://pubmed.ncbi.nlm.nih.gov/39294633" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39294633", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic variation in the beta 3-adrenergic receptor and an increased capacity to gain weight in patients with morbid obesity.", "journal": "N. Engl. J. Med.", "date": "1995", "authors": "Clement K, Vaisse C, Manning BS, Basdevant A, Guy-Grand B, Ruiz J, Silver KD, Shuldiner AR, Froguel P, Strosberg AD", "reference": { "type": "PubMed", "id": "7609752", "url": "https://pubmed.ncbi.nlm.nih.gov/7609752" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7609752", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning of a human beta 3-adrenergic receptor cDNA.", "journal": "FEBS Lett.", "date": "1993", "authors": "Lelias J M, Kaghad M, Rodriguez M, Chalon P, Bonnin J, Dupre I, Delpech B, Bensaid M, LeFur G, Ferrara P", "reference": { "type": "PubMed", "id": "8389717", "url": "https://pubmed.ncbi.nlm.nih.gov/8389717" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8389717", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pharmacological characterization of a recently described human beta 3-adrenergic receptor mutant.", "journal": "Endocrinology", "date": "1996-06", "authors": "Candelore M R, Deng L, Tota L M, Kelly L J, Cascieri M A, Strader C D", "reference": { "type": "PubMed", "id": "8641219", "url": "https://pubmed.ncbi.nlm.nih.gov/8641219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8641219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of Trp64Arg mutation of the beta3-adrenergic-receptor with NIDDM and body weight gain.", "journal": "Diabetologia", "date": "1996", "authors": "Fujisawa T, Ikegami H, Yamato E, Takekawa K, Nakagawa Y, Hamada Y, Oga T, Ueda H, Shintani M, Fukuda M, Ogihara T", "reference": { "type": "PubMed", "id": "8721782", "url": "https://pubmed.ncbi.nlm.nih.gov/8721782" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8721782", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The negative inotropic effect of beta3-adrenoceptor stimulation is mediated by activation of a nitric oxide synthase pathway in human ventricle.", "journal": "The Journal of clinical investigation", "date": "1998-10-01", "authors": "Gauthier C, Leblais V, Kobzik L, Trochu J N, Khandoudi N, Bril A, Balligand J L, Le Marec H", "reference": { "type": "PubMed", "id": "9769330", "url": "https://pubmed.ncbi.nlm.nih.gov/9769330" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P13945-1", "protein_name": "Beta-3 adrenergic receptor", "gene_name": "ADRB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P13945", "url": "https://www.uniprot.org/uniprotkb/P13945" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9769330", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor", "journal": "Cell Host Microbe", "date": "2020", "authors": "Zhao P., Praissman J.L., Grant O.C., Cai Y., Xiao T., Rosenbalm K.E., Aoki K., Kellman B.P., Bridger R., Barouch D.H., Brindley M.A., Lewis N.E., Tiemeyer M., Chen B., Woods R.J., Wells L.", "reference": { "type": "DOI", "id": "10.1016/j.chom.2020.08.004", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, "referenced_glycans": [ { "glytoucan_ac": "G59937CP" }, { "glytoucan_ac": "G88725PI" }, { "glytoucan_ac": "G59626AS" }, { "glytoucan_ac": "G07799LX" }, { "glytoucan_ac": "G82364UA" }, { "glytoucan_ac": "G27391WQ" }, { "glytoucan_ac": "G72787SB" }, { "glytoucan_ac": "G72791KH" }, { "glytoucan_ac": "G20956ZV" }, { "glytoucan_ac": "G95835XS" }, { "glytoucan_ac": "G35029YA" }, { "glytoucan_ac": "G83646BJ" }, { "glytoucan_ac": "G40926MX" }, { "glytoucan_ac": "G43417UB" }, { "glytoucan_ac": "G44211QA" }, { "glytoucan_ac": "G25079LO" }, { "glytoucan_ac": "G25987BV" }, { "glytoucan_ac": "G92050GC" }, { "glytoucan_ac": "G02815KT" }, { "glytoucan_ac": "G12580WI" }, { "glytoucan_ac": "G31852PQ" }, { "glytoucan_ac": "G73686WG" }, { "glytoucan_ac": "G19379ID" }, { "glytoucan_ac": "G19464WF" }, { "glytoucan_ac": "G36670VW" }, { "glytoucan_ac": "G10486CT" }, { "glytoucan_ac": "G28541PG" }, { "glytoucan_ac": "G27947YN" }, { "glytoucan_ac": "G67324HN" }, { "glytoucan_ac": "G60923RB" }, { "glytoucan_ac": "G80920RR" }, { "glytoucan_ac": "G83460ZZ" }, { "glytoucan_ac": "G80475RE" }, { "glytoucan_ac": "G80735OA" }, { "glytoucan_ac": "G54417MJ" }, { "glytoucan_ac": "G54600FO" }, { "glytoucan_ac": "G83555HU" }, { "glytoucan_ac": "G98896IU" }, { "glytoucan_ac": "G41247ZX" }, { "glytoucan_ac": "G15038BD" }, { "glytoucan_ac": "G15486FH" }, { "glytoucan_ac": "G16175ZV" }, { "glytoucan_ac": "G60033FS" }, { "glytoucan_ac": "G56610MH" }, { "glytoucan_ac": "G57317CE" }, { "glytoucan_ac": "G58001LT" }, { "glytoucan_ac": "G02886BB" }, { "glytoucan_ac": "G93579XB" }, { "glytoucan_ac": "G94583DZ" }, { "glytoucan_ac": "G08293MJ" }, { "glytoucan_ac": "G09197ZW" }, { "glytoucan_ac": "G09528DL" }, { "glytoucan_ac": "G49955PK" }, { "glytoucan_ac": "G50073PQ" }, { "glytoucan_ac": "G29068FM" }, { "glytoucan_ac": "G29651HS" }, { "glytoucan_ac": "G86752LQ" }, { "glytoucan_ac": "G87051GH" }, { "glytoucan_ac": "G87384DY" }, { "glytoucan_ac": "G88374WZ" }, { "glytoucan_ac": "G47737VJ" }, { "glytoucan_ac": "G01650EU" }, { "glytoucan_ac": "G72790NZ" }, { "glytoucan_ac": "G03574QJ" }, { "glytoucan_ac": "G55382TU" }, { "glytoucan_ac": "G00912UN" }, { "glytoucan_ac": "G49284IH" }, { "glytoucan_ac": "G49739MP" }, { "glytoucan_ac": "G10339FR" }, { "glytoucan_ac": "G65184UU" }, { "glytoucan_ac": "G85144OK" }, { "glytoucan_ac": "G85282JO" }, { "glytoucan_ac": "G85740DB" }, { "glytoucan_ac": "G44953PJ" }, { "glytoucan_ac": "G45504EY" }, { "glytoucan_ac": "G39446WN" }, { "glytoucan_ac": "G62765YT" }, { "glytoucan_ac": "G23729WG" }, { "glytoucan_ac": "G75365RL" }, { "glytoucan_ac": "G57776ZU" }, { "glytoucan_ac": "G37399XV" }, { "glytoucan_ac": "G68318VE" }, { "glytoucan_ac": "G69364JQ" }, { "glytoucan_ac": "G62792OG" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100001101100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G09197ZW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010010000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G09528DL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10339FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000011110101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15486FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G16175ZV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G19464WF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G20956ZV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.000111000001101100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G29651HS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000110000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G36670VW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49284IH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100001.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G62792OG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.000010000001110100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G67324HN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G69364JQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80735OA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G82364UA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011100101111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000111000011101100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G95835XS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010001000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P2X&bu=0&command=select+.B:103;+center+selection;+zoom+selection" }, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 129, "start_aa": "Thr", "end_pos": 129, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr129", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 129, "start_aa": "Thr", "end_pos": 129, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr129", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G75365RL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 155, "start_aa": "Ser", "end_pos": 155, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser155", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.0100000.1110100000.000000000011111000.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G94583DZ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 155, "start_aa": "Ser", "end_pos": 155, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser155", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1110000000.110100100101111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 155, "start_aa": "Ser", "end_pos": 155, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser155", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G93579XB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 257, "start_aa": "Ser", "end_pos": 257, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser257", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1110000000.110111100111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 257, "start_aa": "Ser", "end_pos": 257, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser257", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G98896IU", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 294, "start_aa": "Thr", "end_pos": 294, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr294", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1110100000.000100100011111000.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 294, "start_aa": "Thr", "end_pos": 294, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr294", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:322;+center+selection;+zoom+selection" }, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "6M17", "database": "PDB", "url": "https://www.rcsb.org/structure/6M17" }, { "id": "6M18", "database": "PDB", "url": "https://www.rcsb.org/structure/6M18" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7CT5", "database": "PDB", "url": "https://www.rcsb.org/structure/7CT5" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DWX", "database": "PDB", "url": "https://www.rcsb.org/structure/7DWX" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7DX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX5" }, { "id": "7DX6", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX6" }, { "id": "7DX8", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX8" }, { "id": "7DX9", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX9" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7DX7", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX7" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KJ4", "database": "PDB", "url": "https://www.rcsb.org/structure/7KJ4" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V61", "database": "PDB", "url": "https://www.rcsb.org/structure/7V61" }, { "id": "7V7Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7V7Z" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7Y1Y", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Y" }, { "id": "7Y1Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Z" }, { "id": "7Y21", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y21" }, { "id": "7Y75", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y75" }, { "id": "7Y76", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y76" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7Y20", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y20" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8I91", "database": "PDB", "url": "https://www.rcsb.org/structure/8I91" }, { "id": "8I92", "database": "PDB", "url": "https://www.rcsb.org/structure/8I92" }, { "id": "8I93", "database": "PDB", "url": "https://www.rcsb.org/structure/8I93" }, { "id": "8I9B", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9B" }, { "id": "8I9C", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9C" }, { "id": "8I9D", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9D" }, { "id": "8I9E", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9E" }, { "id": "8I9F", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9F" }, { "id": "8I9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9G" }, { "id": "8I9H", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9H" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WBZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WBZ" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WM3", "database": "PDB", "url": "https://www.rcsb.org/structure/8WM3" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9IU1", "database": "PDB", "url": "https://www.rcsb.org/structure/9IU1" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 334, "start_aa": "Thr", "end_pos": 334, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr334", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 334, "start_aa": "Thr", "end_pos": 334, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr334", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15486FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P30&bu=0&command=select+.B:432;+center+selection;+zoom+selection" }, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SN0" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V84", "database": "PDB", "url": "https://www.rcsb.org/structure/7V84" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7V8B", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8B" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8IF2", "database": "PDB", "url": "https://www.rcsb.org/structure/8IF2" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JJE", "database": "PDB", "url": "https://www.rcsb.org/structure/8JJE" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XY9", "database": "PDB", "url": "https://www.rcsb.org/structure/8XY9" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y16", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y16" }, { "id": "8Y18", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y18" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9ELE", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELE" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G23729WG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 43, "start_aa": "Ser", "end_pos": 43, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser43", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G87384DY", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 43, "start_aa": "Ser", "end_pos": 43, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser43", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.0100000.1110100000.010000000001000001.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 43, "start_aa": "Ser", "end_pos": 43, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser43", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 44, "start_aa": "Ser", "end_pos": 44, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser44", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 496, "start_aa": "Thr", "end_pos": 496, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr496", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.110111100111111111.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 496, "start_aa": "Thr", "end_pos": 496, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr496", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.111110100111111111.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 496, "start_aa": "Thr", "end_pos": 496, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr496", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:53;+center+selection;+zoom+selection" }, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P8I", "database": "PDB", "url": "https://www.rcsb.org/structure/7P8I" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V82", "database": "PDB", "url": "https://www.rcsb.org/structure/7V82" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V84", "database": "PDB", "url": "https://www.rcsb.org/structure/7V84" }, { "id": "7V86", "database": "PDB", "url": "https://www.rcsb.org/structure/7V86" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7V8B", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8B" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XY9", "database": "PDB", "url": "https://www.rcsb.org/structure/8XY9" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y16", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y16" }, { "id": "8Y18", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y18" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9ELE", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELE" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100001101100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G09528DL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10339FR", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15486FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G20956ZV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49739MP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010011000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G67324HN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G69364JQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G73686WG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000011101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:546;+center+selection;+zoom+selection" }, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOR", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOR" }, { "id": "8TOS", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOS" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G23729WG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 602, "start_aa": "Ser", "end_pos": 602, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser602", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 602, "start_aa": "Ser", "end_pos": 602, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser602", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 611, "start_aa": "Ser", "end_pos": 611, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser611", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.110111100111111111.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 611, "start_aa": "Ser", "end_pos": 611, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser611", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54417MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001101100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85282JO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001100100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "doi.10.1016/j.chom.2020.08.004", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 84 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 203 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 72 }, { "field": "o_linked_glycans", "count": 10 }, { "field": "exact_sites", "count": 16 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "exact_n_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked_glycans", "count": 72 }, { "field": "exact_n_linked;o_linked_sites", "count": 6 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked;o_linked_glycans", "count": 11 }, { "field": "exact_o_linked_sites", "count": 10 }, { "field": "exact_o_linked_glycan_sites", "count": 9 }, { "field": "exact_o_linked_glycans", "count": 10 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 16 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "exact_o_linked_sites", "count": 10 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 187 }, { "field": "total_sites", "count": 15 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 9 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 72 }, { "field": "o_linked_glycans", "count": 10 }, { "field": "exact_sites", "count": 15 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "exact_n_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked_glycans", "count": 72 }, { "field": "exact_n_linked;o_linked_sites", "count": 6 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked;o_linked_glycans", "count": 11 }, { "field": "exact_o_linked_sites", "count": 9 }, { "field": "exact_o_linked_glycan_sites", "count": 9 }, { "field": "exact_o_linked_glycans", "count": 10 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] } ] }, { "title": "Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2", "journal": "Glycobiology", "date": "2021", "authors": "Shajahan A., Archer-Hartmann S., Supekar N.T., Gleinich A.S., Heiss C., Azadi P.", "reference": { "type": "DOI", "id": "10.1093/glycob/cwaa101", "url": "https://doi.org/10.1093/glycob/cwaa101" }, "referenced_glycans": [ { "glytoucan_ac": "G59937CP" }, { "glytoucan_ac": "G88725PI" }, { "glytoucan_ac": "G59626AS" }, { "glytoucan_ac": "G79941IJ" }, { "glytoucan_ac": "G35029YA" }, { "glytoucan_ac": "G43638QT" }, { "glytoucan_ac": "G44211QA" }, { "glytoucan_ac": "G25987BV" }, { "glytoucan_ac": "G02815KT" }, { "glytoucan_ac": "G12580WI" }, { "glytoucan_ac": "G19517GM" }, { "glytoucan_ac": "G10486CT" }, { "glytoucan_ac": "G80475RE" }, { "glytoucan_ac": "G54417MJ" }, { "glytoucan_ac": "G54600FO" }, { "glytoucan_ac": "G83555HU" }, { "glytoucan_ac": "G98596OT" }, { "glytoucan_ac": "G41247ZX" }, { "glytoucan_ac": "G56610MH" }, { "glytoucan_ac": "G08293MJ" }, { "glytoucan_ac": "G86752LQ" }, { "glytoucan_ac": "G88374WZ" }, { "glytoucan_ac": "G55382TU" }, { "glytoucan_ac": "G10339FR" }, { "glytoucan_ac": "G85144OK" }, { "glytoucan_ac": "G85740DB" }, { "glytoucan_ac": "G44953PJ" }, { "glytoucan_ac": "G45504EY" }, { "glytoucan_ac": "G32926LW" }, { "glytoucan_ac": "G68318VE" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P2X&bu=0&command=select+.B:103;+center+selection;+zoom+selection" }, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G19517GM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000010000001101101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G43638QT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000001101101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54417MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G98596OT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:322;+center+selection;+zoom+selection" }, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "6M17", "database": "PDB", "url": "https://www.rcsb.org/structure/6M17" }, { "id": "6M18", "database": "PDB", "url": "https://www.rcsb.org/structure/6M18" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7CT5", "database": "PDB", "url": "https://www.rcsb.org/structure/7CT5" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DWX", "database": "PDB", "url": "https://www.rcsb.org/structure/7DWX" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7DX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX5" }, { "id": "7DX6", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX6" }, { "id": "7DX8", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX8" }, { "id": "7DX9", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX9" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7DX7", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX7" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KJ4", "database": "PDB", "url": "https://www.rcsb.org/structure/7KJ4" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V61", "database": "PDB", "url": "https://www.rcsb.org/structure/7V61" }, { "id": "7V7Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7V7Z" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7Y1Y", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Y" }, { "id": "7Y1Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Z" }, { "id": "7Y21", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y21" }, { "id": "7Y75", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y75" }, { "id": "7Y76", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y76" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7Y20", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y20" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8I91", "database": "PDB", "url": "https://www.rcsb.org/structure/8I91" }, { "id": "8I92", "database": "PDB", "url": "https://www.rcsb.org/structure/8I92" }, { "id": "8I93", "database": "PDB", "url": "https://www.rcsb.org/structure/8I93" }, { "id": "8I9B", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9B" }, { "id": "8I9C", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9C" }, { "id": "8I9D", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9D" }, { "id": "8I9E", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9E" }, { "id": "8I9F", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9F" }, { "id": "8I9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9G" }, { "id": "8I9H", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9H" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WBZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WBZ" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WM3", "database": "PDB", "url": "https://www.rcsb.org/structure/8WM3" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9IU1", "database": "PDB", "url": "https://www.rcsb.org/structure/9IU1" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P30&bu=0&command=select+.B:432;+center+selection;+zoom+selection" }, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SN0" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V84", "database": "PDB", "url": "https://www.rcsb.org/structure/7V84" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7V8B", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8B" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8IF2", "database": "PDB", "url": "https://www.rcsb.org/structure/8IF2" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JJE", "database": "PDB", "url": "https://www.rcsb.org/structure/8JJE" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XY9", "database": "PDB", "url": "https://www.rcsb.org/structure/8XY9" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y16", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y16" }, { "id": "8Y18", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y18" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9ELE", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELE" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G43638QT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000001101101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54417MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10339FR", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:546;+center+selection;+zoom+selection" }, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOR", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOR" }, { "id": "8TOS", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOS" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10339FR", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=9FMM&bu=0&command=select+.A:690;+center+selection;+zoom+selection" }, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "doi.10.1093/glycob/cwaa101", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 