[ { "title": "A plasma membrane receptor kinase, GHR1, mediates abscisic acid- and hydrogen peroxide-regulated stomatal movement in Arabidopsis.", "journal": "Plant Cell", "date": "2012", "authors": "Hua Deping, Wang Cun, He Junna, Liao Hui, Duan Ying, Zhu Ziqiang, Guo Yan, Chen Zhizhong, Gong Zhizhong", "reference": { "type": "PubMed", "id": "22730405", "url": "https://pubmed.ncbi.nlm.nih.gov/22730405" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q940H6-1", "protein_name": "Serine/threonine-protein kinase SRK2E", "gene_name": "OST1; SRK2E", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LD83-1", "protein_name": "Guard cell S-type anion channel SLAC1", "gene_name": "SLAC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "C0LGQ9-1", "protein_name": "LRR receptor-like serine/threonine-protein kinase GHR1", "gene_name": "GHR1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04719-1", "protein_name": "Protein phosphatase 2C 77", "gene_name": "ABI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q940H6", "url": "https://www.uniprot.org/uniprotkb/Q940H6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 381, "end_pos": 381, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on the capacity to complement the water loss phenotype of the ghr1 mutant.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "22730405", "url": "https://pubmed.ncbi.nlm.nih.gov/22730405" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 57, "end_pos": 57, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes the capacity to complement the water loss phenotype of the ghr1 mutant.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "22730405", "url": "https://pubmed.ncbi.nlm.nih.gov/22730405" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 66, "end_pos": 66, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes the capacity to complement the water loss phenotype of the ghr1 mutant.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "22730405", "url": "https://pubmed.ncbi.nlm.nih.gov/22730405" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 798, "end_pos": 798, "sequence_org": "K", "sequence_mut": "E", "comment": "Loss of phosphorylation activity on SLAC1.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "22730405", "url": "https://pubmed.ncbi.nlm.nih.gov/22730405" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 798, "end_pos": 798, "sequence_org": "K", "sequence_mut": "W", "comment": "Impaired ATP binding.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "22730405", "url": "https://pubmed.ncbi.nlm.nih.gov/22730405" } ], "uniprot_canonical_ac": "C0LGQ9-1" } ], "record_id": "pubmed.22730405", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis ABA-Activated Kinase MAPKKK18 is Regulated by Protein Phosphatase 2C ABI1 and the Ubiquitin-Proteasome Pathway.", "journal": "Plant & cell physiology", "date": "2015-12", "authors": "Mitula Filip, Tajdel Malgorzata, Cie\u015bla Agata, Kasprowicz-Malu\u015bki Anna, Kulik Anna, Babula-Skowro\u0144ska Danuta, Michalak Michal, Dobrowolska Grazyna, Sadowski Jan, Ludwik\u00f3w Agnieszka", "reference": { "type": "PubMed", "id": "26443375", "url": "https://pubmed.ncbi.nlm.nih.gov/26443375" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q940H6-1", "protein_name": "Serine/threonine-protein kinase SRK2E", "gene_name": "OST1; SRK2E", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49597-1", "protein_name": "Protein phosphatase 2C 56", "gene_name": "ABI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZVP5-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 18", "gene_name": "MAPKKK18", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q940H6", "url": "https://www.uniprot.org/uniprotkb/Q940H6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 161, "end_pos": 161, "sequence_org": "T", "sequence_mut": "E", "comment": "Constitutively active kinase with normal accumulation in the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVP5", "url": "https://www.uniprot.org/uniprotkb/Q9ZVP5" }, { "database": "PubMed", "id": "26443375", "url": "https://pubmed.ncbi.nlm.nih.gov/26443375" } ], "uniprot_canonical_ac": "Q9ZVP5-1" }, { "start_pos": 32, "end_pos": 32, "sequence_org": "K", "sequence_mut": "M", "comment": "Strongly reduced kinase activity and altered subcellular localization outside the nucleus.", "evidence": [ { "database": "UniProtKB", "id": "Q9ZVP5", "url": "https://www.uniprot.org/uniprotkb/Q9ZVP5" }, { "database": "PubMed", "id": "26443375", "url": "https://pubmed.ncbi.nlm.nih.gov/26443375" } ], "uniprot_canonical_ac": "Q9ZVP5-1" } ], "record_id": "pubmed.26443375", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation of Arabidopsis MAPKKK18 by ABI1 and SnRK2, components of the ABA signaling pathway.", "journal": "Plant Signal. Behav.", "date": "2016", "authors": "Tajdel Ma\u0142gorzata, Mitu\u0142a Filip, Ludwik\u00f3w Agnieszka", "reference": { "type": "PubMed", "id": "26852793", "url": "https://pubmed.ncbi.nlm.nih.gov/26852793" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q940H6-1", "protein_name": "Serine/threonine-protein kinase SRK2E", "gene_name": "OST1; SRK2E", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZVP5-1", "protein_name": "Mitogen-activated protein kinase kinase kinase 18", "gene_name": "MAPKKK18", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q940H6", "url": "https://www.uniprot.org/uniprotkb/Q940H6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26852793", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Type one protein phosphatase 1 and its regulatory protein inhibitor 2 negatively regulate ABA signaling.", "journal": "PLoS Genet.", "date": "2016", "authors": "Hou Yueh-Ju, Zhu Yingfang, Wang Pengcheng, Zhao Yang, Xie Shaojun, Batelli Giorgia, Wang Bangshing, Duan Cheng-Guo, Wang Xingang, Xing Lu, Lei Mingguang, Yan Jun, Zhu Xiaohong, Zhu