30 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 89 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_sites", "count": 7 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 17 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 7 }, { "field": "exact_n_linked_sites", "count": 7 }, { "field": "exact_n_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked_glycans", "count": 17 }, { "field": "exact_n_linked;o_linked_sites", "count": 7 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 7 }, { "field": "exact_n_linked;o_linked_glycans", "count": 13 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 83 }, { "field": "total_sites", "count": 7 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 6 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 17 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 7 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "exact_n_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked_glycans", "count": 17 }, { "field": "exact_n_linked;o_linked_sites", "count": 7 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 7 }, { "field": "exact_n_linked;o_linked_glycans", "count": 13 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] } ] }, { "title": "Substrate-based design of the first class of angiotensin-converting enzyme-related carboxypeptidase (ACE2) inhibitors.", "journal": "J. Am. Chem. Soc.", "date": "2002", "authors": "Dales Natalie A, Gould Alexandra E, Brown James A, Calderwood Emily F, Guan Bing, Minor Charles A, Gavin James M, Hales Paul, Kaushik Virendar K, Stewart Michael, Tummino Peter J, Vickers Chad S, Ocain Timothy D, Patane Michael A", "reference": { "type": "PubMed", "id": "12358520", "url": "https://pubmed.ncbi.nlm.nih.gov/12358520" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12358520", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Quantitative mRNA expression profiling of ACE 2, a novel homologue of angiotensin converting enzyme.", "journal": "FEBS Lett.", "date": "2002", "authors": "Harmer Dan, Gilbert Maureen, Borman Richard, Clark Kenneth L", "reference": { "type": "PubMed", "id": "12459472", "url": "https://pubmed.ncbi.nlm.nih.gov/12459472" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12821-1", "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12459472", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Increased angiotensin-(1-7)-forming activity in failing human heart ventricles: evidence for upregulation of the angiotensin-converting enzyme Homologue ACE2.", "journal": "Circulation", "date": "2003-10-07", "authors": "Zisman Lawrence S, Keller Rebecca S, Weaver Barbara, Lin Qishan, Speth Robert, Bristow Michael R, Canver Charles C", "reference": { "type": "PubMed", "id": "14504186", "url": "https://pubmed.ncbi.nlm.nih.gov/14504186" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.14504186", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ACE2 X-ray structures reveal a large hinge-bending motion important for inhibitor binding and catalysis.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Towler P, Staker B, Prasad SG, Menon S, Tang J, Parsons T, Ryan D, Fisher M, Williams D, Dales NA, Patane MA, Pantoliano MW", "reference": { "type": "PubMed", "id": "14754895", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P2X&bu=0&command=select+.B:103;+center+selection;+zoom+selection" }, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:322;+center+selection;+zoom+selection" }, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "6M17", "database": "PDB", "url": "https://www.rcsb.org/structure/6M17" }, { "id": "6M18", "database": "PDB", "url": "https://www.rcsb.org/structure/6M18" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7CT5", "database": "PDB", "url": "https://www.rcsb.org/structure/7CT5" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DWX", "database": "PDB", "url": "https://www.rcsb.org/structure/7DWX" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7DX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX5" }, { "id": "7DX6", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX6" }, { "id": "7DX8", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX8" }, { "id": "7DX9", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX9" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7DX7", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX7" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KJ4", "database": "PDB", "url": "https://www.rcsb.org/structure/7KJ4" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V61", "database": "PDB", "url": "https://www.rcsb.org/structure/7V61" }, { "id": "7V7Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7V7Z" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7Y1Y", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Y" }, { "id": "7Y1Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Z" }, { "id": "7Y21", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y21" }, { "id": "7Y75", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y75" }, { "id": "7Y76", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y76" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7Y20", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y20" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8I91", "database": "PDB", "url": "https://www.rcsb.org/structure/8I91" }, { "id": "8I92", "database": "PDB", "url": "https://www.rcsb.org/structure/8I92" }, { "id": "8I93", "database": "PDB", "url": "https://www.rcsb.org/structure/8I93" }, { "id": "8I9B", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9B" }, { "id": "8I9C", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9C" }, { "id": "8I9D", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9D" }, { "id": "8I9E", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9E" }, { "id": "8I9F", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9F" }, { "id": "8I9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9G" }, { "id": "8I9H", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9H" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WBZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WBZ" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WM3", "database": "PDB", "url": "https://www.rcsb.org/structure/8WM3" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9IU1", "database": "PDB", "url": "https://www.rcsb.org/structure/9IU1" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P30&bu=0&command=select+.B:432;+center+selection;+zoom+selection" }, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SN0" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V84", "database": "PDB", "url": "https://www.rcsb.org/structure/7V84" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7V8B", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8B" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8IF2", "database": "PDB", "url": "https://www.rcsb.org/structure/8IF2" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JJE", "database": "PDB", "url": "https://www.rcsb.org/structure/8JJE" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XY9", "database": "PDB", "url": "https://www.rcsb.org/structure/8XY9" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y16", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y16" }, { "id": "8Y18", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y18" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9ELE", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELE" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:53;+center+selection;+zoom+selection" }, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P8I", "database": "PDB", "url": "https://www.rcsb.org/structure/7P8I" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V82", "database": "PDB", "url": "https://www.rcsb.org/structure/7V82" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V84", "database": "PDB", "url": "https://www.rcsb.org/structure/7V84" }, { "id": "7V86", "database": "PDB", "url": "https://www.rcsb.org/structure/7V86" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7V8B", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8B" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XY9", "database": "PDB", "url": "https://www.rcsb.org/structure/8XY9" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y16", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y16" }, { "id": "8Y18", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y18" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9ELE", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELE" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:546;+center+selection;+zoom+selection" }, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOR", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOR" }, { "id": "8TOS", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOS" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.14754895", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] } ] }, { "title": "Tissue distribution of ACE2 protein, the functional receptor for SARS coronavirus. A first step in understanding SARS pathogenesis.", "journal": "J. Pathol.", "date": "2004", "authors": "Hamming I, Timens W, Bulthuis M L C, Lely A T, Navis G J, van Goor H", "reference": { "type": "PubMed", "id": "15141377", "url": "https://pubmed.ncbi.nlm.nih.gov/15141377" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15141377", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ACE2 gene expression is up-regulated in the human failing heart.", "journal": "BMC Med.", "date": "2004", "authors": "Goulter Andrew B, Goddard Martin J, Allen Jennifer C, Clark Kenneth L", "reference": { "type": "PubMed", "id": "15151696", "url": "https://pubmed.ncbi.nlm.nih.gov/15151696" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12821-1", "protein_name": "Angiotensin-converting enzyme", "gene_name": "ACE", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15151696", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of ACE2 and integrin beta1 in failing human heart.", "journal": "Biochim. Biophys. Acta", "date": "2004", "authors": "Lin Qishan, Keller Rebecca S, Weaver Barbara, Zisman Lawrence S", "reference": { "type": "PubMed", "id": "15276642", "url": "https://pubmed.ncbi.nlm.nih.gov/15276642" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05556-1", "protein_name": "Integrin beta-1", "gene_name": "ITGB1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15276642", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Receptor and viral determinants of SARS-coronavirus adaptation to human ACE2.", "journal": "The EMBO journal", "date": "2005", "authors": "Li W, Zhang C, Sui J, Kuhn JH, Moore MJ, Luo S, Wong SK, Huang IC, Xu K, Vasilieva N, Murakami A, He Y, Marasco WA, Guan Y, Choe H, Farzan M", "reference": { "type": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P59594-1", "protein_name": "Spike glycoprotein", "gene_name": "S", "tax_name": "SARS-CoV" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 110, "end_pos": 110, "sequence_org": "E", "sequence_mut": "P", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 135, "end_pos": 136, "sequence_org": "PD", "sequence_mut": "SM", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 160, "end_pos": 160, "sequence_org": "E", "sequence_mut": "R", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 192, "end_pos": 192, "sequence_org": "R", "sequence_mut": "D", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 219, "end_pos": 219, "sequence_org": "R", "sequence_mut": "D", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 239, "end_pos": 239, "sequence_org": "H", "sequence_mut": "Q", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 24, "end_pos": 26, "sequence_org": "QAK", "sequence_mut": "KAE", "comment": "Slightly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 309, "end_pos": 309, "sequence_org": "K", "sequence_mut": "D", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 312, "end_pos": 312, "sequence_org": "E", "sequence_mut": "A", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 31, "end_pos": 31, "sequence_org": "K", "sequence_mut": "D", "comment": "Abolishes interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 324, "end_pos": 324, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 338, "end_pos": 340, "sequence_org": "NVQ", "sequence_mut": "DDR", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 350, "end_pos": 350, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 353, "end_pos": 353, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 353, "end_pos": 353, "sequence_org": "K", "sequence_mut": "D", "comment": "Abolishes interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 353, "end_pos": 353, "sequence_org": "K", "sequence_mut": "H", "comment": "Abolishes interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 355, "end_pos": 355, "sequence_org": "D", "sequence_mut": "A", "comment": "Strongly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 357, "end_pos": 357, "sequence_org": "R", "sequence_mut": "A", "comment": "Strongly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 359, "end_pos": 359, "sequence_org": "L", "sequence_mut": "A", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 359, "end_pos": 359, "sequence_org": "L", "sequence_mut": "K", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 37, "end_pos": 37, "sequence_org": "E", "sequence_mut": "A", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 383, "end_pos": 383, "sequence_org": "M", "sequence_mut": "A", "comment": "Slightly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 389, "end_pos": 389, "sequence_org": "P", "sequence_mut": "A", "comment": "Slightly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 38, "end_pos": 38, "sequence_org": "D", "sequence_mut": "A", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 393, "end_pos": 393, "sequence_org": "R", "sequence_mut": "A", "comment": "Slightly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 41, "end_pos": 41, "sequence_org": "Y", "sequence_mut": "A", "comment": "Strongly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 425, "end_pos": 427, "sequence_org": "SPD", "sequence_mut": "PSN", "comment": "Slightly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 465, "end_pos": 467, "sequence_org": "KGE", "sequence_mut": "QDK", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 559, "end_pos": 559, "sequence_org": "R", "sequence_mut": "S", "comment": "Slightly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 603, "end_pos": 603, "sequence_org": "F", "sequence_mut": "T", "comment": "No effect on interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 68, "end_pos": 68, "sequence_org": "K", "sequence_mut": "D", "comment": "Slightly inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 82, "end_pos": 84, "sequence_org": "MYP", "sequence_mut": "NFS", "comment": "Inhibits interaction with SARS-CoV spike glycoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "15791205", "url": "https://pubmed.ncbi.nlm.nih.gov/15791205" } ], "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.15791205", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human coronavirus NL63 employs the severe acute respiratory syndrome coronavirus receptor for cellular entry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005-05-31", "authors": "Hofmann Heike, Pyrc Krzysztof, van der Hoek Lia, Geier Martina, Berkhout Ben, P\u00f6hlmann Stefan", "reference": { "type": "PubMed", "id": "15897467", "url": "https://pubmed.ncbi.nlm.nih.gov/15897467" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15897467", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of an alternative 5'-untranslated exon and new polymorphisms of angiotensin-converting enzyme 2 gene: lack of association with SARS in the Vietnamese population.", "journal": "Am. J. Med. Genet. A", "date": "2005", "authors": "Itoyama Satoru, Keicho Naoto, Hijikata Minako, Quy Tran, Phi Nguyen Chi, Long Hoang Thuy, Ha Le Dang, Ban Vo Van, Matsushita Ikumi, Yanai Hideki, Kirikae Fumiko, Kirikae Teruo, Kuratsuji Tadatoshi, Sasazuki Takehiko", "reference": { "type": "PubMed", "id": "15937940", "url": "https://pubmed.ncbi.nlm.nih.gov/15937940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15937940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tumor necrosis factor-alpha convertase (ADAM17) mediates regulated ectodomain shedding of the severe-acute respiratory syndrome-coronavirus (SARS-CoV) receptor, angiotensin-converting enzyme-2 (ACE2).", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Lambert DW, Yarski M, Warner FJ, Thornhill P, Parkin ET, Smith AI, Hooper NM, Turner AJ", "reference": { "type": "PubMed", "id": "15983030", "url": "https://pubmed.ncbi.nlm.nih.gov/15983030" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15983030", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of critical active-site residues in angiotensin-converting enzyme-2 (ACE2) by site-directed mutagenesis.", "journal": "The FEBS journal", "date": "2005", "authors": "Guy JL, Jackson RM, Jensen HA, Hooper NM, Turner AJ", "reference": { "type": "PubMed", "id": "16008552", "url": "https://pubmed.ncbi.nlm.nih.gov/16008552" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 273, "end_pos": 273, "sequence_org": "R", "sequence_mut": "Q", "comment": "Complete loss of enzyme activity. Does not affect amino acid transport activity of SLC6A19.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "16008552", "url": "https://pubmed.ncbi.nlm.nih.gov/16008552" }, { "database": "PubMed", "id": "19185582", "url": "https://pubmed.ncbi.nlm.nih.gov/19185582" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 345, "end_pos": 345, "sequence_org": "H", "sequence_mut": "A", "comment": "Complete loss of enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "16008552", "url": "https://pubmed.ncbi.nlm.nih.gov/16008552" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 505, "end_pos": 505, "sequence_org": "H", "sequence_mut": "A", "comment": "Complete loss of enzyme activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "16008552", "url": "https://pubmed.ncbi.nlm.nih.gov/16008552" } ], "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.16008552", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Residues affecting the chloride regulation and substrate selectivity of the angiotensin-converting enzymes (ACE and ACE2) identified by site-directed mutagenesis.", "journal": "The FEBS journal", "date": "2008", "authors": "Rushworth CA, Guy JL, Turner AJ", "reference": { "type": "PubMed", "id": "19021774", "url": "https://pubmed.ncbi.nlm.nih.gov/19021774" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 169, "end_pos": 169, "sequence_org": "R", "sequence_mut": "Q", "comment": "About 95% loss of angiotensin I cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "19021774", "url": "https://pubmed.ncbi.nlm.nih.gov/19021774" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 271, "end_pos": 271, "sequence_org": "W", "sequence_mut": "Q", "comment": "About 95% loss of angiotensin I cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "19021774", "url": "https://pubmed.ncbi.nlm.nih.gov/19021774" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 481, "end_pos": 481, "sequence_org": "K", "sequence_mut": "Q", "comment": "About 80% loss of angiotensin I cleavage.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "19021774", "url": "https://pubmed.ncbi.nlm.nih.gov/19021774" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 514, "end_pos": 514, "sequence_org": "R", "sequence_mut": "Q", "comment": "About 50% loss of angiotensin I cleavage but two-fold greater activity with angiotensin II.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "19021774", "url": "https://pubmed.ncbi.nlm.nih.gov/19021774" } ], "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.19021774", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of NL63 respiratory coronavirus receptor-binding domain complexed with its human receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Wu K, Li W, Peng G, Li F", "reference": { "type": "PubMed", "id": "19901337", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:546;+center+selection;+zoom+selection" }, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOR", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOR" }, { "id": "8TOS", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOS" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.19901337", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "mining_tool" ] } ] }, { "title": "Angiotensin-converting enzyme 2 ectodomain shedding cleavage-site identification: determinants and constraints.", "journal": "Biochemistry", "date": "2011", "authors": "Lai ZW, Hanchapola I, Steer DL, Smith AI", "reference": { "type": "PubMed", "id": "21563828", "url": "https://pubmed.ncbi.nlm.nih.gov/21563828" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21563828", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Angiotensin-Converting Enzyme 2 Metabolizes and Partially Inactivates Pyr-Apelin-13 and Apelin-17: Physiological Effects in the Cardiovascular System.", "journal": "Hypertension (Dallas, Tex. : 1979)", "date": "2016", "authors": "Wang W, McKinnie SM, Farhan M, Paul M, McDonald T, McLean B, Llorens-Cortes C, Hazra S, Murray AG, Vederas JC, Oudit GY", "reference": { "type": "PubMed", "id": "27217402", "url": "https://pubmed.ncbi.nlm.nih.gov/27217402" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.27217402", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Pyr1]Apelin-13(1-12) Is a Biologically Active ACE2 Metabolite of the Endogenous Cardiovascular Peptide [Pyr1]Apelin-13.", "journal": "Front. Neurosci.", "date": "2017", "authors": "Yang Peiran, Kuc Rhoda E, Brame Aim\u00e9e L, Dyson Alex, Singer Mervyn, Glen Robert C, Cheriyan Joseph, Wilkinson Ian B, Davenport Anthony P, Maguire Janet J", "reference": { "type": "PubMed", "id": "28293165", "url": "https://pubmed.ncbi.nlm.nih.gov/28293165" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.28293165", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cryo-EM structure of the SARS coronavirus spike glycoprotein in complex with its host cell receptor ACE2.", "journal": "PLoS Pathog.", "date": "2018", "authors": "Song Wenfei, Gui Miao, Wang Xinquan, Xiang Ye", "reference": { "type": "PubMed", "id": "30102747", "url": "https://pubmed.ncbi.nlm.nih.gov/30102747" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30102747", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Stabilized coronavirus spikes are resistant to conformational changes induced by receptor recognition or proteolysis.", "journal": "Sci. Rep.", "date": "2018", "authors": "Kirchdoerfer Robert N, Wang Nianshuang, Pallesen Jesper, Wrapp Daniel, Turner Hannah L, Cottrell Christopher A, Corbett Kizzmekia S, Graham Barney S, McLellan Jason S, Ward Andrew B", "reference": { "type": "PubMed", "id": "30356097", "url": "https://pubmed.ncbi.nlm.nih.gov/30356097" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30356097", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Single-cell RNA-seq data analysis on the receptor ACE2 expression reveals the potential risk of different human organs vulnerable to 2019-nCoV infection.", "journal": "Front. Med.", "date": "2020", "authors": "Zou Xin, Chen Ke, Zou Jiawei, Han Peiyi, Hao Jie, Han Zeguang", "reference": { "type": "PubMed", "id": "32170560", "url": "https://pubmed.ncbi.nlm.nih.gov/32170560" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32170560", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SARS-CoV-2 entry factors are highly expressed in nasal epithelial cells together with innate immune genes.", "journal": "Nat. Med.", "date": "2020", "authors": "Sungnak Waradon, Huang Ni, B\u00e9cavin Christophe, Berg Marijn, Queen Rachel, Litvinukova Monika, Talavera-L\u00f3pez Carlos, Maatz Henrike, Reichart Daniel, Sampaziotis Fotios, Worlock Kaylee B, Yoshida Masahiro, Barnes Josephine L,", "reference": { "type": "PubMed", "id": "32327758", "url": "https://pubmed.ncbi.nlm.nih.gov/32327758" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32327758", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association of respiratory allergy, asthma, and expression of the SARS-CoV-2 receptor ACE2.", "journal": "J. Allergy Clin. Immunol.", "date": "2020", "authors": "Jackson Daniel J, Busse William W, Bacharier Leonard B, Kattan Meyer, O'Connor George T, Wood Robert A, Visness Cynthia M, Durham Stephen R, Larson David, Esnault Stephane, Ober Carole, Gergen Peter J, Becker Patrice, Togias Alkis, Gern James E, Altman Mathew C", "reference": { "type": "PubMed", "id": "32333915", "url": "https://pubmed.ncbi.nlm.nih.gov/32333915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32333915", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ACE2 correlated with immune infiltration serves as a prognostic biomarker in endometrial carcinoma and renal papillary cell carcinoma: implication for COVID-19.", "journal": "Aging", "date": "2020", "authors": "Yang J, Li H, Hu S, Zhou Y", "reference": { "type": "PubMed", "id": "32339157", "url": "https://pubmed.ncbi.nlm.nih.gov/32339157" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "biomarkers": [ { "best_biomarker_role": [ "prognostic" ], "biomarker_canonical_id": "AN6312", "assessed_biomarker_entity": [ "Angiotensin-converting enzyme 2" ], "biomarker_id": "AN6312-1", "biomarker": [ "decreased ACE2 level" ], "condition": { "id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infectious disease that is characterized by fever, cough and shortness of breath and that has_material_basis_in Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), a subtype of Betacoronavirus pandemicum." }, "name_list": [ "COVID-19", "2019 Novel Coronavirus (2019-nCoV)", "2019-nCoV infection", "COVID19", "SARS-CoV-2 infection", "2019 novel coronavirus infection", "coronavirus disease 2019", "severe acute respiratory syndrome coronavirus 2 infectious disease", "2019 novel coronavirus", "2019-nCoV", "SARS-CoV-2", "SARS-coronavirus 2", "beta-CoV", "beta-CoVs", "betacoronavirus", "severe acute respiratory syndrome coronavirus 2", "-CoV", "-CoVs", "-coronavirus" ], "id_list": [ "DOID:0080600", "MONDO:0100096" ] } } ], "record_id": "pubmed.32339157", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SARS-CoV-2 productively infects human gut enterocytes.", "journal": "Science", "date": "2020", "authors": "Lamers Mart M, Beumer Joep, van der Vaart Jelte, Knoops K\u00e8vin, Puschhof Jens, Breugem Tim I, Ravelli Raimond B G, Paul van Schayck J, Mykytyn Anna Z, Duimel Hans Q, van Donselaar Elly, Riesebosch Samra, Kuijpers Helma J H, Schipper Debby, van de Wetering Willine J, de Graaf Miranda, Koopmans Marion, Cuppen Edwin, Peters Peter J, Haagmans Bart L, Clevers Hans", "reference": { "type": "PubMed", "id": "32358202", "url": "https://pubmed.ncbi.nlm.nih.gov/32358202" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32358202", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SARS-CoV-2 Receptor ACE2 Is an Interferon-Stimulated Gene in Human Airway Epithelial Cells and Is Detected in Specific Cell Subsets across Tissues.", "journal": "Cell", "date": "2020", "authors": "Ziegler Carly G K, Allon Samuel J, Nyquist Sarah K, Mbano Ian M, Miao Vincent N, Tzouanas Constantine N, Cao Yuming, Yousif Ashraf S, Bals Julia, Hauser Blake M, Feldman Jared, Muus Christoph, Wadsworth Marc H, Kazer Samuel W, Hughes Travis K, Doran Benjamin, Gatter G James, Vukovic Marko, Taliaferro Faith, Mead Benjamin E, Guo Zhiru, Wang Jennifer P, Gras Delphine, Plaisant Magali, Ansari Meshal, Angelidis Ilias, Adler Heiko, Sucre Jennifer M S, Taylor Chase J, Lin Brian, Waghray Avinash, Mitsialis Vanessa, Dwyer Daniel F, Buchheit Kathleen M, Boyce Joshua A, Barrett Nora A, Laidlaw Tanya M, Carroll Shaina L, Colonna Lucrezia, Tkachev Victor, Peterson Christopher W, Yu Alison, Zheng Hengqi Betty, Gideon Hannah P, Winchell Caylin G, Lin Philana Ling, Bingle Colin D, Snapper Scott B, Kropski Jonathan A, Theis Fabian J, Schiller Herbert B, Zaragosi Laure-Emmanuelle, Barbry Pascal, Leslie Alasdair, Kiem Hans-Peter, Flynn JoAnne L, Fortune Sarah M, Berger Bonnie, Finberg Robert W, Kean Leslie S, Garber Manuel, Schmidt Aaron G, Lingwood Daniel, Shalek Alex K, Ordovas-Montanes Jose, ,", "reference": { "type": "PubMed", "id": "32413319", "url": "https://pubmed.ncbi.nlm.nih.gov/32413319" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32413319", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plasma levels of soluble ACE2are associated with sex, Metabolic Syndrome, and its biomarkers in a large cohort, pointing to a possible mechanism for increased severity in COVID-19.", "journal": "Critical care (London, England)", "date": "2020", "authors": "Kornilov SA, Lucas I, Jade K, Dai CL, Lovejoy JC, Magis AT", "reference": { "type": "PubMed", "id": "32698840", "url": "https://pubmed.ncbi.nlm.nih.gov/32698840" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "biomarkers": [ { "best_biomarker_role": [ "monitoring" ], "biomarker_canonical_id": "AN6311", "assessed_biomarker_entity": [ "Angiotensin-converting enzyme 2" ], "biomarker_id": "AN6311-2", "biomarker": [ "increased ACE2 level" ], "condition": { "id": "DOID:0080600", "recommended_name": { "id": "DOID:0080600", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0080600", "name": "COVID-19", "description": "A Coronavirus infectious disease that is characterized by fever, cough and shortness of breath and that has_material_basis_in Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2), a subtype of Betacoronavirus pandemicum." }, "name_list": [ "COVID-19", "2019 Novel Coronavirus (2019-nCoV)", "2019-nCoV infection", "COVID19", "SARS-CoV-2 infection", "2019 novel coronavirus infection", "coronavirus disease 2019", "severe acute respiratory syndrome coronavirus 2 infectious disease", "2019 novel coronavirus", "2019-nCoV", "SARS-CoV-2", "SARS-coronavirus 2", "beta-CoV", "beta-CoVs", "betacoronavirus", "severe acute respiratory syndrome coronavirus 2", "-CoV", "-CoVs", "-coronavirus" ], "id_list": [ "DOID:0080600", "MONDO:0100096" ] } } ], "record_id": "pubmed.32698840", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The protein expression profile of ACE2 in human tissues.", "journal": "Mol. Syst. Biol.", "date": "2020", "authors": "Hikmet Feria, M\u00e9ar Loren, Edvinsson \u00c5sa, Micke Patrick, Uhl\u00e9n Mathias, Lindskog Cecilia", "reference": { "type": "PubMed", "id": "32715618", "url": "https://pubmed.ncbi.nlm.nih.gov/32715618" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32715618", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Engineering human ACE2 to optimize binding to the spike protein of SARS coronavirus 2.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Chan KK, Dorosky D, Sharma P, Abbasi SA, Dye JM, Kranz DM, Herbert AS, Procko E", "reference": { "type": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 19, "end_pos": 19, "sequence_org": "S", "sequence_mut": "P", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 24, "end_pos": 24, "sequence_org": "Q", "sequence_mut": "T", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 25, "end_pos": 25, "sequence_org": "A", "sequence_mut": "V", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 27, "end_pos": 27, "sequence_org": "T", "sequence_mut": "Y", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein. In sACE2.v2.2; increases interaction with RBD domain of SARS-CoV-2 spike protein; when associated with Y-330 and L-386.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 29, "end_pos": 29, "sequence_org": "L", "sequence_mut": "F", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 31, "end_pos": 31, "sequence_org": "K", "sequence_mut": "Y", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 324, "end_pos": 324, "sequence_org": "T", "sequence_mut": "P", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 325, "end_pos": 325, "sequence_org": "Q", "sequence_mut": "P", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 330, "end_pos": 330, "sequence_org": "N", "sequence_mut": "Y", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein. In sACE2.v2.2; increases interaction with RBD domain of SARS-CoV-2 spike protein; when associated with Y-27 and L-386.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 33, "end_pos": 33, "sequence_org": "N", "sequence_mut": "D", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 34, "end_pos": 34, "sequence_org": "H", "sequence_mut": "A", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 351, "end_pos": 351, "sequence_org": "L", "sequence_mut": "F", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 386, "end_pos": 386, "sequence_org": "A", "sequence_mut": "L", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein. In sACE2.v2.2; increases interaction with RBD domain of SARS-CoV-2 spike protein; when associated with Y-27 and Y-330.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 389, "end_pos": 389, "sequence_org": "P", "sequence_mut": "D", "comment": "Increases very slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 393, "end_pos": 393, "sequence_org": "R", "sequence_mut": "K", "comment": "Increases very slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 39, "end_pos": 39, "sequence_org": "L", "sequence_mut": "R", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 40, "end_pos": 40, "sequence_org": "F", "sequence_mut": "D", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 41, "end_pos": 41, "sequence_org": "Y", "sequence_mut": "R", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 42, "end_pos": 42, "sequence_org": "Q", "sequence_mut": "L", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 518, "end_pos": 518, "sequence_org": "R", "sequence_mut": "G", "comment": "Increases very slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 69, "end_pos": 69, "sequence_org": "W", "sequence_mut": "V", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 72, "end_pos": 72, "sequence_org": "F", "sequence_mut": "Y", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 75, "end_pos": 75, "sequence_org": "E", "sequence_mut": "K", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 76, "end_pos": 76, "sequence_org": "Q", "sequence_mut": "T", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 79, "end_pos": 79, "sequence_org": "L", "sequence_mut": "T", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 89, "end_pos": 89, "sequence_org": "Q", "sequence_mut": "P", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 90, "end_pos": 90, "sequence_org": "N", "sequence_mut": "Q", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 91, "end_pos": 91, "sequence_org": "L", "sequence_mut": "P", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 92, "end_pos": 92, "sequence_org": "T", "sequence_mut": "Q", "comment": "Increases slightly the interaction with RBD domain of SARS-CoV-2 spike protein.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "32753553", "url": "https://pubmed.ncbi.nlm.nih.gov/32753553" } ], "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.32753553", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biomechanical Characterization of SARS-CoV-2 Spike RBD and Human ACE2 Protein-Protein Interaction.", "journal": "bioRxiv : the preprint server for biology", "date": "2020-07-31", "authors": "Cao Wenpeng, Dong Chuqiao, Kim Seonghan, Hou Decheng, Tai Wanbo, Du Lanying, Im Wonpil, Zhang X Frank", "reference": { "type": "PubMed", "id": "32766576", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.32766576", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Virus-Receptor Interactions of Glycosylated SARS-CoV-2 Spike and Human ACE2 Receptor.", "journal": "Cell host & microbe", "date": "2020", "authors": "Zhao P, Praissman JL, Grant OC, Cai Y, Xiao T, Rosenbalm KE, Aoki K, Kellman BP, Bridger R, Barouch DH, Brindley MA, Lewis NE, Tiemeyer M, Chen B, Woods RJ, Wells L", "reference": { "type": "PubMed", "id": "32841605", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, "referenced_glycans": [ { "glytoucan_ac": "G00031MO" }, { "glytoucan_ac": "G00033MO" }, { "glytoucan_ac": "G01457KB" }, { "glytoucan_ac": "G58667NI" }, { "glytoucan_ac": "G59126YU" }, { "glytoucan_ac": "G59456VR" }, { "glytoucan_ac": "G59937CP" }, { "glytoucan_ac": "G88725PI" }, { "glytoucan_ac": "G89098OM" }, { "glytoucan_ac": "G90093AU" }, { "glytoucan_ac": "G59626AS" }, { "glytoucan_ac": "G79568CQ" }, { "glytoucan_ac": "G51640FO" }, { "glytoucan_ac": "G52527GH" }, { "glytoucan_ac": "G52934AK" }, { "glytoucan_ac": "G07410AW" }, { "glytoucan_ac": "G07483YN" }, { "glytoucan_ac": "G07799LX" }, { "glytoucan_ac": "G82119TF" }, { "glytoucan_ac": "G82252QI" }, { "glytoucan_ac": "G82348BZ" }, { "glytoucan_ac": "G82364UA" }, { "glytoucan_ac": "G82942ZJ" }, { "glytoucan_ac": "G41611UP" }, { "glytoucan_ac": "G27391WQ" }, { "glytoucan_ac": "G72735IY" }, { "glytoucan_ac": "G72787SB" }, { "glytoucan_ac": "G72791KH" }, { "glytoucan_ac": "G72797UR" }, { "glytoucan_ac": "G20956ZV" }, { "glytoucan_ac": "G95835XS" }, { "glytoucan_ac": "G34838RM" }, { "glytoucan_ac": "G35029YA" }, { "glytoucan_ac": "G83646BJ" }, { "glytoucan_ac": "G64973KT" }, { "glytoucan_ac": "G40926MX" }, { "glytoucan_ac": "G43417UB" }, { "glytoucan_ac": "G43694RQ" }, { "glytoucan_ac": "G44211QA" }, { "glytoucan_ac": "G44215PV" }, { "glytoucan_ac": "G25079LO" }, { "glytoucan_ac": "G25481DT" }, { "glytoucan_ac": "G25637MV" }, { "glytoucan_ac": "G25987BV" }, { "glytoucan_ac": "G92050GC" }, { "glytoucan_ac": "G02815KT" }, { "glytoucan_ac": "G11457RF" }, { "glytoucan_ac": "G11637WL" }, { "glytoucan_ac": "G12580WI" }, { "glytoucan_ac": "G31852PQ" }, { "glytoucan_ac": "G73686WG" }, { "glytoucan_ac": "G74722FL" }, { "glytoucan_ac": "G74724QE" }, { "glytoucan_ac": "G19379ID" }, { "glytoucan_ac": "G19464WF" }, { "glytoucan_ac": "G36670VW" }, { "glytoucan_ac": "G10486CT" }, { "glytoucan_ac": "G28541PG" }, { "glytoucan_ac": "G27947YN" }, { "glytoucan_ac": "G66676MI" }, { "glytoucan_ac": "G66937TJ" }, { "glytoucan_ac": "G67324HN" }, { "glytoucan_ac": "G60605ZN" }, { "glytoucan_ac": "G60890ZT" }, { "glytoucan_ac": "G60923RB" }, { "glytoucan_ac": "G80920RR" }, { "glytoucan_ac": "G91023GB" }, { "glytoucan_ac": "G91365ZQ" }, { "glytoucan_ac": "G91636VS" }, { "glytoucan_ac": "G83460ZZ" }, { "glytoucan_ac": "G80223IX" }, { "glytoucan_ac": "G80393PG" }, { "glytoucan_ac": "G80475RE" }, { "glytoucan_ac": "G80735OA" }, { "glytoucan_ac": "G80858MF" }, { "glytoucan_ac": "G81006GJ" }, { "glytoucan_ac": "G81263BG" }, { "glytoucan_ac": "G81295CK" }, { "glytoucan_ac": "G05724UK" }, { "glytoucan_ac": "G06110VR" }, { "glytoucan_ac": "G06356OH" }, { "glytoucan_ac": "G54417MJ" }, { "glytoucan_ac": "G54600FO" }, { "glytoucan_ac": "G83555HU" }, { "glytoucan_ac": "G83892WB" }, { "glytoucan_ac": "G83945MQ" }, { "glytoucan_ac": "G84452RH" }, { "glytoucan_ac": "G84467IZ" }, { "glytoucan_ac": "G84820NF" }, { "glytoucan_ac": "G98896IU" }, { "glytoucan_ac": "G99074EO" }, { "glytoucan_ac": "G99342HD" }, { "glytoucan_ac": "G99858XP" }, { "glytoucan_ac": "G99969SS" }, { "glytoucan_ac": "G21507RO" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G22355FZ" }, { "glytoucan_ac": "G78059CC" }, { "glytoucan_ac": "G41247ZX" }, { "glytoucan_ac": "G14994KB" }, { "glytoucan_ac": "G15038BD" }, { "glytoucan_ac": "G15169WU" }, { "glytoucan_ac": "G15486FH" }, { "glytoucan_ac": "G16175ZV" }, { "glytoucan_ac": "G60033FS" }, { "glytoucan_ac": "G63628AV" }, { "glytoucan_ac": "G64394MX" }, { "glytoucan_ac": "G64527OM" }, { "glytoucan_ac": "G56610MH" }, { "glytoucan_ac": "G56749GV" }, { "glytoucan_ac": "G57317CE" }, { "glytoucan_ac": "G58001LT" }, { "glytoucan_ac": "G01614ZM" }, { "glytoucan_ac": "G02030ZB" }, { "glytoucan_ac": "G02886BB" }, { "glytoucan_ac": "G93579XB" }, { "glytoucan_ac": "G93994MR" }, { "glytoucan_ac": "G94435QH" }, { "glytoucan_ac": "G94583DZ" }, { "glytoucan_ac": "G94854LT" }, { "glytoucan_ac": "G08293MJ" }, { "glytoucan_ac": "G09197ZW" }, { "glytoucan_ac": "G09528DL" }, { "glytoucan_ac": "G49955PK" }, { "glytoucan_ac": "G50073PQ" }, { "glytoucan_ac": "G50757KG" }, { "glytoucan_ac": "G28052FT" }, { "glytoucan_ac": "G28106CM" }, { "glytoucan_ac": "G29068FM" }, { "glytoucan_ac": "G29651HS" }, { "glytoucan_ac": "G86752LQ" }, { "glytoucan_ac": "G87051GH" }, { "glytoucan_ac": "G87384DY" }, { "glytoucan_ac": "G87618BG" }, { "glytoucan_ac": "G88374WZ" }, { "glytoucan_ac": "G88417ED" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G46831QF" }, { "glytoucan_ac": "G47737VJ" }, { "glytoucan_ac": "G01650EU" }, { "glytoucan_ac": "G72790NZ" }, { "glytoucan_ac": "G03382KH" }, { "glytoucan_ac": "G03574QJ" }, { "glytoucan_ac": "G04791QM" }, { "glytoucan_ac": "G55220VL" }, { "glytoucan_ac": "G55382TU" }, { "glytoucan_ac": "G55484MX" }, { "glytoucan_ac": "G56102PZ" }, { "glytoucan_ac": "G91875JA" }, { "glytoucan_ac": "G92684AL" }, { "glytoucan_ac": "G00912UN" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G49284IH" }, { "glytoucan_ac": "G49299ZV" }, { "glytoucan_ac": "G49644CL" }, { "glytoucan_ac": "G49739MP" }, { "glytoucan_ac": "G49874UX" }, { "glytoucan_ac": "G10256JP" }, { "glytoucan_ac": "G10339FR" }, { "glytoucan_ac": "G10691MJ" }, { "glytoucan_ac": "G11041DA" }, { "glytoucan_ac": "G65184UU" }, { "glytoucan_ac": "G85144OK" }, { "glytoucan_ac": "G85282JO" }, { "glytoucan_ac": "G85542KD" }, { "glytoucan_ac": "G85608AG" }, { "glytoucan_ac": "G85740DB" }, { "glytoucan_ac": "G29931IJ" }, { "glytoucan_ac": "G30159WR" }, { "glytoucan_ac": "G44953PJ" }, { "glytoucan_ac": "G45359RY" }, { "glytoucan_ac": "G45504EY" }, { "glytoucan_ac": "G39018CC" }, { "glytoucan_ac": "G39188ZX" }, { "glytoucan_ac": "G39213VZ" }, { "glytoucan_ac": "G39446WN" }, { "glytoucan_ac": "G39595FH" }, { "glytoucan_ac": "G62765YT" }, { "glytoucan_ac": "G23432EQ" }, { "glytoucan_ac": "G23729WG" }, { "glytoucan_ac": "G23863VK" }, { "glytoucan_ac": "G75365RL" }, { "glytoucan_ac": "G75594YZ" }, { "glytoucan_ac": "G76163CP" }, { "glytoucan_ac": "G57776ZU" }, { "glytoucan_ac": "G16828VN" }, { "glytoucan_ac": "G31596VW" }, { "glytoucan_ac": "G31916IQ" }, { "glytoucan_ac": "G32550BI" }, { "glytoucan_ac": "G37399XV" }, { "glytoucan_ac": "G68318VE" }, { "glytoucan_ac": "G69364JQ" }, { "glytoucan_ac": "G62792OG" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G01650EU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100001101100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G07799LX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000001000001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G09197ZW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010010000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G09528DL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10339FR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15038BD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010000000011110101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15486FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G16175ZV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G19464WF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001100000.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G20956ZV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25079LO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.000111000001101100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G29651HS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000110000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G36670VW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G37399XV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G47737VJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49284IH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001100001.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G50073PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60923RB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G62792OG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.000010000001110100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G67324HN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G69364JQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80735OA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80920RR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G82364UA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011100101111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83460ZZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G87051GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.000111000011101100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G92050GC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G95835XS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010001000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P2X&bu=0&command=select+.B:103;+center+selection;+zoom+selection" }, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 129, "start_aa": "Thr", "end_pos": 129, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr129", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 129, "start_aa": "Thr", "end_pos": 129, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr129", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G75365RL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 155, "start_aa": "Ser", "end_pos": 155, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser155", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.0100000.1110100000.000000000011111000.