Jian-Kang", "reference": { "type": "PubMed", "id": "26943172", "url": "https://pubmed.ncbi.nlm.nih.gov/26943172" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q940H6-1", "protein_name": "Serine/threonine-protein kinase SRK2E", "gene_name": "OST1; SRK2E", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39192-1", "protein_name": "Serine/threonine-protein kinase SRK2D", "gene_name": "SNRK22; SRK2D", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80920-1", "protein_name": "Abscisic acid receptor PYL4", "gene_name": "PYL4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39193-1", "protein_name": "Serine/threonine-protein kinase SRK2I", "gene_name": "SRK2I", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q84MC7-1", "protein_name": "Abscisic acid receptor PYL9", "gene_name": "PYL9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LTK0-1", "protein_name": "Protein phosphatase inhibitor 2", "gene_name": "I-2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P43291-1", "protein_name": "Serine/threonine-protein kinase SRK2A", "gene_name": "SNRK24; SRK2A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P30366-1", "protein_name": "Serine/threonine-protein phosphatase PP1 isozyme 1", "gene_name": "TOPP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P48482-1", "protein_name": "Serine/threonine-protein phosphatase PP1 isozyme 2", "gene_name": "TOPP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FJ50-1", "protein_name": "Abscisic acid receptor PYL11", "gene_name": "PYL11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M9E9-1", "protein_name": "Serine/threonine-protein kinase SRK2C", "gene_name": "SRK2C", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q940H6", "url": "https://www.uniprot.org/uniprotkb/Q940H6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26943172", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Receptor-like Pseudokinase GHR1 Is Required for Stomatal Closure.", "journal": "The Plant cell", "date": "2018-11", "authors": "Sierla Maija, H\u00f5rak Hanna, Overmyer Kirk, Waszczak Cezary, Yarmolinsky Dmitry, Maierhofer Tobias, Vainonen Julia P, Saloj\u00e4rvi Jarkko, Denessiouk Konstantin, Laanemets Kristiina, T\u00f5ldsepp Kadri, Vahisalu Triin, Gauthier Adrien, Puukko Tuomas, Paulin Lars, Auvinen Petri, Geiger Dietmar, Hedrich Rainer, Kollist Hannes, Kangasj\u00e4rvi Jaakko", "reference": { "type": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q940H6-1", "protein_name": "Serine/threonine-protein kinase SRK2E", "gene_name": "OST1; SRK2E", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LD83-1", "protein_name": "Guard cell S-type anion channel SLAC1", "gene_name": "SLAC1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q2MHE4-1", "protein_name": "Serine/threonine/tyrosine-protein kinase HT1", "gene_name": "HT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42479-1", "protein_name": "Calcium-dependent protein kinase 3", "gene_name": "CPK3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "C0LGQ9-1", "protein_name": "LRR receptor-like serine/threonine-protein kinase GHR1", "gene_name": "GHR1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q940H6", "url": "https://www.uniprot.org/uniprotkb/Q940H6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 108, "end_pos": 108, "sequence_org": "G", "sequence_mut": "D", "comment": "In ghr1-7; apoplastic ROS-sensitive plants exhibiting increased tissue damage when exposed to ozone (O3). Slightly higher steady-state stomatal conductance.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 220, "end_pos": 220, "sequence_org": "D", "sequence_mut": "N", "comment": "In ghr1-13; apoplastic ROS-sensitive plants exhibiting increased tissue damage when exposed to ozone (O3) and slightly higher steady-state stomatal conductance; when associated with D-56.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 293, "end_pos": 293, "sequence_org": "D", "sequence_mut": "N", "comment": "In ghr1-8; apoplastic ROS-sensitive plants exhibiting increased tissue damage when exposed to ozone (O3). Slightly higher steady-state stomatal conductance.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 56, "end_pos": 56, "sequence_org": "G", "sequence_mut": "D", "comment": "In ghr1-13; apoplastic ROS-sensitive plants exhibiting increased tissue damage when exposed to ozone (O3) and slightly higher steady-state stomatal conductance; when associated with N-220.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 618, "end_pos": 618, "sequence_org": "A", "sequence_mut": "T", "comment": "In ghr1-2/rcd7 and ghr1-10; apoplastic ROS-sensitive plants exhibiting increased tissue damage when exposed to ozone (O3). Slightly higher steady-state stomatal conductance.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 637, "end_pos": 637, "sequence_org": "A", "sequence_mut": "V", "comment": "In ghr1-15; apoplastic ROS-sensitive plants exhibiting increased tissue damage when exposed to ozone (O3). Slightly higher steady-state stomatal conductance.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 63, "end_pos": 63, "sequence_org": "G", "sequence_mut": "D", "comment": "In ghr1-12; apoplastic ROS-sensitive plants exhibiting increased tissue damage when exposed to ozone (O3). Slightly higher steady-state stomatal conductance.