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G94583DZ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 155, "start_aa": "Ser", "end_pos": 155, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser155", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1110000000.110100100101111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 155, "start_aa": "Ser", "end_pos": 155, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser155", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G93579XB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 257, "start_aa": "Ser", "end_pos": 257, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser257", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1110000000.110111100111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 257, "start_aa": "Ser", "end_pos": 257, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser257", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G98896IU", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 294, "start_aa": "Thr", "end_pos": 294, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr294", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1110100000.000100100011111000.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 294, "start_aa": "Thr", "end_pos": 294, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr294", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.00000000001000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:322;+center+selection;+zoom+selection" }, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "6M17", "database": "PDB", "url": "https://www.rcsb.org/structure/6M17" }, { "id": "6M18", "database": "PDB", "url": "https://www.rcsb.org/structure/6M18" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7CT5", "database": "PDB", "url": "https://www.rcsb.org/structure/7CT5" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DWX", "database": "PDB", "url": "https://www.rcsb.org/structure/7DWX" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7DX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX5" }, { "id": "7DX6", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX6" }, { "id": "7DX8", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX8" }, { "id": "7DX9", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX9" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7DX7", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX7" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KJ4", "database": "PDB", "url": "https://www.rcsb.org/structure/7KJ4" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V61", "database": "PDB", "url": "https://www.rcsb.org/structure/7V61" }, { "id": "7V7Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7V7Z" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7Y1Y", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Y" }, { "id": "7Y1Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Z" }, { "id": "7Y21", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y21" }, { "id": "7Y75", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y75" }, { "id": "7Y76", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y76" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7Y20", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y20" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8I91", "database": "PDB", "url": "https://www.rcsb.org/structure/8I91" }, { "id": "8I92", "database": "PDB", "url": "https://www.rcsb.org/structure/8I92" }, { "id": "8I93", "database": "PDB", "url": "https://www.rcsb.org/structure/8I93" }, { "id": "8I9B", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9B" }, { "id": "8I9C", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9C" }, { "id": "8I9D", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9D" }, { "id": "8I9E", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9E" }, { "id": "8I9F", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9F" }, { "id": "8I9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9G" }, { "id": "8I9H", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9H" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WBZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WBZ" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WM3", "database": "PDB", "url": "https://www.rcsb.org/structure/8WM3" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9IU1", "database": "PDB", "url": "https://www.rcsb.org/structure/9IU1" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 334, "start_aa": "Thr", "end_pos": 334, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr334", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.111111100111111111.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 334, "start_aa": "Thr", "end_pos": 334, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr334", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15486FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G19379ID", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P30&bu=0&command=select+.B:432;+center+selection;+zoom+selection" }, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SN0" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V84", "database": "PDB", "url": "https://www.rcsb.org/structure/7V84" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7V8B", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8B" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8IF2", "database": "PDB", "url": "https://www.rcsb.org/structure/8IF2" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JJE", "database": "PDB", "url": "https://www.rcsb.org/structure/8JJE" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XY9", "database": "PDB", "url": "https://www.rcsb.org/structure/8XY9" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y16", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y16" }, { "id": "8Y18", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y18" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9ELE", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELE" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G23729WG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 43, "start_aa": "Ser", "end_pos": 43, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser43", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G87384DY", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 43, "start_aa": "Ser", "end_pos": 43, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser43", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.0100000.1110100000.010000000001000001.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 43, "start_aa": "Ser", "end_pos": 43, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser43", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 44, "start_aa": "Ser", "end_pos": 44, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser44", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 496, "start_aa": "Thr", "end_pos": 496, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr496", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.0100000000.110111100111111111.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G58001LT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 496, "start_aa": "Thr", "end_pos": 496, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr496", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100000000.111110100111111111.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "T", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 496, "start_aa": "Thr", "end_pos": 496, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr496", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000010000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:53;+center+selection;+zoom+selection" }, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P8I", "database": "PDB", "url": "https://www.rcsb.org/structure/7P8I" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V82", "database": "PDB", "url": "https://www.rcsb.org/structure/7V82" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V84", "database": "PDB", "url": "https://www.rcsb.org/structure/7V84" }, { "id": "7V86", "database": "PDB", "url": "https://www.rcsb.org/structure/7V86" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7V8B", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8B" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XY9", "database": "PDB", "url": "https://www.rcsb.org/structure/8XY9" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y16", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y16" }, { "id": "8Y18", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y18" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9ELE", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELE" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G03574QJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100001101100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G09528DL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10339FR", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15486FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G20956ZV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49739MP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010011000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G62765YT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G67324HN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010100000001101101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G69364JQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72791KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G73686WG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000011101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:546;+center+selection;+zoom+selection" }, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOR", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOR" }, { "id": "8TOS", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOS" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G23729WG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 602, "start_aa": "Ser", "end_pos": 602, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser602", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 602, "start_aa": "Ser", "end_pos": 602, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser602", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G27391WQ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 611, "start_aa": "Ser", "end_pos": 611, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser611", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.0000000.00000000001000.1000000.0100000000.110111100111111111.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "S", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 611, "start_aa": "Ser", "end_pos": 611, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser611", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "000000000000000100000.00000000001000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02886BB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010101000001111100.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28541PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31852PQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39446WN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G40926MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49955PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100001111100.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54417MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001101100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57317CE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111110111111100.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57776ZU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60033FS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G65184UU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72787SB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72790NZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010011110111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83646BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85282JO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001100100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "ThermoFisher Lumos Tribrid stepped-HCD. pGlyco 2.2.2 and Byonic software. Expressed and purified a stabilized, soluble trimer Spike glycoprotein mimetic immunogen (S) and a soluble version of the ACE2 glycoprotein from a human cell line. To determine occupancy of N-linked glycans at each site a sequential deglycoslyation approach using Endoglycosidase H and PNGase F in the presence of 18O-H2O following tryptic digestion of S was used", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G00031MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100100011111100.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G00033MO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010000100001111100.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G01457KB", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G01614ZM", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111001.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G04791QM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111110.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G07410AW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G07483YN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000100001101000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10691MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G11041DA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001011000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G11457RF", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.000000000001101000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G11637WL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001001000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G16828VN", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001001000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G21507RO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G22355FZ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1110000000.110100100101111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001101100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25481DT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.000000000001001000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25637MV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010101100011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28052FT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.000000000001001000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G28106CM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G29931IJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110100100011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G30159WR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000011101000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001100100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G32550BI", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.111110100111111111.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G34838RM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39018CC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.111111100011111110.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39213VZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100100001111100.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G41611UP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G43694RQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.000000000001010000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45359RY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.010100000011111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G46831QF", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010000100011111000.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49299ZV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001000001.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49644CL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011110001.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G50757KG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G52934AK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100011111110.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55484MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100100011111000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G56102PZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G56749GV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G58667NI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010000000001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59126YU", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000001100000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59456VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.010000000001000000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60605ZN", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60890ZT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.0100000.1100100000.010000000001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G63628AV", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.110110100111111111.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100000000.010100000001111001.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G66676MI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100001111110.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G66937TJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001100000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G74722FL", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010100000011111111.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G74724QE", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G75594YZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001011000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G76163CP", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1110000000.010100000011111000.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G78059CC", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80223IX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.000010000001111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80393PG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000100100011011000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80858MF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100100001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G82119TF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G82252QI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G82348BZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100100011111101.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G82942ZJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001001000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83892WB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83945MQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001000000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G84467IZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G84820NF", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100001101100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85542KD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010000000001110000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85608AG", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1100100000.000100000001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G87618BG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100100001111000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88417ED", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010000000001010000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G90093AU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.010011000011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G91023GB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000100000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G91365ZQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001010000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G91875JA", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G92684AL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.000000000001100000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G93994MR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.000000000001000000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G94435QH", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00000000001000.1000000.1110000000.010000000001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010011100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G99074EO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G99342HD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G99858XP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000100001111000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G99969SS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001000000.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.32841605", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 193 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 312 }, { "field": "total_sites", "count": 17 }, { "field": "n_linked_sites", "count": 7 }, { "field": "o_linked_sites", "count": 11 }, { "field": "n_linked_glycan_sites", "count": 7 }, { "field": "o_linked_glycan_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 158 }, { "field": "o_linked_glycans", "count": 33 }, { "field": "exact_sites", "count": 16 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "exact_n_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked_glycans", "count": 72 }, { "field": "exact_n_linked;o_linked_sites", "count": 6 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked;o_linked_glycans", "count": 11 }, { "field": "exact_o_linked_sites", "count": 10 }, { "field": "exact_o_linked_glycan_sites", "count": 9 }, { "field": "exact_o_linked_glycans", "count": 10 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 86 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 23 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 16 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "exact_o_linked_sites", "count": 10 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 296 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_sites", "count": 7 }, { "field": "o_linked_sites", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 7 }, { "field": "o_linked_glycan_sites", "count": 10 }, { "field": "n_linked_glycans", "count": 158 }, { "field": "o_linked_glycans", "count": 33 }, { "field": "exact_sites", "count": 15 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "exact_n_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked_glycans", "count": 72 }, { "field": "exact_n_linked;o_linked_sites", "count": 6 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked;o_linked_glycans", "count": 11 }, { "field": "exact_o_linked_sites", "count": 9 }, { "field": "exact_o_linked_glycan_sites", "count": 9 }, { "field": "exact_o_linked_glycans", "count": 10 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 86 }, { "field": "fuzzy_o_linked_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_o_linked_glycans", "count": 23 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] } ] }, { "title": "Identification of angiotensin-converting enzyme 2 (ACE2) protein as the potential biomarker in SARS-CoV-2 infection-related lung cancer using computational analyses.", "journal": "Genomics", "date": "2020", "authors": "Samad A, Jafar T, Rafi JH", "reference": { "type": "PubMed", "id": "32916258", "url": "https://pubmed.ncbi.nlm.nih.gov/32916258" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "biomarkers": [ { "best_biomarker_role": [ "prognostic" ], "biomarker_canonical_id": "AN6311", "assessed_biomarker_entity": [ "Angiotensin-converting enzyme 2" ], "biomarker_id": "AN6311-1", "biomarker": [ "increased ACE2 level" ], "condition": { "id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "name_list": [ "lung cancer", "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "adenocarcinoma of lung, somatic", "cancer of lung", "lung cancer, protection against, autosomal dominant, somatic mutation", "lung cancer, resistance to, autosomal dominant, somatic mutation", "lung cancer, somatic", "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "malignant lung neoplasm", "malignant lung tumor", "malignant lung tumour", "malignant neoplasm of lung", "malignant neoplasm of the lung", "malignant tumor of lung", "malignant tumor of the lung", "malignant tumour of lung", "malignant tumour of the lung", "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "nonsmall cell lung cancer, somatic", "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "lung cancer susceptibility 1", "LNCR1", "lung cancer susceptibility", "lung cancer susceptibility 3", "LNCR3", "lung cancer susceptibility 4", "LNCR4", "lung cancer susceptibility 5", "LNCR5", "Lung cancer" ], "id_list": [ "DOID:1324", "MONDO:0008903", "MONDO:0012159", "MONDO:0012942", "MONDO:0012955", "MONDO:0013631", "MIM:211980" ] } } ], "record_id": "pubmed.32916258", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Neuropilin\u20111 as a new potential SARS\u2011CoV\u20112 infection mediator implicated in the neurologic features and central nervous system involvement of COVID\u201119.", "journal": "Molecular medicine reports", "date": "2020-11", "authors": "Davies Julie, Randeva Harpal S, Chatha Kamaljit, Hall Marcia, Spandidos Demetrios A, Karteris Emmanouil, Kyrou Ioannis", "reference": { "type": "PubMed", "id": "33000221", "url": "https://pubmed.ncbi.nlm.nih.gov/33000221" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O14786-1", "protein_name": "Neuropilin-1", "gene_name": "NRP1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33000221", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tissue-specific and interferon-inducible expression of nonfunctional ACE2 through endogenous retroelement co-option.", "journal": "Nature genetics", "date": "2020", "authors": "Ng KW, Attig J, Bolland W, Young GR, Major J, Wrobel AG, Gamblin S, Wack A, Kassiotis G", "reference": { "type": "PubMed", "id": "33077915", "url": "https://pubmed.ncbi.nlm.nih.gov/33077915" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33077915", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interferons and viruses induce a novel truncated ACE2 isoform and not the full-length SARS-CoV-2 receptor.", "journal": "Nature genetics", "date": "2020", "authors": "Onabajo OO, Banday AR, Stanifer ML, Yan W, Obajemu A, Santer DM, Florez-Vargas O, Piontkivska H, Vargas JM, Ring TJ, Kee C, Doldan P, Tyrrell DL, Mendoza JL, Boulant S, Prokunina-Olsson L", "reference": { "type": "PubMed", "id": "33077916", "url": "https://pubmed.ncbi.nlm.nih.gov/33077916" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33077916", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the Spectrum of ACE2 Variation Suggests a Possible Influence of Rare and Common Variants on Susceptibility to COVID-19 and Severity of Outcome.", "journal": "Front. Genet.", "date": "2020", "authors": "Shikov Anton E, Barbitoff Yury A, Glotov Andrey S, Danilova Maria M, Tonyan Ziravard N, Nasykhova Yulia A, Mikhailova Anastasia A, Bespalova Olesya N, Kalinin Roman S, Mirzorustamova Azizahon M, Kogan Igor Yu, Baranov Vladislav S, Chernov Alexander N, Pavlovich Dragana M, Azarenko Sergey V, Fedyakov Mikhail A, Tsay Victoria V, Eismont Yuri A, Romanova Olga V, Hobotnikov Dmitry N, Vologzhanin Dmitry A, Mosenko Sergei V, Ponomareva Tatiana A, Talts Yana A, Anisenkova Anna U, Lisovets Dmitrii G, Sarana Andrey M, Urazov Stanislav P, Scherbak Sergey G, Glotov Oleg S", "reference": { "type": "PubMed", "id": "33133145", "url": "https://pubmed.ncbi.nlm.nih.gov/33133145" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33133145", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comprehensive characterization of N- and O- glycosylation of SARS-CoV-2 human receptor angiotensin converting enzyme 2.", "journal": "Glycobiology", "date": "2020", "authors": "Shajahan A, Archer-Hartmann S, Supekar NT, Gleinich AS, Heiss C, Azadi P", "reference": { "type": "PubMed", "id": "33135055", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, "referenced_glycans": [ { "glytoucan_ac": "G00420UH" }, { "glytoucan_ac": "G59536GA" }, { "glytoucan_ac": "G59937CP" }, { "glytoucan_ac": "G88725PI" }, { "glytoucan_ac": "G89098OM" }, { "glytoucan_ac": "G89319AW" }, { "glytoucan_ac": "G59626AS" }, { "glytoucan_ac": "G79568CQ" }, { "glytoucan_ac": "G79941IJ" }, { "glytoucan_ac": "G51640FO" }, { "glytoucan_ac": "G52527GH" }, { "glytoucan_ac": "G83204BU" }, { "glytoucan_ac": "G83295QG" }, { "glytoucan_ac": "G42358LZ" }, { "glytoucan_ac": "G26403SG" }, { "glytoucan_ac": "G27251WT" }, { "glytoucan_ac": "G72667IM" }, { "glytoucan_ac": "G72797UR" }, { "glytoucan_ac": "G20732FY" }, { "glytoucan_ac": "G35029YA" }, { "glytoucan_ac": "G43638QT" }, { "glytoucan_ac": "G44211QA" }, { "glytoucan_ac": "G44215PV" }, { "glytoucan_ac": "G24835MQ" }, { "glytoucan_ac": "G24954UD" }, { "glytoucan_ac": "G25987BV" }, { "glytoucan_ac": "G02815KT" }, { "glytoucan_ac": "G11629QQ" }, { "glytoucan_ac": "G11870QZ" }, { "glytoucan_ac": "G12580WI" }, { "glytoucan_ac": "G74430RZ" }, { "glytoucan_ac": "G97876DH" }, { "glytoucan_ac": "G19517GM" }, { "glytoucan_ac": "G37442IW" }, { "glytoucan_ac": "G37868ZX" }, { "glytoucan_ac": "G37881RL" }, { "glytoucan_ac": "G10486CT" }, { "glytoucan_ac": "G66760KM" }, { "glytoucan_ac": "G68008QO" }, { "glytoucan_ac": "G68209WQ" }, { "glytoucan_ac": "G60070LT" }, { "glytoucan_ac": "G60145BJ" }, { "glytoucan_ac": "G90789YQ" }, { "glytoucan_ac": "G91473PK" }, { "glytoucan_ac": "G91636VS" }, { "glytoucan_ac": "G80475RE" }, { "glytoucan_ac": "G80966KZ" }, { "glytoucan_ac": "G81006GJ" }, { "glytoucan_ac": "G81263BG" }, { "glytoucan_ac": "G81295CK" }, { "glytoucan_ac": "G05642HQ" }, { "glytoucan_ac": "G06110VR" }, { "glytoucan_ac": "G06356OH" }, { "glytoucan_ac": "G54417MJ" }, { "glytoucan_ac": "G54600FO" }, { "glytoucan_ac": "G83555HU" }, { "glytoucan_ac": "G84452RH" }, { "glytoucan_ac": "G98596OT" }, { "glytoucan_ac": "G99966GV" }, { "glytoucan_ac": "G39943KJ" }, { "glytoucan_ac": "G22140GZ" }, { "glytoucan_ac": "G22310AV" }, { "glytoucan_ac": "G41247ZX" }, { "glytoucan_ac": "G14994KB" }, { "glytoucan_ac": "G15169WU" }, { "glytoucan_ac": "G33609NS" }, { "glytoucan_ac": "G34617SM" }, { "glytoucan_ac": "G64394MX" }, { "glytoucan_ac": "G56610MH" }, { "glytoucan_ac": "G56903ZB" }, { "glytoucan_ac": "G57818FI" }, { "glytoucan_ac": "G57888GL" }, { "glytoucan_ac": "G02030ZB" }, { "glytoucan_ac": "G03127AL" }, { "glytoucan_ac": "G93656SY" }, { "glytoucan_ac": "G94854LT" }, { "glytoucan_ac": "G08146BT" }, { "glytoucan_ac": "G08293MJ" }, { "glytoucan_ac": "G50045TK" }, { "glytoucan_ac": "G50757KG" }, { "glytoucan_ac": "G86752LQ" }, { "glytoucan_ac": "G87015RU" }, { "glytoucan_ac": "G88374WZ" }, { "glytoucan_ac": "G46687AB" }, { "glytoucan_ac": "G47518TP" }, { "glytoucan_ac": "G03382KH" }, { "glytoucan_ac": "G55220VL" }, { "glytoucan_ac": "G55382TU" }, { "glytoucan_ac": "G48414YA" }, { "glytoucan_ac": "G49874UX" }, { "glytoucan_ac": "G10256JP" }, { "glytoucan_ac": "G10339FR" }, { "glytoucan_ac": "G85144OK" }, { "glytoucan_ac": "G85740DB" }, { "glytoucan_ac": "G29880MM" }, { "glytoucan_ac": "G31153XO" }, { "glytoucan_ac": "G44953PJ" }, { "glytoucan_ac": "G45495MK" }, { "glytoucan_ac": "G45504EY" }, { "glytoucan_ac": "G39188ZX" }, { "glytoucan_ac": "G39595FH" }, { "glytoucan_ac": "G23432EQ" }, { "glytoucan_ac": "G23729WG" }, { "glytoucan_ac": "G23863VK" }, { "glytoucan_ac": "G75798PH" }, { "glytoucan_ac": "G75983OB" }, { "glytoucan_ac": "G17015OC" }, { "glytoucan_ac": "G31596VW" }, { "glytoucan_ac": "G31916IQ" }, { "glytoucan_ac": "G32926LW" }, { "glytoucan_ac": "G68318VE" }, { "glytoucan_ac": "G68698AP" }, { "glytoucan_ac": "G62461SM" } ], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P2X&bu=0&command=select+.B:103;+center+selection;+zoom+selection" }, "start_pos": 103, "start_aa": "Asn", "end_pos": 103, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn103", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N103", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N103" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G19517GM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000010000001101101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G32926LW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G43638QT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000001101101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54417MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N322", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N322" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G98596OT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:322;+center+selection;+zoom+selection" }, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "6M17", "database": "PDB", "url": "https://www.rcsb.org/structure/6M17" }, { "id": "6M18", "database": "PDB", "url": "https://www.rcsb.org/structure/6M18" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7CT5", "database": "PDB", "url": "https://www.rcsb.org/structure/7CT5" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DWX", "database": "PDB", "url": "https://www.rcsb.org/structure/7DWX" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7DX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX5" }, { "id": "7DX6", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX6" }, { "id": "7DX8", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX8" }, { "id": "7DX9", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX9" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7DX7", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX7" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KJ4", "database": "PDB", "url": "https://www.rcsb.org/structure/7KJ4" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V61", "database": "PDB", "url": "https://www.rcsb.org/structure/7V61" }, { "id": "7V7Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7V7Z" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7Y1Y", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Y" }, { "id": "7Y1Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Z" }, { "id": "7Y21", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y21" }, { "id": "7Y75", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y75" }, { "id": "7Y76", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y76" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7Y20", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y20" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8I91", "database": "PDB", "url": "https://www.rcsb.org/structure/8I91" }, { "id": "8I92", "database": "PDB", "url": "https://www.rcsb.org/structure/8I92" }, { "id": "8I93", "database": "PDB", "url": "https://www.rcsb.org/structure/8I93" }, { "id": "8I9B", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9B" }, { "id": "8I9C", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9C" }, { "id": "8I9D", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9D" }, { "id": "8I9E", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9E" }, { "id": "8I9F", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9F" }, { "id": "8I9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9G" }, { "id": "8I9H", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9H" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WBZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WBZ" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WM3", "database": "PDB", "url": "https://www.rcsb.org/structure/8WM3" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9IU1", "database": "PDB", "url": "https://www.rcsb.org/structure/9IU1" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85144OK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=8P30&bu=0&command=select+.B:432;+center+selection;+zoom+selection" }, "start_pos": 432, "start_aa": "Asn", "end_pos": 432, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn432", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N432", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N432" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "6VW1", "database": "PDB", "url": "https://www.rcsb.org/structure/6VW1" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7DMU", "database": "PDB", "url": "https://www.rcsb.org/structure/7DMU" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SN0" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V84", "database": "PDB", "url": "https://www.rcsb.org/structure/7V84" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7V8B", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8B" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XWA", "database": "PDB", "url": "https://www.rcsb.org/structure/7XWA" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8IF2", "database": "PDB", "url": "https://www.rcsb.org/structure/8IF2" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JJE", "database": "PDB", "url": "https://www.rcsb.org/structure/8JJE" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8SPH", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPH" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XY9", "database": "PDB", "url": "https://www.rcsb.org/structure/8XY9" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y16", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y16" }, { "id": "8Y18", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y18" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9ELE", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELE" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G12580WI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G43638QT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000011000001101101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44953PJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54417MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55382TU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G56610MH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G79941IJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 53, "start_aa": "Asn", "end_pos": 53, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn53", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N53", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N53" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10339FR", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:546;+center+selection;+zoom+selection" }, "start_pos": 546, "start_aa": "Asn", "end_pos": 546, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn546", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19159218" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "Q9BYF1@N546", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N546" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOR", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOR" }, { "id": "8TOS", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOS" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Y6A", "database": "PDB", "url": "https://www.rcsb.org/structure/8Y6A" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02815KT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "10.1101/2023.09.13.557529", "database": "DOI", "url": "https://doi.org/10.1101/2023.09.13.557529" }, { "id": "GLY_000888", "database": "Data Submission", "url": "http://data.glygen.org/GLY_000888" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10339FR", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100111111100.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10486CT", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00000000001000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G41247ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44211QA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68318VE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80475RE", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010011110111111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G85740DB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G86752LQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G88725PI", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=9FMM&bu=0&command=select+.A:690;+center+selection;+zoom+selection" }, "start_pos": 690, "start_aa": "Asn", "end_pos": 690, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn690", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "Q9BYF1@N690", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N690" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68008QO", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 730, "start_aa": "Thr", "end_pos": 730, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr730", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010000000011111101.00001.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G81006GJ", "type": "O-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "T", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 730, "start_aa": "Thr", "end_pos": 730, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr730", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000010000.0000000.00000000001000.1000000.1100100000.010000000011111101.00100.01001", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08293MJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G25987BV", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111110111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G35029YA", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100000000.010111100111111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45504EY", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1100100000.000111100001101100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G54600FO", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110100000.010111000001111100.00100.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" }, { "id": "37074911", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/37074911" }, { "id": "PDC000471", "database": "PDC", "url": "https://proteomic.datacommons.cancer.gov/pdc/study/PDC000471" } ], "filter_code": "001000000000000000000.xxxxxxx.00010000000000.xxxxxxx.xxxxxxxxxx.xxxxxxxxxxxxxxxxxx.xxxxx.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59937CP", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83555HU", "type": "N-linked;o-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1@N90", "database": "GPTwiki", "url": "https://edwardslab.bmcb.georgetown.edu/gptwiki/Q9BYF1@N90" } ], "filter_code": "001000000000000000000.0000000.00000000001000.0100000.1110000000.010111100011111101.00010.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G00420UH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000000.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G02030ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G03127AL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000100011111100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G03382KH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G05642HQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.000000000001111000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110111100011111111.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G08146BT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G10256JP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G11629QQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000011111100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G11870QZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.010110000001110100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G14994KB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.010111000001111100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.010101000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G20732FY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101000.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G22140GZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001101100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G23863VK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G24835MQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010010000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G24954UD", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000011000001101101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000011000001001100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G27251WT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100100001101100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G29880MM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31153XO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31596VW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.000111100001100100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G34617SM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000011000011101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G37442IW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110100000.010000000001110000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.010100000001011100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G37881RL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001000100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.111111100011111110.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G39943KJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100100001111100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G42358LZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001111100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G44215PV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011101101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G45495MK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010100000011111100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G47518TP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000011101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010111000011111100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G49874UX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G50757KG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G51640FO", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010100000001100100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G55220VL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100011111110.