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 680, "end_pos": 680, "sequence_org": "S", "sequence_mut": "N", "comment": "In ghr1-16; apoplastic ROS-sensitive plants exhibiting increased tissue damage when exposed to ozone (O3). Slightly higher steady-state stomatal conductance.", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "uniprot_canonical_ac": "C0LGQ9-1" } ], "phosphorylation": [ { "start_pos": 100, "end_pos": 100, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser100", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 1010, "end_pos": 1010, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr1010", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 1015, "end_pos": 1015, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser1015", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser102", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 1045, "end_pos": 1045, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr1045", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 1047, "end_pos": 1047, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Tyr1047", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 1051, "end_pos": 1051, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser1051", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 1052, "end_pos": 1052, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser1052", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 105, "end_pos": 105, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser105", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 126, "end_pos": 126, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser126", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 262, "end_pos": 262, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser262", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 278, "end_pos": 278, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser278", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 280, "end_pos": 280, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr280", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 281, "end_pos": 281, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser281", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 325, "end_pos": 325, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser325", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 406, "end_pos": 406, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Tyr406", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 410, "end_pos": 410, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser410", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 415, "end_pos": 415, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr415", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 417, "end_pos": 417, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser417", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 434, "end_pos": 434, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser434", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 613, "end_pos": 613, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser613", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 614, "end_pos": 614, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser614", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 616, "end_pos": 616, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser616", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 669, "end_pos": 669, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr669", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 675, "end_pos": 675, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr675", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 678, "end_pos": 678, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser678", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 680, "end_pos": 680, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser680", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 698, "end_pos": 698, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser698", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 699, "end_pos": 699, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser699", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 700, "end_pos": 700, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser700", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 713, "end_pos": 713, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr713", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 716, "end_pos": 716, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser716", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 718, "end_pos": 718, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser718", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 720, "end_pos": 720, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr720", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 721, "end_pos": 721, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser721", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 724, "end_pos": 724, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser724", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 760, "end_pos": 760, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser760", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 764, "end_pos": 764, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr764", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 769, "end_pos": 769, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Ser769", "uniprot_canonical_ac": "C0LGQ9-1" }, { "start_pos": 928, "end_pos": 928, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by HT1", "evidence": [ { "database": "UniProtKB", "id": "C0LGQ9", "url": "https://www.uniprot.org/uniprotkb/C0LGQ9" }, { "database": "iPTMnet", "id": "C0LGQ9", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/C0LGQ9" }, { "database": "PubMed", "id": "30361234", "url": "https://pubmed.ncbi.nlm.nih.gov/30361234" } ], "site_lbl": "Thr928", "uniprot_canonical_ac": "C0LGQ9-1" } ], "record_id": "pubmed.30361234", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 40 }, { "field": "total_sites", "count": 40 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "MAP3Kinase-dependent SnRK2-kinase activation is required for abscisic acid signal transduction and rapid osmotic stress response.", "journal": "Nature communications", "date": "2020-01-02", "authors": "Takahashi Yohei, Zhang Jingbo, Hsu Po-Kai, Ceciliato Paulo H O, Zhang Li, Dubeaux Guillaume, Munemasa Shintaro, Ge