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G56903ZB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100100001111100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57818FI", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010100000001111100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001001100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G59536GA", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.010110000011100100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60070LT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G62461SM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000100000001001100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G64394MX", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000111000011101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000111000001100100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68209WQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G68698AP", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000100000001110100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72667IM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000111000001111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G72797UR", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.010111000011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G74430RZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.000000000001101101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G75798PH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010000000001101000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G80966KZ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.110100100001111100.10000.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G81263BG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010111100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83204BU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100100000.000100000001000000.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G83295QG", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000000000001000100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.010111000011111101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G87015RU", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000010000001101101.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G89098OM", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110000000.010111000001111100.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G89319AW", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1100000000.010100100001001100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G90789YQ", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0001000.1110100000.000100000001100100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G91473PK", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000110000001101100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G91636VS", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010111000001111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G93656SY", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000000000001100100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G94854LT", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0100000.1110000000.010011100011111101.00010.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G97876DH", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1110100000.000000000001000100.00001.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "G99966GV", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "1012", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1012" } ], "filter_code": "000000000000000000000.0000000.00010000000000.0010000.1100100000.000101000001100100.00100.01000", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.33135055", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 113 } ], "sort_fields": [ "glytoucan_ac" ] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 170 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_sites", "count": 8 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 7 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 96 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 8 }, { "field": "exact_n_linked_sites", "count": 7 }, { "field": "exact_n_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked_glycans", "count": 17 }, { "field": "exact_n_linked;o_linked_sites", "count": 7 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 7 }, { "field": "exact_n_linked;o_linked_glycans", "count": 13 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 2 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 79 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 164 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_sites", "count": 7 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 7 }, { "field": "o_linked_glycan_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 96 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "exact_sites", "count": 8 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "exact_n_linked_glycan_sites", "count": 6 }, { "field": "exact_n_linked_glycans", "count": 17 }, { "field": "exact_n_linked;o_linked_sites", "count": 7 }, { "field": "exact_n_linked;o_linked_glycan_sites", "count": 7 }, { "field": "exact_n_linked;o_linked_glycans", "count": 13 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "exact_o_linked_glycan_sites", "count": 1 }, { "field": "exact_o_linked_glycans", "count": 2 }, { "field": "fuzzy_sites", "count": 1 }, { "field": "fuzzy_n_linked_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycan_sites", "count": 1 }, { "field": "fuzzy_n_linked_glycans", "count": 79 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "filter_code", "uniprot_canonical_ac", "icn3d_view.label", "icn3d_view.url", "mining_tool" ] } ] }, { "title": "A novel ACE2 isoform is expressed in human respiratory epithelia and is upregulated in response to interferons and RNA respiratory virus infection.", "journal": "Nature genetics", "date": "2021-02", "authors": "Blume Cornelia, Jackson Claire L, Spalluto Cosma Mirella, Legebeke Jelmer, Nazlamova Liliya, Conforti Franco, Perotin Jeanne-Marie, Frank Martin, Butler John, Crispin Max, Coles Janice, Thompson James, Ridley Robert A, Dean Lareb S N, Loxham Matthew, Reikine Stephanie, Azim Adnan, Tariq Kamran, Johnston David A, Skipp Paul J, Djukanovic Ratko, Baralle Diana, McCormick Christopher J, Davies Donna E, Lucas Jane S, Wheway Gabrielle, Mennella Vito", "reference": { "type": "PubMed", "id": "33432184", "url": "https://pubmed.ncbi.nlm.nih.gov/33432184" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.33432184", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Short linear motif candidates in the cell entry system used by SARS-CoV-2 and their potential therapeutic implications.", "journal": "Science signaling", "date": "2021", "authors": "Meszaros B, Samano-Sanchez H, Alvarado-Valverde J, Calyseva J, Martinez-Perez E, Alves R, Shields DC, Kumar M, Rippmann F, Chemes LB, Gibson TJ", "reference": { "type": "PubMed", "id": "33436497", "url": "https://pubmed.ncbi.nlm.nih.gov/33436497" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05106-1", "protein_name": "Integrin beta-3", "gene_name": "ITGB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 781, "end_pos": 781, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "33436498", "url": "https://pubmed.ncbi.nlm.nih.gov/33436498" }, { "database": "PubMed", "id": "33436497", "url": "https://pubmed.ncbi.nlm.nih.gov/33436497" }, { "database": "iPTMnet", "id": "Q9BYF1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BYF1" } ], "site_lbl": "Tyr781", "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 783, "end_pos": 783, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "33436497", "url": "https://pubmed.ncbi.nlm.nih.gov/33436497" }, { "database": "PubMed", "id": "33436498", "url": "https://pubmed.ncbi.nlm.nih.gov/33436498" }, { "database": "iPTMnet", "id": "Q9BYF1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BYF1" } ], "site_lbl": "Ser783", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.33436497", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytoplasmic short linear motifs in ACE2 and integrin beta3 link SARS-CoV-2 host cell receptors to mediators of endocytosis and autophagy.", "journal": "Science signaling", "date": "2021", "authors": "Kliche J, Kuss H, Ali M, Ivarsson Y", "reference": { "type": "PubMed", "id": "33436498", "url": "https://pubmed.ncbi.nlm.nih.gov/33436498" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P05106-1", "protein_name": "Integrin beta-3", "gene_name": "ITGB3", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 781, "end_pos": 781, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "33436498", "url": "https://pubmed.ncbi.nlm.nih.gov/33436498" }, { "database": "PubMed", "id": "33436497", "url": "https://pubmed.ncbi.nlm.nih.gov/33436497" }, { "database": "iPTMnet", "id": "Q9BYF1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BYF1" } ], "site_lbl": "Tyr781", "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 783, "end_pos": 783, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "33436497", "url": "https://pubmed.ncbi.nlm.nih.gov/33436497" }, { "database": "PubMed", "id": "33436498", "url": "https://pubmed.ncbi.nlm.nih.gov/33436498" }, { "database": "iPTMnet", "id": "Q9BYF1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9BYF1" } ], "site_lbl": "Ser783", "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 778, "end_pos": 778, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "IntAct", "id": "P05106", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05106*" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "33436498", "url": "https://pubmed.ncbi.nlm.nih.gov/33436498" } ], "site_lbl": "Ser778", "uniprot_canonical_ac": "P05106-1" }, { "start_pos": 785, "end_pos": 785, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "P05106", "url": "https://www.uniprot.org/uniprotkb/P05106" }, { "database": "PubMed", "id": "8631894", "url": "https://pubmed.ncbi.nlm.nih.gov/8631894" }, { "database": "IntAct", "id": "P05106", "url": "https://www.ebi.ac.uk/intact/interactors/id:P05106*" }, { "database": "iPTMnet", "id": "P05106", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P05106" }, { "database": "PubMed", "id": "33436498", "url": "https://pubmed.ncbi.nlm.nih.gov/33436498" }, { "database": "PubMed", "id": "27145276", "url": "https://pubmed.ncbi.nlm.nih.gov/27145276" } ], "site_lbl": "Tyr785", "uniprot_canonical_ac": "P05106-1" } ], "record_id": "pubmed.33436498", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Dual nature of human ACE2 glycosylation in binding to SARS-CoV-2 spike.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2021-05-11", "authors": "Mehdipour Ahmad Reza, Hummer Gerhard", "reference": { "type": "PubMed", "id": "33903171", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:322;+center+selection;+zoom+selection" }, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "6M17", "database": "PDB", "url": "https://www.rcsb.org/structure/6M17" }, { "id": "6M18", "database": "PDB", "url": "https://www.rcsb.org/structure/6M18" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7CT5", "database": "PDB", "url": "https://www.rcsb.org/structure/7CT5" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DWX", "database": "PDB", "url": "https://www.rcsb.org/structure/7DWX" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7DX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX5" }, { "id": "7DX6", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX6" }, { "id": "7DX8", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX8" }, { "id": "7DX9", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX9" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7DX7", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX7" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KJ4", "database": "PDB", "url": "https://www.rcsb.org/structure/7KJ4" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V61", "database": "PDB", "url": "https://www.rcsb.org/structure/7V61" }, { "id": "7V7Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7V7Z" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7Y1Y", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Y" }, { "id": "7Y1Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Z" }, { "id": "7Y21", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y21" }, { "id": "7Y75", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y75" }, { "id": "7Y76", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y76" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7Y20", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y20" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8I91", "database": "PDB", "url": "https://www.rcsb.org/structure/8I91" }, { "id": "8I92", "database": "PDB", "url": "https://www.rcsb.org/structure/8I92" }, { "id": "8I93", "database": "PDB", "url": "https://www.rcsb.org/structure/8I93" }, { "id": "8I9B", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9B" }, { "id": "8I9C", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9C" }, { "id": "8I9D", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9D" }, { "id": "8I9E", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9E" }, { "id": "8I9F", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9F" }, { "id": "8I9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9G" }, { "id": "8I9H", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9H" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WBZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WBZ" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WM3", "database": "PDB", "url": "https://www.rcsb.org/structure/8WM3" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9IU1", "database": "PDB", "url": "https://www.rcsb.org/structure/9IU1" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.33903171", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "ACE2 glycans preferentially interact with SARS-CoV-2 over SARS-CoV.", "journal": "Chemical communications (Cambridge, England)", "date": "2021-06-15", "authors": "Acharya Atanu, Lynch Diane L, Pavlova Anna, Pang Yui Tik, Gumbart James C", "reference": { "type": "PubMed", "id": "34019602", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:322;+center+selection;+zoom+selection" }, "start_pos": 322, "start_aa": "Asn", "end_pos": 322, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn322", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "8P2X", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2X" }, { "id": "8P30", "database": "PDB", "url": "https://www.rcsb.org/structure/8P30" }, { "id": "8P31", "database": "PDB", "url": "https://www.rcsb.org/structure/8P31" }, { "id": "9ELF", "database": "PDB", "url": "https://www.rcsb.org/structure/9ELF" }, { "id": "8P2Y", "database": "PDB", "url": "https://www.rcsb.org/structure/8P2Y" }, { "id": "2AJF", "database": "PDB", "url": "https://www.rcsb.org/structure/2AJF" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "6M17", "database": "PDB", "url": "https://www.rcsb.org/structure/6M17" }, { "id": "6M18", "database": "PDB", "url": "https://www.rcsb.org/structure/6M18" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7CT5", "database": "PDB", "url": "https://www.rcsb.org/structure/7CT5" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DRV", "database": "PDB", "url": "https://www.rcsb.org/structure/7DRV" }, { "id": "7DWX", "database": "PDB", "url": "https://www.rcsb.org/structure/7DWX" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7DX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX5" }, { "id": "7DX6", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX6" }, { "id": "7DX8", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX8" }, { "id": "7DX9", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX9" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EKC", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKC" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKG", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKG" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7DX7", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX7" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KJ4", "database": "PDB", "url": "https://www.rcsb.org/structure/7KJ4" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7PKI", "database": "PDB", "url": "https://www.rcsb.org/structure/7PKI" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7U0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7U0N" }, { "id": "7UFK", "database": "PDB", "url": "https://www.rcsb.org/structure/7UFK" }, { "id": "7V61", "database": "PDB", "url": "https://www.rcsb.org/structure/7V61" }, { "id": "7V7Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7V7Z" }, { "id": "7V80", "database": "PDB", "url": "https://www.rcsb.org/structure/7V80" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V87", "database": "PDB", "url": "https://www.rcsb.org/structure/7V87" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V8A", "database": "PDB", "url": "https://www.rcsb.org/structure/7V8A" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WBQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBQ" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WHH", "database": "PDB", "url": "https://www.rcsb.org/structure/7WHH" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XB0", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB0" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7Y1Y", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Y" }, { "id": "7Y1Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y1Z" }, { "id": "7Y21", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y21" }, { "id": "7Y75", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y75" }, { "id": "7Y76", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y76" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "8E7M", "database": "PDB", "url": "https://www.rcsb.org/structure/8E7M" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7Y20", "database": "PDB", "url": "https://www.rcsb.org/structure/7Y20" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "7XB1", "database": "PDB", "url": "https://www.rcsb.org/structure/7XB1" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8H5C", "database": "PDB", "url": "https://www.rcsb.org/structure/8H5C" }, { "id": "8I91", "database": "PDB", "url": "https://www.rcsb.org/structure/8I91" }, { "id": "8I92", "database": "PDB", "url": "https://www.rcsb.org/structure/8I92" }, { "id": "8I93", "database": "PDB", "url": "https://www.rcsb.org/structure/8I93" }, { "id": "8I9B", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9B" }, { "id": "8I9C", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9C" }, { "id": "8I9D", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9D" }, { "id": "8I9E", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9E" }, { "id": "8I9F", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9F" }, { "id": "8I9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9G" }, { "id": "8I9H", "database": "PDB", "url": "https://www.rcsb.org/structure/8I9H" }, { "id": "8IOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOU" }, { "id": "8IOV", "database": "PDB", "url": "https://www.rcsb.org/structure/8IOV" }, { "id": "8JYN", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYN" }, { "id": "8JYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYO" }, { "id": "8JYP", "database": "PDB", "url": "https://www.rcsb.org/structure/8JYP" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8SPI", "database": "PDB", "url": "https://www.rcsb.org/structure/8SPI" }, { "id": "8TOT", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOT" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8VQR", "database": "PDB", "url": "https://www.rcsb.org/structure/8VQR" }, { "id": "8WBZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WBZ" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WM3", "database": "PDB", "url": "https://www.rcsb.org/structure/8WM3" }, { "id": "8WP8", "database": "PDB", "url": "https://www.rcsb.org/structure/8WP8" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XAL", "database": "PDB", "url": "https://www.rcsb.org/structure/8XAL" }, { "id": "8XLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLM" }, { "id": "8XLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8XLN" }, { "id": "8XN2", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN2" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XN5", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN5" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XUY", "database": "PDB", "url": "https://www.rcsb.org/structure/8XUY" }, { "id": "8XV0", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV0" }, { "id": "8XV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8XV1" }, { "id": "8XYE", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYE" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8Z4X", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z4X" }, { "id": "8Z64", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z64" }, { "id": "8Z7B", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7B" }, { "id": "8Z7P", "database": "PDB", "url": "https://www.rcsb.org/structure/8Z7P" }, { "id": "8XVM", "database": "PDB", "url": "https://www.rcsb.org/structure/8XVM" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9IU1", "database": "PDB", "url": "https://www.rcsb.org/structure/9IU1" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9LDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/9LDJ" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9VA2", "database": "PDB", "url": "https://www.rcsb.org/structure/9VA2" }, { "id": "9VLT", "database": "PDB", "url": "https://www.rcsb.org/structure/9VLT" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01000", "uniprot_canonical_ac": "Q9BYF1-1" }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.34019602", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 2 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_n_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Exploring the Role of Glycans in the Interaction of SARS-CoV-2 RBD and Human Receptor ACE2.", "journal": "Viruses", "date": "2021-05-17", "authors": "Nguyen Kien, Chakraborty Srirupa, Mansbach Rachael A, Korber Bette, Gnanakaran Sandrasegaram", "reference": { "type": "PubMed", "id": "34067878", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true, "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": { "label": "iCn3D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?bcifid=7WGB&bu=0&command=select+.D:90;+center+selection;+zoom+selection" }, "start_pos": 90, "start_aa": "Asn", "end_pos": 90, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn90", "evidence": [ { "id": "33135055", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33135055" }, { "id": "GLY_000040", "database": "UniCarbKB", "url": "http://data.glygen.org/GLY_000040" }, { "id": "10.1093/glycob/cwaa101", "database": "DOI", "url": "https://doi.org/10.1093/glycob/cwaa101" }, { "id": "32841605", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32841605" }, { "id": "10.1016/j.chom.2020.08.004", "database": "DOI", "url": "https://doi.org/10.1016/j.chom.2020.08.004" }, { "id": "Q9BYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1#ptm_processing" }, { "id": "14754895", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/14754895" }, { "id": "19901337", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/19901337" }, { "id": "15084671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/15084671" }, { "id": "A0A7I2V3X6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3X6#ptm_processing" }, { "id": "PIRSR601548-5", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-5" }, { "id": "PIRSR601548-10", "database": "PIR Site Rule", "url": "https://www.uniprot.org/unirule/PIRSR601548-10" }, { "id": "A0A7I2V4H0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V4H0#ptm_processing" }, { "id": "A0A7I2V3N4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V3N4#ptm_processing" }, { "id": "A0A7I2V2E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A7I2V2E9#ptm_processing" }, { "id": "34019602", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34019602" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" }, { "id": "34067878", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/34067878" }, { "id": "33903171", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33903171" }, { "id": "32766576", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/32766576" }, { "id": "33607086", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33607086" }, { "id": "7WGB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGB" }, { "id": "1R42", "database": "PDB", "url": "https://www.rcsb.org/structure/1R42" }, { "id": "1R4L", "database": "PDB", "url": "https://www.rcsb.org/structure/1R4L" }, { "id": "3KBH", "database": "PDB", "url": "https://www.rcsb.org/structure/3KBH" }, { "id": "6LZG", "database": "PDB", "url": "https://www.rcsb.org/structure/6LZG" }, { "id": "6M0J", "database": "PDB", "url": "https://www.rcsb.org/structure/6M0J" }, { "id": "7A91", "database": "PDB", "url": "https://www.rcsb.org/structure/7A91" }, { "id": "7A92", "database": "PDB", "url": "https://www.rcsb.org/structure/7A92" }, { "id": "7DDO", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDO" }, { "id": "7DDP", "database": "PDB", "url": "https://www.rcsb.org/structure/7DDP" }, { "id": "7DQA", "database": "PDB", "url": "https://www.rcsb.org/structure/7DQA" }, { "id": "7DX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7DX4" }, { "id": "7EDJ", "database": "PDB", "url": "https://www.rcsb.org/structure/7EDJ" }, { "id": "7EFR", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFR" }, { "id": "7EKE", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKE" }, { "id": "7EKF", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKF" }, { "id": "7EKH", "database": "PDB", "url": "https://www.rcsb.org/structure/7EKH" }, { "id": "7EFP", "database": "PDB", "url": "https://www.rcsb.org/structure/7EFP" }, { "id": "7BH9", "database": "PDB", "url": "https://www.rcsb.org/structure/7BH9" }, { "id": "7FDH", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDH" }, { "id": "7FDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDI" }, { "id": "7KMB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMB" }, { "id": "7KMS", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMS" }, { "id": "7KMZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7KMZ" }, { "id": "7KNB", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNB" }, { "id": "7KNE", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNE" }, { "id": "7KNH", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNH" }, { "id": "7KNI", "database": "PDB", "url": "https://www.rcsb.org/structure/7KNI" }, { "id": "7L0N", "database": "PDB", "url": "https://www.rcsb.org/structure/7L0N" }, { "id": "7LO4", "database": "PDB", "url": "https://www.rcsb.org/structure/7LO4" }, { "id": "7MJM", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJM" }, { "id": "7MJN", "database": "PDB", "url": "https://www.rcsb.org/structure/7MJN" }, { "id": "7NXC", "database": "PDB", "url": "https://www.rcsb.org/structure/7NXC" }, { "id": "7P19", "database": "PDB", "url": "https://www.rcsb.org/structure/7P19" }, { "id": "7FDG", "database": "PDB", "url": "https://www.rcsb.org/structure/7FDG" }, { "id": "7R0Z", "database": "PDB", "url": "https://www.rcsb.org/structure/7R0Z" }, { "id": "7R10", "database": "PDB", "url": "https://www.rcsb.org/structure/7R10" }, { "id": "7R11", "database": "PDB", "url": "https://www.rcsb.org/structure/7R11" }, { "id": "7R12", "database": "PDB", "url": "https://www.rcsb.org/structure/7R12" }, { "id": "7R1A", "database": "PDB", "url": "https://www.rcsb.org/structure/7R1A" }, { "id": "7RPV", "database": "PDB", "url": "https://www.rcsb.org/structure/7RPV" }, { "id": "7SXX", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXX" }, { "id": "7SXY", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXY" }, { "id": "7SXZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7SXZ" }, { "id": "7SY0", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY0" }, { "id": "7SY1", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY1" }, { "id": "7SY2", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY2" }, { "id": "7SY3", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY3" }, { "id": "7SY4", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY4" }, { "id": "7SY5", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY5" }, { "id": "7SY6", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY6" }, { "id": "7SY7", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY7" }, { "id": "7SY8", "database": "PDB", "url": "https://www.rcsb.org/structure/7SY8" }, { "id": "7T9K", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9K" }, { "id": "7T9L", "database": "PDB", "url": "https://www.rcsb.org/structure/7T9L" }, { "id": "7TEW", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEW" }, { "id": "7TEX", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEX" }, { "id": "7TEZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7TEZ" }, { "id": "7TF0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TF0" }, { "id": "7TN0", "database": "PDB", "url": "https://www.rcsb.org/structure/7TN0" }, { "id": "7V83", "database": "PDB", "url": "https://www.rcsb.org/structure/7V83" }, { "id": "7V88", "database": "PDB", "url": "https://www.rcsb.org/structure/7V88" }, { "id": "7V89", "database": "PDB", "url": "https://www.rcsb.org/structure/7V89" }, { "id": "7VX4", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX4" }, { "id": "7VX5", "database": "PDB", "url": "https://www.rcsb.org/structure/7VX5" }, { "id": "7WBL", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBL" }, { "id": "7WBP", "database": "PDB", "url": "https://www.rcsb.org/structure/7WBP" }, { "id": "7WGC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WGC" }, { "id": "7WPA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPA" }, { "id": "7WPB", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPB" }, { "id": "7WPC", "database": "PDB", "url": "https://www.rcsb.org/structure/7WPC" }, { "id": "7WS8", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS8" }, { "id": "7WS9", "database": "PDB", "url": "https://www.rcsb.org/structure/7WS9" }, { "id": "7WSA", "database": "PDB", "url": "https://www.rcsb.org/structure/7WSA" }, { "id": "7XAZ", "database": "PDB", "url": "https://www.rcsb.org/structure/7XAZ" }, { "id": "7XBF", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBF" }, { "id": "7XBG", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBG" }, { "id": "7XBH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XBH" }, { "id": "7XCI", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCI" }, { "id": "7XCP", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCP" }, { "id": "7XID", "database": "PDB", "url": "https://www.rcsb.org/structure/7XID" }, { "id": "7XO7", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO7" }, { "id": "7XO9", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO9" }, { "id": "7YA1", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA1" }, { "id": "7YDI", "database": "PDB", "url": "https://www.rcsb.org/structure/7YDI" }, { "id": "7YEG", "database": "PDB", "url": "https://www.rcsb.org/structure/7YEG" }, { "id": "7YHW", "database": "PDB", "url": "https://www.rcsb.org/structure/7YHW" }, { "id": "7YJ3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YJ3" }, { "id": "7YR2", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR2" }, { "id": "7YR3", "database": "PDB", "url": "https://www.rcsb.org/structure/7YR3" }, { "id": "7ZDQ", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZDQ" }, { "id": "7ZF7", "database": "PDB", "url": "https://www.rcsb.org/structure/7ZF7" }, { "id": "8AQS", "database": "PDB", "url": "https://www.rcsb.org/structure/8AQS" }, { "id": "8ASY", "database": "PDB", "url": "https://www.rcsb.org/structure/8ASY" }, { "id": "8DF5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DF5" }, { "id": "8DLJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLJ" }, { "id": "8DLK", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLK" }, { "id": "8DLM", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLM" }, { "id": "8DLN", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLN" }, { "id": "8DLP", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLP" }, { "id": "8DLQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLQ" }, { "id": "8DLU", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLU" }, { "id": "8DLV", "database": "PDB", "url": "https://www.rcsb.org/structure/8DLV" }, { "id": "8DM5", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM5" }, { "id": "8DM6", "database": "PDB", "url": "https://www.rcsb.org/structure/8DM6" }, { "id": "8DV1", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV1" }, { "id": "8DV2", "database": "PDB", "url": "https://www.rcsb.org/structure/8DV2" }, { "id": "7YA0", "database": "PDB", "url": "https://www.rcsb.org/structure/7YA0" }, { "id": "7XO8", "database": "PDB", "url": "https://www.rcsb.org/structure/7XO8" }, { "id": "7XCH", "database": "PDB", "url": "https://www.rcsb.org/structure/7XCH" }, { "id": "8FXB", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXB" }, { "id": "8FXC", "database": "PDB", "url": "https://www.rcsb.org/structure/8FXC" }, { "id": "8H06", "database": "PDB", "url": "https://www.rcsb.org/structure/8H06" }, { "id": "8QSQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8QSQ" }, { "id": "8S9G", "database": "PDB", "url": "https://www.rcsb.org/structure/8S9G" }, { "id": "8TOQ", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOQ" }, { "id": "8TOU", "database": "PDB", "url": "https://www.rcsb.org/structure/8TOU" }, { "id": "8VKO", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKO" }, { "id": "8WDR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDR" }, { "id": "8WDS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDS" }, { "id": "8WDY", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDY" }, { "id": "8WDZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WDZ" }, { "id": "8WE0", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE0" }, { "id": "8WE1", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE1" }, { "id": "8WGV", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGV" }, { "id": "8WGW", "database": "PDB", "url": "https://www.rcsb.org/structure/8WGW" }, { "id": "8WHS", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHS" }, { "id": "8WHU", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHU" }, { "id": "8WHZ", "database": "PDB", "url": "https://www.rcsb.org/structure/8WHZ" }, { "id": "8WRH", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRH" }, { "id": "8WRL", "database": "PDB", "url": "https://www.rcsb.org/structure/8WRL" }, { "id": "8WSR", "database": "PDB", "url": "https://www.rcsb.org/structure/8WSR" }, { "id": "8WTD", "database": "PDB", "url": "https://www.rcsb.org/structure/8WTD" }, { "id": "8XN3", "database": "PDB", "url": "https://www.rcsb.org/structure/8XN3" }, { "id": "8XNF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNF" }, { "id": "8XNK", "database": "PDB", "url": "https://www.rcsb.org/structure/8XNK" }, { "id": "8XSF", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSF" }, { "id": "8XSJ", "database": "PDB", "url": "https://www.rcsb.org/structure/8XSJ" }, { "id": "8XXW", "database": "PDB", "url": "https://www.rcsb.org/structure/8XXW" }, { "id": "8XYO", "database": "PDB", "url": "https://www.rcsb.org/structure/8XYO" }, { "id": "8WE4", "database": "PDB", "url": "https://www.rcsb.org/structure/8WE4" }, { "id": "8VKP", "database": "PDB", "url": "https://www.rcsb.org/structure/8VKP" }, { "id": "9FMM", "database": "PDB", "url": "https://www.rcsb.org/structure/9FMM" }, { "id": "9J62", "database": "PDB", "url": "https://www.rcsb.org/structure/9J62" }, { "id": "9IUU", "database": "PDB", "url": "https://www.rcsb.org/structure/9IUU" }, { "id": "9R19", "database": "PDB", "url": "https://www.rcsb.org/structure/9R19" }, { "id": "9RVA", "database": "PDB", "url": "https://www.rcsb.org/structure/9RVA" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01100", "uniprot_canonical_ac": "Q9BYF1-1" } ], "record_id": "pubmed.34067878", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "icn3d_view.label", "icn3d_view.url", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "LRRC15 inhibits SARS-CoV-2 cellular entry in trans.", "journal": "PLoS Biol.", "date": "2022", "authors": "Song Jaewon, Chow Ryan D, Pe\u00f1a-Hern\u00e1ndez Mario A, Zhang Li, Loeb Skylar A, So Eui-Young, Liang Olin D, Ren Ping, Chen Sidi, Wilen Craig B, Lee Sanghyun", "reference": { "type": "PubMed", "id": "36228039", "url": "https://pubmed.ncbi.nlm.nih.gov/36228039" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TF66-1", "protein_name": "Leucine-rich repeat-containing protein 15", "gene_name": "LRRC15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36228039", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Fibroblast-expressed LRRC15 is a receptor for SARS-CoV-2 spike and controls antiviral and antifibrotic transcriptional programs.", "journal": "PLoS Biol.", "date": "2023", "authors": "Loo Lipin, Waller Matthew A, Moreno Cesar L, Cole Alexander J, Stella Alberto Ospina, Pop Oltin-Tiberiu, Jochum Ann-Kristin, Ali Omar Hasan, Denes Christopher E, Hamoudi Zina, Chung Felicity, Aggarwal Anupriya, Low Jason K K, Patel Karishma, Siddiquee Rezwan, Kang Taeyoung, Mathivanan Suresh, Mackay Joel P, Jochum Wolfram, Flatz Lukas, Hesselson Daniel, Turville Stuart, Neely G Gregory", "reference": { "type": "PubMed", "id": "36757924", "url": "https://pubmed.ncbi.nlm.nih.gov/36757924" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8TF66-1", "protein_name": "Leucine-rich repeat-containing protein 15", "gene_name": "LRRC15", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36757924", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Vitamin C promotes ACE2 degradation and protects against SARS-CoV-2 infection.", "journal": "EMBO reports", "date": "2023-04-05", "authors": "Zuo Yibo, Zheng Zhijin, Huang Yingkang, He Jiuyi, Zang Lichao, Ren Tengfei, Cao Xinhua, Miao Ying, Yuan Yukang, Liu Yanli, Ma Feng, Dai Jianfeng, Tian Sheng, Ding Qiang, Zheng Hui", "reference": { "type": "PubMed", "id": "36876523", "url": "https://pubmed.ncbi.nlm.nih.gov/36876523" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q70EL3-1", "protein_name": "Ubiquitin carboxyl-terminal hydrolase 50", "gene_name": "USP50", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 788, "end_pos": 788, "sequence_org": "K", "sequence_mut": "R", "comment": "Increases ACE2 protein stability.", "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" }, { "database": "PubMed", "id": "36876523", "url": "https://pubmed.ncbi.nlm.nih.gov/36876523" } ], "uniprot_canonical_ac": "Q9BYF1-1" }, { "start_pos": 53, "end_pos": 53, "sequence_org": "C", "sequence_mut": "S", "comment": "Abolishes ubiquitin-like protein peptidase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q70EL3", "url": "https://www.uniprot.org/uniprotkb/Q70EL3" }, { "database": "PubMed", "id": "28094437", "url": "https://pubmed.ncbi.nlm.nih.gov/28094437" }, { "database": "PubMed", "id": "36876523", "url": "https://pubmed.ncbi.nlm.nih.gov/36876523" } ], "uniprot_canonical_ac": "Q70EL3-1" } ], "record_id": "pubmed.36876523", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitination of angiotensin-converting enzyme 2 contributes to the development of pulmonary arterial hypertension mediated by neural precursor cell-expressed developmentally down-regulated gene 4-Like.", "journal": "Respiratory research", "date": "2024-08-29", "authors": "Wang Rui, Wang Rui, Zhou Siqi, Liu Tianya, Dang Jingjing, Chen Qianmin, Chen Jingyu, Wang Zhiping", "reference": { "type": "PubMed", "id": "39210401", "url": "https://pubmed.ncbi.nlm.nih.gov/39210401" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96PU5-1", "protein_name": "E3 ubiquitin-protein ligase NEDD4-like", "gene_name": "NEDD4L", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39210401", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Role of ACE2 and TMPRSS2 polymorphisms on COVID-19 outcome and disease severity in adult patients: A prospective cohort study in a tertiary hospital, Indonesia.", "journal": "Narra J", "date": "2024-08", "authors": "Yunita Rina, Wahyuni Arlinda S, Sinaga Bintang Ym, Yamamoto Zulham, Soebandrio Amin, Kusumawati R Lia, Sembiring Rosita J, Pandia Pandiaman", "reference": { "type": "PubMed", "id": "39280326", "url": "https://pubmed.ncbi.nlm.nih.gov/39280326" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" }, { "uniprot_canonical_ac": "O15393-1", "protein_name": "Transmembrane protease serine 2", "gene_name": "TMPRSS2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39280326", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human ACE2 Gene Replacement Mice Support SARS-CoV-2 Viral Replication and Nonlethal Disease Progression.", "journal": "ImmunoHorizons", "date": "2024-09-01", "authors": "Thiede Joshua M, Dick Jenna K, Jarjour Nicholas N, Krishna Venkatramana D, Qian Lily, Sangala Jules, Benzow Kellie, Karanjeet Kul, Chin Shine, Rainwater Orion, Cheeran Maxim C-J, Hogquist Kristin A, Jameson Stephen C, Hart Geoffrey T, Bold Tyler D, Koob Michael D", "reference": { "type": "PubMed", "id": "39287601", "url": "https://pubmed.ncbi.nlm.nih.gov/39287601" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39287601", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of SARS-CoV-2 Spike protein with ACE2 induces cortical actin modulation, including dephosphorylation of ERM proteins and reduction of cortical stiffness.", "journal": "Human cell", "date": "2024-10-22", "authors": "Do Thi Ly, Tachibana Kouichi, Yamamoto Norio, Ando Kiyoshi, Isoda Takaaki, Kihara Takanori", "reference": { "type": "PubMed", "id": "39436480", "url": "https://pubmed.ncbi.nlm.nih.gov/39436480" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BYF1-1", "protein_name": "Angiotensin-converting enzyme 2", "gene_name": "ACE2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BYF1", "url": "https://www.uniprot.org/uniprotkb/Q9BYF1" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39436480", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human erythrocyte pyrimidine 5'-nucleotidase, PN-I, is identical to p36, a protein associated to lupus inclusion formation in response to alpha-interferon.", "journal": "Blood", "date": "2000", "authors": "Amici A, Emanuelli M, Raffaelli N, Ruggieri S, Saccucci F, Magni G", "reference": { "type": "PubMed", "id": "10942414", "url": "https://pubmed.ncbi.nlm.nih.gov/10942414" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10942414", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetic basis of hemolytic anemia caused by pyrimidine 5' nucleotidase deficiency.", "journal": "Blood", "date": "2001", "authors": "Marinaki AM, Escuredo E, Duley JA, Simmonds HA, Amici A, Naponelli V, Magni G, Seip M, Ben-Bassat I, Harley EH, Thein SL, Rees DC", "reference": { "type": "PubMed", "id": "11369620", "url": "https://pubmed.ncbi.nlm.nih.gov/11369620" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11369620", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of six unrelated Italian patients affected by pyrimidine 5'-nucleotidase deficiency.", "journal": "British journal of haematology", "date": "2003", "authors": "Bianchi P, Fermo E, Alfinito F, Vercellati C, Baserga M, Ferraro F, Guzzo I, Rotoli B, Zanella A", "reference": { "type": "PubMed", "id": "12930399", "url": "https://pubmed.ncbi.nlm.nih.gov/12930399" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12930399", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis of Japanese variants of pyrimidine 5'-nucleotidase deficiency.", "journal": "British journal of haematology", "date": "2004", "authors": "Kanno H, Takizawa T, Miwa S, Fujii H", "reference": { "type": "PubMed", "id": "15238149", "url": "https://pubmed.ncbi.nlm.nih.gov/15238149" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15238149", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional analysis of pyrimidine 5'-nucleotidase mutants causing nonspherocytic hemolytic anemia.", "journal": "Blood", "date": "2005", "authors": "Chiarelli LR, Bianchi P, Fermo E, Galizzi A, Iadarola P, Mattevi A, Zanella A, Valentini G", "reference": { "type": "PubMed", "id": "15604219", "url": "https://pubmed.ncbi.nlm.nih.gov/15604219" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15604219", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evidence for essential catalytic determinants for human erythrocyte pyrimidine 5'-nucleotidase.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2005", "authors": "Amici A, Ciccioli K, Naponelli V, Raffaelli N, Magni G", "reference": { "type": "PubMed", "id": "15968458", "url": "https://pubmed.ncbi.nlm.nih.gov/15968458" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 135, "end_pos": 135, "sequence_org": "E", "sequence_mut": "D", "comment": "No effect on nucleotidase activity. Almost complete loss of phosphotransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" }, { "database": "PubMed", "id": "15968458", "url": "https://pubmed.ncbi.nlm.nih.gov/15968458" } ], "uniprot_canonical_ac": "Q9H0P0-4" }, { "start_pos": 232, "end_pos": 232, "sequence_org": "D", "sequence_mut": "N", "comment": "No effect on nucleotidase and phosphotransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" }, { "database": "PubMed", "id": "15968458", "url": "https://pubmed.ncbi.nlm.nih.gov/15968458" } ], "uniprot_canonical_ac": "Q9H0P0-4" }, { "start_pos": 233, "end_pos": 233, "sequence_org": "F", "sequence_mut": "A", "comment": "Almost complete loss of nucleotidase and phosphotransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" }, { "database": "PubMed", "id": "15968458", "url": "https://pubmed.ncbi.nlm.nih.gov/15968458" } ], "uniprot_canonical_ac": "Q9H0P0-4" }, { "start_pos": 234, "end_pos": 234, "sequence_org": "D", "sequence_mut": "N", "comment": "No effect on nucleotidase and phosphotransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" }, { "database": "PubMed", "id": "15968458", "url": "https://pubmed.ncbi.nlm.nih.gov/15968458" } ], "uniprot_canonical_ac": "Q9H0P0-4" }, { "start_pos": 88, "end_pos": 88, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of nucleotidase and phosphotransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" }, { "database": "PubMed", "id": "15968458", "url": "https://pubmed.ncbi.nlm.nih.gov/15968458" } ], "uniprot_canonical_ac": "Q9H0P0-4" }, { "start_pos": 89, "end_pos": 89, "sequence_org": "F", "sequence_mut": "A", "comment": "Almost complete loss of nucleotidase and phosphotransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" }, { "database": "PubMed", "id": "15968458", "url": "https://pubmed.ncbi.nlm.nih.gov/15968458" } ], "uniprot_canonical_ac": "Q9H0P0-4" }, { "start_pos": 90, "end_pos": 90, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of nucleotidase and phosphotransferase activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" }, { "database": "PubMed", "id": "15968458", "url": "https://pubmed.ncbi.nlm.nih.gov/15968458" } ], "uniprot_canonical_ac": "Q9H0P0-4" } ], "record_id": "pubmed.15968458", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular characterization of five Portuguese patients with pyrimidine 5'-nucleotidase deficient hemolytic anemia showing three new P5'N-I mutations.", "journal": "Haematologica", "date": "2006", "authors": "Manco L, Relvas L, Silva Pinto C, Pereira J, Almeida AB, Ribeiro ML", "reference": { "type": "PubMed", "id": "16461318", "url": "https://pubmed.ncbi.nlm.nih.gov/16461318" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16461318", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular basis of pyrimidine 5'-nucleotidase deficiency caused by 3 newly identified missense mutations (c.187T>C, c.469G>C and c.740T>C) and a tabulation of known mutations.", "journal": "Blood cells, molecules & diseases", "date": "2008", "authors": "Chiarelli LR, Morera SM, Galizzi A, Fermo E, Zanella A, Valentini G", "reference": { "type": "PubMed", "id": "18499901", "url": "https://pubmed.ncbi.nlm.nih.gov/18499901" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18499901", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cytosolic 