Chennan, Zhao Yunde, Hauser Felix, Schroeder Julian I", "reference": { "type": "PubMed", "id": "31896774", "url": "https://pubmed.ncbi.nlm.nih.gov/31896774" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q940H6-1", "protein_name": "Serine/threonine-protein kinase SRK2E", "gene_name": "OST1; SRK2E", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q940H6", "url": "https://www.uniprot.org/uniprotkb/Q940H6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q940H6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q940H6" }, { "database": "PubMed", "id": "18433157", "url": "https://pubmed.ncbi.nlm.nih.gov/18433157" }, { "database": "PubMed", "id": "19805022", "url": "https://pubmed.ncbi.nlm.nih.gov/19805022" }, { "database": "PubMed", "id": "23572148", "url": "https://pubmed.ncbi.nlm.nih.gov/23572148" }, { "database": "PubMed", "id": "23776212", "url": "https://pubmed.ncbi.nlm.nih.gov/23776212" }, { "database": "PubMed", "id": "30833711", "url": "https://pubmed.ncbi.nlm.nih.gov/30833711" }, { "database": "PubMed", "id": "31896774", "url": "https://pubmed.ncbi.nlm.nih.gov/31896774" }, { "database": "PubMed", "id": "33911084", "url": "https://pubmed.ncbi.nlm.nih.gov/33911084" } ], "site_lbl": "Ser171", "uniprot_canonical_ac": "Q940H6-1" } ], "record_id": "pubmed.31896774", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Initiation and amplification of SnRK2 activation in abscisic acid signaling.", "journal": "Nature communications", "date": "2021-04-28", "authors": "Lin Zhen, Li Yuan, Wang Yubei, Liu Xiaolei, Ma Liang, Zhang Zhengjing, Mu Chen, Zhang Yan, Peng Li, Xie Shaojun, Song Chun-Peng, Shi Huazhong, Zhu Jian-Kang, Wang Pengcheng", "reference": { "type": "PubMed", "id": "33911084", "url": "https://pubmed.ncbi.nlm.nih.gov/33911084" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q940H6-1", "protein_name": "Serine/threonine-protein kinase SRK2E", "gene_name": "OST1; SRK2E", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q940H6", "url": "https://www.uniprot.org/uniprotkb/Q940H6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q940H6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q940H6" }, { "database": "PubMed", "id": "18433157", "url": "https://pubmed.ncbi.nlm.nih.gov/18433157" }, { "database": "PubMed", "id": "19805022", "url": "https://pubmed.ncbi.nlm.nih.gov/19805022" }, { "database": "PubMed", "id": "23572148", "url": "https://pubmed.ncbi.nlm.nih.gov/23572148" }, { "database": "PubMed", "id": "23776212", "url": "https://pubmed.ncbi.nlm.nih.gov/23776212" }, { "database": "PubMed", "id": "30833711", "url": "https://pubmed.ncbi.nlm.nih.gov/30833711" }, { "database": "PubMed", "id": "31896774", "url": "https://pubmed.ncbi.nlm.nih.gov/31896774" }, { "database": "PubMed", "id": "33911084", "url": "https://pubmed.ncbi.nlm.nih.gov/33911084" } ], "site_lbl": "Ser171", "uniprot_canonical_ac": "Q940H6-1" }, { "start_pos": 175, "end_pos": 175, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q940H6", "url": "https://www.uniprot.org/uniprotkb/Q940H6" }, { "database": "PubMed", "id": "16766677", "url": "https://pubmed.ncbi.nlm.nih.gov/16766677" }, { "database": "iPTMnet", "id": "Q940H6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q940H6" }, { "database": "PubMed", "id": "19805022", "url": "https://pubmed.ncbi.nlm.nih.gov/19805022" }, { "database": "PubMed", "id": "20733066", "url": "https://pubmed.ncbi.nlm.nih.gov/20733066" }, { "database": "PubMed", "id": "33911084", "url": "https://pubmed.ncbi.nlm.nih.gov/33911084" } ], "site_lbl": "Ser175", "uniprot_canonical_ac": "Q940H6-1" }, { "start_pos": 179, "end_pos": 179, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q940H6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q940H6" }, { "database": "PubMed", "id": "33911084", "url": "https://pubmed.ncbi.nlm.nih.gov/33911084" } ], "site_lbl": "Thr179", "uniprot_canonical_ac": "Q940H6-1" } ], "record_id": "pubmed.33911084", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "BAK1 plays contrasting roles in regulating abscisic acid-induced stomatal closure and abscisic acid-inhibited primary root growth in Arabidopsis.", "journal": "Journal of integrative plant biology", "date": "2022-06", "authors": "Deng Jinping, Kong Lingyao, Zhu Yinhua, Pei Dan, Chen Xuexue, Wang Yu, Qi Junsheng, Song Chunpeng, Yang Shuhua, Gong Zhizhong", "reference": { "type": "PubMed", "id": "35352463", "url": "https://pubmed.ncbi.nlm.nih.gov/35352463" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q940H6-1", "protein_name": "Serine/threonine-protein kinase SRK2E", "gene_name": "OST1; SRK2E", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q940H6", "url": "https://www.uniprot.org/uniprotkb/Q940H6" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 146, "end_pos": 146, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q940H6", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q940H6" }, { "database": "PubMed", "id": "35352463", "url": "https://pubmed.ncbi.nlm.nih.gov/35352463" } ], "site_lbl": "Thr146", "uniprot_canonical_ac": "Q940H6-1" } ], "record_id": "pubmed.35352463", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "CUL4 associates with DDB1 and DET1 and its downregulation affects diverse aspects of development in Arabidopsis thaliana.", "journal": "Plant J.", "date": "2006", "authors": "Bernhardt Anne, Lechner Esther, Hano Perdita, Schade Verena, Dieterle Monika, Anders Marco, Dubin Manu Jody, Benvenuto Giovanna, Bowler Chris, Genschik Pascal, Hellmann Hanjo", "reference": { "type": "PubMed", "id": "16792691", "url": "https://pubmed.ncbi.nlm.nih.gov/16792691" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LGH4-1", "protein_name": "Cullin-4", "gene_name": "CUL4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NQ88-1", "protein_name": "Protein DAMAGED DNA-BINDING 2", "gene_name": "DDB2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16792691", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis CULLIN4 forms an E3 ubiquitin ligase with RBX1 and the CDD complex in mediating light control of development.", "journal": "Plant Cell", "date": "2006", "authors": "Chen Haodong, Shen Yunping, Tang Xiaobo, Yu Lu, Wang Jia, Guo Lan, Zhang Yu, Zhang Huiyong, Feng Suhua, Strickland Elizabeth, Zheng Ning, Deng Xing Wang", "reference": { "type": "PubMed", "id": "16844902", "url": "https://pubmed.ncbi.nlm.nih.gov/16844902" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LGH4-1", "protein_name": "Cullin-4", "gene_name": "CUL4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q940X7-1", "protein_name": "RING-box protein 1a", "gene_name": "RBX1A; RBX1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8L5Y6-1", "protein_name": "Cullin-associated NEDD8-dissociated protein 1", "gene_name": "CAND1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16844902", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DDB2, DDB1A and DET1 exhibit complex interactions during Arabidopsis development.", "journal": "Genetics", "date": "2007", "authors": "Al Khateeb Wesam M, Schroeder Dana F", "reference": { "type": "PubMed", "id": "17409070", "url": "https://pubmed.ncbi.nlm.nih.gov/17409070" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NQ88-1", "protein_name": "Protein DAMAGED DNA-BINDING 2", "gene_name": "DDB2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17409070", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Regulation and role of Arabidopsis CUL4-DDB1A-DDB2 in maintaining genome integrity upon UV stress.", "journal": "PLoS genetics", "date": "2008-06-13", "authors": "Molinier Jean, Lechner Esther, Dumbliauskas Eva, Genschik Pascal", "reference": { "type": "PubMed", "id": "18551167", "url": "https://pubmed.ncbi.nlm.nih.gov/18551167" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NQ88-1", "protein_name": "Protein DAMAGED DNA-BINDING 2", "gene_name": "DDB2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 343, "end_pos": 343, "sequence_org": "R", "sequence_mut": "H", "comment": "Does not impair interaction with DDB1A.", "evidence": [ { "database": "UniProtKB", "id": "Q6NQ88", "url": "https://www.uniprot.org/uniprotkb/Q6NQ88" }, { "database": "PubMed", "id": "18551167", "url": "https://pubmed.ncbi.nlm.nih.gov/18551167" } ], "uniprot_canonical_ac": "Q6NQ88-1" } ], "record_id": "pubmed.18551167", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The DDB1a interacting proteins ATCSA-1 and DDB2 are critical factors for UV-B tolerance and genomic integrity in Arabidopsis thaliana.", "journal": "Plant J.", "date": "2010", "authors": "Biedermann Sascha, Hellmann Hanjo", "reference": { "type": "PubMed", "id": "20128879", "url": "https://pubmed.ncbi.nlm.nih.gov/20128879" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93ZG3-1", "protein_name": "WD repeat-containing protein ATCSA-1", "gene_name": "ATCSA-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NQ88-1", "protein_name": "Protein DAMAGED DNA-BINDING 2", "gene_name": "DDB2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20128879", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DWA3, an Arabidopsis DWD protein, acts as a negative regulator in ABA signal transduction.", "journal": "Plant Sci.", "date": "2011", "authors": "Lee Jae-Hoon, Terzaghi William, Deng Xing Wang", "reference": { "type": "PubMed", "id": "21421380", "url": "https://pubmed.ncbi.nlm.nih.gov/21421380" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O49552-1", "protein_name": "DNA damage-binding protein 1b", "gene_name": "DDB1B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4HTH8-1", "protein_name": "Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.2", "gene_name": "KTN80.2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21421380", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis WD repeat domain55 Interacts with DNA damaged binding protein1 and is required for apical patterning in the embryo.", "journal": "Plant Cell", "date": "2012", "authors": "Bjerkan Katrine N, Jung-Rom\u00e9o Sabrina, J\u00fcrgens Gerd, Genschik Pascal, Grini Paul E", "reference": { "type": "PubMed", "id": "22447688", "url": "https://pubmed.ncbi.nlm.nih.gov/22447688" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80775-1", "protein_name": "WD repeat-containing protein 55", "gene_name": "WDR55", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22447688", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DWD HYPERSENSITIVE TO UV-B 1 is negatively involved in UV-B mediated cellular responses in Arabidopsis.", "journal": "Plant Mol. Biol.", "date": "2014", "authors": "Kim Sang-Hoon, Kim Hani, Seo Kyoung-In, Kim Soon-Hee, Chung Sunglan, Huang Xi, Yang Panyu, Deng Xing Wang, Lee Jae-Hoon", "reference": { "type": "PubMed", "id": "25193399", "url": "https://pubmed.ncbi.nlm.nih.gov/25193399" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GYY7-1", "protein_name": "Protein DWD HYPERSENSITIVE TO UV-B 1", "gene_name": "DHU1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25193399", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of a novel DWD protein that participates in heat stress response in Arabidopsis.", "journal": "Mol. Cells", "date": "2014", "authors": "Kim Soon-Hee, Lee Joon-Hyun, Seo Kyoung-In, Ryu Boyeong, Sung Yongju, Chung Taijoon, Deng Xing Wang, Lee Jae-Hoon", "reference": { "type": "PubMed", "id": "25358503", "url": "https://pubmed.ncbi.nlm.nih.gov/25358503" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P27323-1", "protein_name": "Heat shock protein 90-1", "gene_name": "HSP90-1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZUN8-1", "protein_name": "Protein HEAT STRESS TOLERANT DWD 1", "gene_name": "HTD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O49552-1", "protein_name": "DNA damage-binding protein 1b", "gene_name": "DDB1B", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25358503", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "ASG2 is a farnesylated DWD protein that acts as ABA negative regulator in Arabidopsis.", "journal": "Plant Cell Environ.", "date": "2016", "authors": "Dutilleul Christelle, Ribeiro Iliana, Blanc Nathalie, Nezames Cynthia D, Deng Xing Wang, Zglobicki Piotr, Palacio Barrera Ana Mar\u00eda, Atehort\u00f9a Lucia, Courtois Martine, Labas Val\u00e9rie, Giglioli-Guivarc'h Nathalie, Ducos Eric", "reference": { "type": "PubMed", "id": "26147561", "url": "https://pubmed.ncbi.nlm.nih.gov/26147561" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9M0V3-1", "protein_name": "DNA damage-binding protein 1a", "gene_name": "DDB1A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94BQ3-1", "protein_name": "Protein ALTERED SEED GERMINATION 2", "gene_name": "ASG2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38920-1", "protein_name": "Protein farnesyltransferase subunit beta", "gene_name": "ERA1; FTB", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9M0V3", "url": "https://www.uniprot.org/uniprotkb/Q9M0V3" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 245, "end_pos": 257, "sequence_org": "RRMLPPLASSRKR", "sequence_mut": "", "comment": "Impaired nuclear localization.", "evidence": [ { "database": "UniProtKB", "id": "Q94BQ3", "url": "https://www.uniprot.org/uniprotkb/Q94BQ3" }, { "database": "PubMed", "id": "26147561", "url": "https://pubmed.ncbi.nlm.nih.gov/26147561" } ], "uniprot_canonical_ac": "Q94BQ3-1" }, { "start_pos": 754, "end_pos": 754, "sequence_org": "C", "sequence_mut": "S", "comment": "Impaired farnesylation leading to a constitutive localizes in both cytosol and nucleus, as well as reduced interaction with HDA9.", "evidence": [ { "database": "UniProtKB", "id": "Q94BQ3", "url": "https://www.uniprot.org/uniprotkb/Q94BQ3" }, { "database": "PubMed", "id": "28663238", "url": "https://pubmed.ncbi.nlm.nih.gov/28663238" }, { "database": "PubMed", "id": "26147561", "url": "https://pubmed.ncbi.nlm.nih.gov/26147561" } ], "uniprot_canonical_ac": "Q94BQ3-1" } ], "record_id": "pubmed.26147561", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genetics of Aux/IAA and ARF action in plant growth and development.", "journal": "Plant molecular biology", "date": "2002", "authors": "Liscum E, Reed J W", "reference": { "type": "PubMed", "id": "12036262", "url": "https://pubmed.ncbi.nlm.nih.gov/12036262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O24410-1", "protein_name": "Auxin-responsive protein IAA20", "gene_name": "IAA20", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38830-1", "protein_name": "Auxin-responsive protein IAA12", "gene_name": "IAA12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38826-1", "protein_name": "Auxin-responsive protein IAA8", "gene_name": "IAA8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38827-1", "protein_name": "Auxin-responsive protein IAA9", "gene_name": "IAA9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24407-1", "protein_name": "Auxin-responsive protein IAA16", "gene_name": "IAA16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24408-1", "protein_name": "Auxin-responsive protein IAA18", "gene_name": "IAA18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24409-1", "protein_name": "Auxin-responsive protein IAA19", "gene_name": "IAA19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P33077-1", "protein_name": "Auxin-responsive protein IAA4", "gene_name": "IAA4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P33078-1", "protein_name": "Auxin-responsive protein IAA5", "gene_name": "IAA5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49677-1", "protein_name": "Auxin-responsive protein IAA1", "gene_name": "IAA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93830-1", "protein_name": "Auxin-responsive protein IAA17", "gene_name": "IAA17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38824-1", "protein_name": "Auxin-responsive protein IAA6", "gene_name": "IAA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38828-1", "protein_name": "Auxin-responsive protein IAA10", "gene_name": "IAA10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38831-1", "protein_name": "Auxin-responsive protein IAA13", "gene_name": "IAA13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H174-1", "protein_name": "Auxin-responsive protein IAA31", "gene_name": "IAA31", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RYC6-1", "protein_name": "Auxin-responsive protein IAA32", "gene_name": "IAA32", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XFM0-1", "protein_name": "Auxin-responsive protein IAA28", "gene_name": "IAA28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSY8-1", "protein_name": "Auxin-responsive protein IAA27", "gene_name": "IAA27", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C966-1", "protein_name": "Auxin-responsive protein IAA15", "gene_name": "IAA15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38825-1", "protein_name": "Auxin-responsive protein IAA7", "gene_name": "IAA7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93WC4-1", "protein_name": "Auxin-responsive protein IAA29", "gene_name": "IAA29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38832-1", "protein_name": "Auxin-responsive protein IAA14", "gene_name": "IAA14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FKM7-1", "protein_name": "Auxin-responsive protein IAA33", "gene_name": "IAA33", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M1R4-1", "protein_name": "Auxin-responsive protein IAA30", "gene_name": "IAA30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LAL2-1", "protein_name": "Auxin-responsive protein IAA26", "gene_name": "IAA26; PAP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49678-1", "protein_name": "Auxin-responsive protein IAA2", "gene_name": "IAA2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38822-1", "protein_name": "Auxin-responsive