5'-nucleotidase III (NT5C3): gene sequence variation and functional genomics.", "journal": "Pharmacogenetics and genomics", "date": "2009", "authors": "Aksoy P, Zhu MJ, Kalari KR, Moon I, Pelleymounter LL, Eckloff BW, Wieben ED, Yee VC, Weinshilboum RM, Wang L", "reference": { "type": "PubMed", "id": "19623099", "url": "https://pubmed.ncbi.nlm.nih.gov/19623099" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.19623099", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Pyrimidine-5'-nucleotidase Campinas, a new mutation (p.R56G) in the NT5C3 gene associated with pyrimidine-5'-nucleotidase type I deficiency and influence of Gilbert's Syndrome on clinical expression.", "journal": "Blood cells, molecules & diseases", "date": "2014", "authors": "Santos Ad, Dantas LE, Traina F, Albuquerque DM, Chaim EA, Saad ST", "reference": { "type": "PubMed", "id": "25153905", "url": "https://pubmed.ncbi.nlm.nih.gov/25153905" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25153905", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Two novel mutations (c.830A>G, c.252+1G>A) in NT5C3A associated with hereditary pyrimidine 5'-nucleotidase deficiency: two cases report and literature review].", "journal": "Zhonghua xue ye xue za zhi = Zhonghua xueyexue zazhi", "date": "2021", "authors": "Li Y, Zhao X, Hu XR, Li JP, Xiong YZ, Sun XX, Ye L, Yang Y, Li Y, Yang WR, Peng GX, Fan HH, Zhou K, Jing LP, Zhang FK, Zhang L", "reference": { "type": "PubMed", "id": "34547876", "url": "https://pubmed.ncbi.nlm.nih.gov/34547876" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34547876", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Purification, microsequencing, and immunolocalization of p36, a new interferon-alpha-induced protein that is associated with human lupus inclusions.", "journal": "J. Biol. Chem.", "date": "1996", "authors": "Rich S A, Bose M, Tempst P, Rudofsky U H", "reference": { "type": "PubMed", "id": "8557639", "url": "https://pubmed.ncbi.nlm.nih.gov/8557639" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H0P0-4", "protein_name": "Cytosolic 5'-nucleotidase 3A", "gene_name": "NT5C3A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H0P0", "url": "https://www.uniprot.org/uniprotkb/Q9H0P0" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8557639", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cellular distribution of Lysyl-tRNA synthetase and its interaction with Gag during human immunodeficiency virus type 1 assembly.", "journal": "J. Virol.", "date": "2004", "authors": "Halwani R, Cen S, Javanbakht H, Saadatmand J, Kim S, Shiba K, Kleiman L", "reference": { "type": "PubMed", "id": "15220430", "url": "https://pubmed.ncbi.nlm.nih.gov/15220430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13155-1", "protein_name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2", "gene_name": "AIMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15046-1", "protein_name": "Lysine--tRNA ligase", "gene_name": "KARS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13155", "url": "https://www.uniprot.org/uniprotkb/Q13155" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1, "end_pos": 65, "sequence_org": "MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTTDNGVG", "sequence_mut": "", "comment": "Loss of nuclear localization, but no effect on packaging into HIV-1.", "evidence": [ { "database": "UniProtKB", "id": "Q15046", "url": "https://www.uniprot.org/uniprotkb/Q15046" }, { "database": "PubMed", "id": "15220430", "url": "https://pubmed.ncbi.nlm.nih.gov/15220430" } ], "uniprot_canonical_ac": "Q15046-1" } ], "record_id": "pubmed.15220430", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Lysyl-tRNA synthetase interacts with EF1alpha, aspartyl-tRNA synthetase and p38 in vitro.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2008", "authors": "Guzzo Catherine M, Yang David C H", "reference": { "type": "PubMed", "id": "18029264", "url": "https://pubmed.ncbi.nlm.nih.gov/18029264" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13155-1", "protein_name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2", "gene_name": "AIMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P68104-1", "protein_name": "Elongation factor 1-alpha 1", "gene_name": "EEF1A1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P14868-1", "protein_name": "Aspartate--tRNA ligase, cytoplasmic", "gene_name": "DARS1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15046-1", "protein_name": "Lysine--tRNA ligase", "gene_name": "KARS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13155", "url": "https://www.uniprot.org/uniprotkb/Q13155" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18029264", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural Basis for Specific Inhibition of tRNA Synthetase by an ATP Competitive Inhibitor.", "journal": "Chem. Biol.", "date": "2015", "authors": "Fang P, Han H, Wang J, Chen K, Chen X, Guo M", "reference": { "type": "PubMed", "id": "26074468", "url": "https://pubmed.ncbi.nlm.nih.gov/26074468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13155-1", "protein_name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2", "gene_name": "AIMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q15046-1", "protein_name": "Lysine--tRNA ligase", "gene_name": "KARS1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13155", "url": "https://www.uniprot.org/uniprotkb/Q13155" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.26074468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Oncogenic Mutation of AIMP2/p38 Inhibits Its Tumor-Suppressive Interaction with Smurf2.", "journal": "Cancer research", "date": "2016", "authors": "Kim DG, Lee JY, Lee JH, Cho HY, Kang BS, Jang SY, Kim MH, Guo M, Han JM, Kim SJ, Kim S", "reference": { "type": "PubMed", "id": "27197155", "url": "https://pubmed.ncbi.nlm.nih.gov/27197155" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13155-1", "protein_name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2", "gene_name": "AIMP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13155", "url": "https://www.uniprot.org/uniprotkb/Q13155" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 156, "end_pos": 156, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q13155", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q13155" }, { "database": "PubMed", "id": "27197155", "url": "https://pubmed.ncbi.nlm.nih.gov/27197155" } ], "site_lbl": "Ser156", "uniprot_canonical_ac": "Q13155-1" } ], "record_id": "pubmed.27197155", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homozygosity for a nonsense variant in AIMP2 is associated with a progressive neurodevelopmental disorder with microcephaly, seizures, and spastic quadriparesis.", "journal": "Journal of human genetics", "date": "2018", "authors": "Shukla A, Das Bhowmik A, Hebbar M, Rajagopal KV, Girisha KM, Gupta N, Dalal A", "reference": { "type": "PubMed", "id": "29215095", "url": "https://pubmed.ncbi.nlm.nih.gov/29215095" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13155-1", "protein_name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2", "gene_name": "AIMP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13155", "url": "https://www.uniprot.org/uniprotkb/Q13155" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.29215095", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AIMP2-DX2 provides therapeutic interface to control KRAS-driven tumorigenesis.", "journal": "Nature communications", "date": "2022", "authors": "Kim DG, Choi Y, Lee Y, Lim S, Kong J, Song J, Roh Y, Harmalkar DS, Lee K, Goo JI, Cho HY, Mushtaq AU, Lee J, Park SH, Kim D, Min BS, Lee KY, Jeon YH, Lee S, Lee K, Kim S", "reference": { "type": "PubMed", "id": "35546148", "url": "https://pubmed.ncbi.nlm.nih.gov/35546148" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13155-1", "protein_name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2", "gene_name": "AIMP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13155", "url": "https://www.uniprot.org/uniprotkb/Q13155" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35546148", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AIMP2 restricts EV71 replication by recruiting SMURF2 to promote the degradation of 3D polymerase.", "journal": "Virologica Sinica", "date": "2024-08", "authors": "Ren Junrui, Yu Lei, Zhang Qiuhan, Ren Pengyu, Cai Yumeng, Wang Xueyun, Lan Ke, Wu Shuwen", "reference": { "type": "PubMed", "id": "38945214", "url": "https://pubmed.ncbi.nlm.nih.gov/38945214" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13155-1", "protein_name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2", "gene_name": "AIMP2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9HAU4-1", "protein_name": "E3 ubiquitin-protein ligase SMURF2", "gene_name": "SMURF2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13155", "url": "https://www.uniprot.org/uniprotkb/Q13155" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38945214", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AIMP2 accumulation in brain leads to cognitive deficits and blood secretion in Parkinson's disease.", "journal": "Journal of translational medicine", "date": "2024-10-10", "authors": "Kim Heejeong, Shin Jeong-Yong, Ham Sangwoo, Kim Ji Hun, Lee Gum Hwa, Lee Nae-Eung, Kim Hee-Tae, Cho Seok Hyun, Kim Sangseong, Lee Yunjong", "reference": { "type": "PubMed", "id": "39390613", "url": "https://pubmed.ncbi.nlm.nih.gov/39390613" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13155-1", "protein_name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2", "gene_name": "AIMP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13155", "url": "https://www.uniprot.org/uniprotkb/Q13155" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39390613", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Analysis of the 5' region of PMS2 reveals heterogeneous transcripts and a novel overlapping gene.", "journal": "Genomics", "date": "1995", "authors": "Nicolaides N C, Kinzler K W, Vogelstein B", "reference": { "type": "PubMed", "id": "8666379", "url": "https://pubmed.ncbi.nlm.nih.gov/8666379" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q13155-1", "protein_name": "Aminoacyl tRNA synthase complex-interacting multifunctional protein 2", "gene_name": "AIMP2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q13155", "url": "https://www.uniprot.org/uniprotkb/Q13155" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8666379", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and fine mapping of API5L1, a novel human gene strongly related to an antiapoptotic gene.", "journal": "Cytogenet. Cell Genet.", "date": "1999", "authors": "Gianfrancesco F, Esposito T, Ciccodicola A, D'Esposito M, Mazzarella R, D'Urso M, Forabosco A", "reference": { "type": "PubMed", "id": "10393420", "url": "https://pubmed.ncbi.nlm.nih.gov/10393420" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZZ5-4", "protein_name": "Apoptosis inhibitor 5", "gene_name": "API5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZZ5", "url": "https://www.uniprot.org/uniprotkb/Q9BZZ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10393420", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AAC-11 overexpression induces invasion and protects cervical cancer cells from apoptosis.", "journal": "Laboratory investigation; a journal of technical methods and pathology", "date": "2000-04", "authors": "Kim J W, Cho H S, Kim J H, Hur S Y, Kim T E, Lee J M, Kim I K, Namkoong S E", "reference": { "type": "PubMed", "id": "10780674", "url": "https://pubmed.ncbi.nlm.nih.gov/10780674" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZZ5-4", "protein_name": "Apoptosis inhibitor 5", "gene_name": "API5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZZ5", "url": "https://www.uniprot.org/uniprotkb/Q9BZZ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10780674", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "FIF [fibroblast growth factor-2 (FGF-2)-interacting-factor], a nuclear putatively antiapoptotic factor, interacts specifically with FGF-2.", "journal": "Mol. Endocrinol.", "date": "2000", "authors": "Van den Berghe L, Laurell H, Huez I, Zanibellato C, Prats H, Bugler B", "reference": { "type": "PubMed", "id": "11075807", "url": "https://pubmed.ncbi.nlm.nih.gov/11075807" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZZ5-4", "protein_name": "Apoptosis inhibitor 5", "gene_name": "API5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZZ5", "url": "https://www.uniprot.org/uniprotkb/Q9BZZ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11075807", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression of the antiapoptosis gene, AAC-11, as a prognosis marker in non-small cell lung cancer.", "journal": "Lung Cancer", "date": "2001", "authors": "Sasaki H, Moriyama S, Yukiue H, Kobayashi Y, Nakashima Y, Kaji M, Fukai I, Kiriyama M, Yamakawa Y, Fujii Y", "reference": { "type": "PubMed", "id": "11557113", "url": "https://pubmed.ncbi.nlm.nih.gov/11557113" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZZ5-4", "protein_name": "Apoptosis inhibitor 5", "gene_name": "API5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZZ5", "url": "https://www.uniprot.org/uniprotkb/Q9BZZ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11557113", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The antiapoptotic protein Api5 and its partner, high molecular weight FGF2, are up-regulated in B cell chronic lymphoid leukemia.", "journal": "J. Leukoc. Biol.", "date": "2007", "authors": "Krejci Pavel, Pejchalova Katerina, Rosenbloom Barry E, Rosenfelt Fred P, Tran Elizabeth L, Laurell Henrik, Wilcox William R", "reference": { "type": "PubMed", "id": "17827341", "url": "https://pubmed.ncbi.nlm.nih.gov/17827341" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZZ5-4", "protein_name": "Apoptosis inhibitor 5", "gene_name": "API5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZZ5", "url": "https://www.uniprot.org/uniprotkb/Q9BZZ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17827341", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Helical repeat structure of apoptosis inhibitor 5 reveals protein-protein interaction modules.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Han BG, Kim KH, Lee SJ, Jeong KC, Cho JW, Noh KH, Kim TW, Kim SJ, Yoon HJ, Suh SW, Lee S, Lee BI", "reference": { "type": "PubMed", "id": "22334682", "url": "https://pubmed.ncbi.nlm.nih.gov/22334682" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZZ5-4", "protein_name": "Apoptosis inhibitor 5", "gene_name": "API5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZZ5", "url": "https://www.uniprot.org/uniprotkb/Q9BZZ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22334682", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DeSUMOylation of Apoptosis Inhibitor 5 by Avibirnavirus VP3 Supports Virus Replication.", "journal": "mBio", "date": "2021", "authors": "Deng T, Hu B, Wang X, Yan Y, Zhou J, Lin L, Xu Y, Zheng X, Zhou J", "reference": { "type": "PubMed", "id": "34372697", "url": "https://pubmed.ncbi.nlm.nih.gov/34372697" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZZ5-4", "protein_name": "Apoptosis inhibitor 5", "gene_name": "API5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZZ5", "url": "https://www.uniprot.org/uniprotkb/Q9BZZ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34372697", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interplay between p300 and HDAC1 regulate acetylation and stability of Api5 to regulate cell proliferation.", "journal": "Scientific reports", "date": "2021", "authors": "Sharma VK, Lahiri M", "reference": { "type": "PubMed", "id": "34385547", "url": "https://pubmed.ncbi.nlm.nih.gov/34385547" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZZ5-4", "protein_name": "Apoptosis inhibitor 5", "gene_name": "API5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZZ5", "url": "https://www.uniprot.org/uniprotkb/Q9BZZ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34385547", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Altered expression of anti-apoptotic protein Api5 affects breast tumorigenesis.", "journal": "BMC cancer", "date": "2023-04-25", "authors": "Kuttanamkuzhi Abhijith, Panda Debiprasad, Malaviya Radhika, Gaidhani Gautami, Lahiri Mayurika", "reference": { "type": "PubMed", "id": "37095445", "url": "https://pubmed.ncbi.nlm.nih.gov/37095445" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9BZZ5-4", "protein_name": "Apoptosis inhibitor 5", "gene_name": "API5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9BZZ5", "url": "https://www.uniprot.org/uniprotkb/Q9BZZ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37095445", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GB virus B disrupts RIG-I signaling by NS3/4A-mediated cleavage of the adaptor protein MAVS.", "journal": "Journal of virology", "date": "2007", "authors": "Chen Z, Benureau Y, Rijnbrand R, Yi J, Wang T, Warter L, Lanford RE, Weinman SA, Lemon SM, Martin A, Li K", "reference": { "type": "PubMed", "id": "17093192", "url": "https://pubmed.ncbi.nlm.nih.gov/17093192" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 508, "end_pos": 508, "sequence_org": "C", "sequence_mut": "A", "comment": "No cleavage by HCV and hepatitis GB virus BNS3/4A protease complex.", "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" }, { "database": "PubMed", "id": "16177806", "url": "https://pubmed.ncbi.nlm.nih.gov/16177806" }, { "database": "PubMed", "id": "16301520", "url": "https://pubmed.ncbi.nlm.nih.gov/16301520" }, { "database": "PubMed", "id": "17093192", "url": "https://pubmed.ncbi.nlm.nih.gov/17093192" } ], "uniprot_canonical_ac": "Q7Z434-1" }, { "start_pos": 508, "end_pos": 508, "sequence_org": "C", "sequence_mut": "R", "comment": "No cleavage by HCV and hepatitis GB virus BNS3/4A protease complex.", "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" }, { "database": "PubMed", "id": "16177806", "url": "https://pubmed.ncbi.nlm.nih.gov/16177806" }, { "database": "PubMed", "id": "16301520", "url": "https://pubmed.ncbi.nlm.nih.gov/16301520" }, { "database": "PubMed", "id": "17093192", "url": "https://pubmed.ncbi.nlm.nih.gov/17093192" } ], "uniprot_canonical_ac": "Q7Z434-1" } ], "record_id": "pubmed.17093192", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of innate immunity due to mitochondrial targeting of a picornaviral protease precursor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Yang Y, Liang Y, Qu L, Chen Z, Yi M, Li K, Lemon SM", "reference": { "type": "PubMed", "id": "17438296", "url": "https://pubmed.ncbi.nlm.nih.gov/17438296" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 427, "end_pos": 427, "sequence_org": "Q", "sequence_mut": "A", "comment": "No cleavage by HHAV 3ABC.", "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" }, { "database": "PubMed", "id": "17438296", "url": "https://pubmed.ncbi.nlm.nih.gov/17438296" } ], "uniprot_canonical_ac": "Q7Z434-1" }, { "start_pos": 463, "end_pos": 463, "sequence_org": "E", "sequence_mut": "A", "comment": "No effect on cleavage by HHAV 3ABC.", "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" }, { "database": "PubMed", "id": "17438296", "url": "https://pubmed.ncbi.nlm.nih.gov/17438296" } ], "uniprot_canonical_ac": "Q7Z434-1" } ], "record_id": "pubmed.17438296", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of MAVS splicing variants that interfere with RIGI/MAVS pathway signaling.", "journal": "Mol. Immunol.", "date": "2008", "authors": "Lad Sonya P, Yang Guang, Scott David A, Chao Ta-Hsiang, Correia Jean da Silva, de la Torre Juan Carlos, Li Erguang", "reference": { "type": "PubMed", "id": "18207245", "url": "https://pubmed.ncbi.nlm.nih.gov/18207245" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18207245", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Peroxisomes are signaling platforms for antiviral innate immunity.", "journal": "Cell", "date": "2010", "authors": "Dixit E, Boulant S, Zhang Y, Lee AS, Odendall C, Shum B, Hacohen N, Chen ZJ, Whelan SP, Fransen M, Nibert ML, Superti-Furga G, Kagan JC", "reference": { "type": "PubMed", "id": "20451243", "url": "https://pubmed.ncbi.nlm.nih.gov/20451243" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20451243", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hepatitis C virus core protein abrogates the DDX3 function that enhances IPS-1-mediated IFN-beta induction.", "journal": "PloS one", "date": "2010-12-08", "authors": "Oshiumi Hiroyuki, Ikeda Masanori, Matsumoto Misako, Watanabe Ayako, Takeuchi Osamu, Akira Shizuo, Kato Nobuyuki, Shimotohno Kunitada, Seya Tsukasa", "reference": { "type": "PubMed", "id": "21170385", "url": "https://pubmed.ncbi.nlm.nih.gov/21170385" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "O00571-1", "protein_name": "ATP-dependent RNA helicase DDX3X", "gene_name": "DDX3X", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.21170385", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The coxsackievirus B 3C protease cleaves MAVS and TRIF to attenuate host type I interferon and apoptotic signaling.", "journal": "PLoS pathogens", "date": "2011", "authors": "Mukherjee A, Morosky SA, Delorme-Axford E, Dybdahl-Sissoko N, Oberste MS, Wang T, Coyne CB", "reference": { "type": "PubMed", "id": "21436888", "url": "https://pubmed.ncbi.nlm.nih.gov/21436888" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IUC6-1", "protein_name": "TIR domain-containing adapter molecule 1", "gene_name": "TICAM1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 653, "end_pos": 653, "sequence_org": "Q", "sequence_mut": "A", "comment": "Complete loss of cleavage by CV3B; when associated with A-659; A-671 and A-702.", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC6", "url": "https://www.uniprot.org/uniprotkb/Q8IUC6" }, { "database": "PubMed", "id": "21436888", "url": "https://pubmed.ncbi.nlm.nih.gov/21436888" } ], "uniprot_canonical_ac": "Q8IUC6-1" }, { "start_pos": 659, "end_pos": 659, "sequence_org": "Q", "sequence_mut": "A", "comment": "Complete loss of cleavage by CV3B; when associated with A-653; A-671 and A-702.", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC6", "url": "https://www.uniprot.org/uniprotkb/Q8IUC6" }, { "database": "PubMed", "id": "21436888", "url": "https://pubmed.ncbi.nlm.nih.gov/21436888" } ], "uniprot_canonical_ac": "Q8IUC6-1" }, { "start_pos": 672, "end_pos": 672, "sequence_org": "Q", "sequence_mut": "A", "comment": "Complete loss of cleavage by CV3B; when associated with A-653; A-659 and A-702.", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC6", "url": "https://www.uniprot.org/uniprotkb/Q8IUC6" }, { "database": "PubMed", "id": "21436888", "url": "https://pubmed.ncbi.nlm.nih.gov/21436888" } ], "uniprot_canonical_ac": "Q8IUC6-1" }, { "start_pos": 702, "end_pos": 702, "sequence_org": "Q", "sequence_mut": "A", "comment": "Complete loss of cleavage by CV3B; when associated with A-653; A-659 and A-671.", "evidence": [ { "database": "UniProtKB", "id": "Q8IUC6", "url": "https://www.uniprot.org/uniprotkb/Q8IUC6" }, { "database": "PubMed", "id": "21436888", "url": "https://pubmed.ncbi.nlm.nih.gov/21436888" } ], "uniprot_canonical_ac": "Q8IUC6-1" } ], "record_id": "pubmed.21436888", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Convergent evolution of escape from hepaciviral antagonism in primates.", "journal": "PLoS Biol.", "date": "2012", "authors": "Patel Maulik R, Loo Yueh-Ming, Horner Stacy M, Gale Michael, Malik Harmit S", "reference": { "type": "PubMed", "id": "22427742", "url": "https://pubmed.ncbi.nlm.nih.gov/22427742" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q7Z434-1", "protein_name": "Mitochondrial antiviral-signaling protein", "gene_name": "MAVS", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q7Z434", "url": "https://www.uniprot.org/uniprotkb/Q7Z434" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22427742", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]