protein IAA3", "gene_name": "IAA3; SHY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5X0-1", "protein_name": "Auxin-responsive protein IAA34", "gene_name": "IAA34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38829-1", "protein_name": "Auxin-responsive protein IAA11", "gene_name": "IAA11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O24410", "url": "https://www.uniprot.org/uniprotkb/O24410" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12036262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 29 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Aux/IAA proteins contain a potent transcriptional repression domain.", "journal": "Plant Cell", "date": "2004", "authors": "Tiwari Shiv B, Hagen Gretchen, Guilfoyle Tom J", "reference": { "type": "PubMed", "id": "14742873", "url": "https://pubmed.ncbi.nlm.nih.gov/14742873" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O24410-1", "protein_name": "Auxin-responsive protein IAA20", "gene_name": "IAA20", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38830-1", "protein_name": "Auxin-responsive protein IAA12", "gene_name": "IAA12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38826-1", "protein_name": "Auxin-responsive protein IAA8", "gene_name": "IAA8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38827-1", "protein_name": "Auxin-responsive protein IAA9", "gene_name": "IAA9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24407-1", "protein_name": "Auxin-responsive protein IAA16", "gene_name": "IAA16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24408-1", "protein_name": "Auxin-responsive protein IAA18", "gene_name": "IAA18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24409-1", "protein_name": "Auxin-responsive protein IAA19", "gene_name": "IAA19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P33077-1", "protein_name": "Auxin-responsive protein IAA4", "gene_name": "IAA4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P33078-1", "protein_name": "Auxin-responsive protein IAA5", "gene_name": "IAA5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49677-1", "protein_name": "Auxin-responsive protein IAA1", "gene_name": "IAA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93830-1", "protein_name": "Auxin-responsive protein IAA17", "gene_name": "IAA17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38824-1", "protein_name": "Auxin-responsive protein IAA6", "gene_name": "IAA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38828-1", "protein_name": "Auxin-responsive protein IAA10", "gene_name": "IAA10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38831-1", "protein_name": "Auxin-responsive protein IAA13", "gene_name": "IAA13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H174-1", "protein_name": "Auxin-responsive protein IAA31", "gene_name": "IAA31", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RYC6-1", "protein_name": "Auxin-responsive protein IAA32", "gene_name": "IAA32", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XFM0-1", "protein_name": "Auxin-responsive protein IAA28", "gene_name": "IAA28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSY8-1", "protein_name": "Auxin-responsive protein IAA27", "gene_name": "IAA27", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C966-1", "protein_name": "Auxin-responsive protein IAA15", "gene_name": "IAA15", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38825-1", "protein_name": "Auxin-responsive protein IAA7", "gene_name": "IAA7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93WC4-1", "protein_name": "Auxin-responsive protein IAA29", "gene_name": "IAA29", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38832-1", "protein_name": "Auxin-responsive protein IAA14", "gene_name": "IAA14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M1R4-1", "protein_name": "Auxin-responsive protein IAA30", "gene_name": "IAA30", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LAL2-1", "protein_name": "Auxin-responsive protein IAA26", "gene_name": "IAA26; PAP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49678-1", "protein_name": "Auxin-responsive protein IAA2", "gene_name": "IAA2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38822-1", "protein_name": "Auxin-responsive protein IAA3", "gene_name": "IAA3; SHY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C5X0-1", "protein_name": "Auxin-responsive protein IAA34", "gene_name": "IAA34", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38829-1", "protein_name": "Auxin-responsive protein IAA11", "gene_name": "IAA11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O24410", "url": "https://www.uniprot.org/uniprotkb/O24410" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14742873", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 28 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Protein-protein interactions among the Aux/IAA proteins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Kim J, Harter K, Theologis A", "reference": { "type": "PubMed", "id": "9342315", "url": "https://pubmed.ncbi.nlm.nih.gov/9342315" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O24410-1", "protein_name": "Auxin-responsive protein IAA20", "gene_name": "IAA20", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24407-1", "protein_name": "Auxin-responsive protein IAA16", "gene_name": "IAA16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24408-1", "protein_name": "Auxin-responsive protein IAA18", "gene_name": "IAA18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24409-1", "protein_name": "Auxin-responsive protein IAA19", "gene_name": "IAA19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49677-1", "protein_name": "Auxin-responsive protein IAA1", "gene_name": "IAA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93830-1", "protein_name": "Auxin-responsive protein IAA17", "gene_name": "IAA17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93024-1", "protein_name": "Auxin response factor 5", "gene_name": "ARF5; MP", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93022-1", "protein_name": "Auxin response factor 7", "gene_name": "ARF7; NPH4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RYC8-1", "protein_name": "Auxin response factor 19", "gene_name": "ARF19", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49678-1", "protein_name": "Auxin-responsive protein IAA2", "gene_name": "IAA2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O24410", "url": "https://www.uniprot.org/uniprotkb/O24410" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9342315", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 10 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Disruption of an RNA helicase/RNAse III gene in Arabidopsis causes unregulated cell division in floral meristems.", "journal": "Development (Cambridge, England)", "date": "1999-12", "authors": "Jacobsen S E, Running M P, Meyerowitz E M", "reference": { "type": "PubMed", "id": "10556049", "url": "https://pubmed.ncbi.nlm.nih.gov/10556049" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 1837, "end_pos": 1843, "sequence_org": "NDICLRK", "sequence_mut": "IAEIDPG", "comment": "In caf-1; converts the floral meristem to an indeterminate state.", "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" }, { "database": "PubMed", "id": "10556049", "url": "https://pubmed.ncbi.nlm.nih.gov/10556049" } ], "uniprot_canonical_ac": "Q9SP32-1" }, { "start_pos": 1844, "end_pos": 1909, "sequence_org": "NWPMPSYRCVKEGGPAHAKRFTFGVRVNTSDRGWTDECIGEPMPSVKKAKDSAAVLLLELLNKTFS", "sequence_mut": "", "comment": "In caf-1; converts the floral meristem to an indeterminate state.", "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" }, { "database": "PubMed", "id": "10556049", "url": "https://pubmed.ncbi.nlm.nih.gov/10556049" } ], "uniprot_canonical_ac": "Q9SP32-1" } ], "record_id": "pubmed.10556049", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "SHORT INTEGUMENTS1/SUSPENSOR1/CARPEL FACTORY, a Dicer homolog, is a maternal effect gene required for embryo development in Arabidopsis.", "journal": "Plant physiology", "date": "2002-10", "authors": "Golden Teresa A, Schauer Stephen E, Lang Jean D, Pien St\u00e9phane, Mushegian Arcady R, Grossniklaus Ueli, Meinke David W, Ray Animesh", "reference": { "type": "PubMed", "id": "12376646", "url": "https://pubmed.ncbi.nlm.nih.gov/12376646" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 415, "end_pos": 415, "sequence_org": "P", "sequence_mut": "S", "comment": "In sin1-1; impaired reproductive development.", "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" }, { "database": "PubMed", "id": "12376646", "url": "https://pubmed.ncbi.nlm.nih.gov/12376646" } ], "uniprot_canonical_ac": "Q9SP32-1" }, { "start_pos": 431, "end_pos": 431, "sequence_org": "I", "sequence_mut": "K", "comment": "In sin1-2; impaired reproductive development.", "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" }, { "database": "PubMed", "id": "12376646", "url": "https://pubmed.ncbi.nlm.nih.gov/12376646" } ], "uniprot_canonical_ac": "Q9SP32-1" } ], "record_id": "pubmed.12376646", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Specific interactions between Dicer-like proteins and HYL1/DRB-family dsRNA-binding proteins in Arabidopsis thaliana.", "journal": "Plant molecular biology", "date": "2005-01", "authors": "Hiraguri Akihiro, Itoh Riku, Kondo Naoko, Nomura Yasuko, Aizawa Daisuke, Murai Yusuke, Koiwa Hisashi, Seki Motoaki, Shinozaki Kazuo, Fukuhara Toshiyuki", "reference": { "type": "PubMed", "id": "15821876", "url": "https://pubmed.ncbi.nlm.nih.gov/15821876" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8GY79-1", "protein_name": "Double-stranded RNA-binding protein 5", "gene_name": "DRB5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SKN2-1", "protein_name": "Double-stranded RNA-binding protein 2", "gene_name": "DRB2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1D4-1", "protein_name": "Double-stranded RNA-binding protein 4", "gene_name": "DBR4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P84634-1", "protein_name": "Dicer-like protein 4", "gene_name": "DCL4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04492-1", "protein_name": "Double-stranded RNA-binding protein 1", "gene_name": "DRB1; HYL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LXW7-1", "protein_name": "Endoribonuclease Dicer homolog 3", "gene_name": "DCL3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15821876", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Partially redundant functions of Arabidopsis DICER-like enzymes and a role for DCL4 in producing trans-acting siRNAs.", "journal": "Current biology : CB", "date": "2005-08-23", "authors": "Gasciolli Virginie, Mallory Allison C, Bartel David P, Vaucheret Herv\u00e9", "reference": { "type": "PubMed", "id": "16040244", "url": "https://pubmed.ncbi.nlm.nih.gov/16040244" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P84634-1", "protein_name": "Dicer-like protein 4", "gene_name": "DCL4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3EBC8-1", "protein_name": "Endoribonuclease Dicer homolog 2", "gene_name": "DCL2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LXW7-1", "protein_name": "Endoribonuclease Dicer homolog 3", "gene_name": "DCL3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16040244", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The interaction between DCL1 and HYL1 is important for efficient and precise processing of pri-miRNA in plant microRNA biogenesis.", "journal": "RNA (New York, N.Y.)", "date": "2006-02", "authors": "Kurihara Yukio, Takashi Yuasa, Watanabe Yuichiro", "reference": { "type": "PubMed", "id": "16428603", "url": "https://pubmed.ncbi.nlm.nih.gov/16428603" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04492-1", "protein_name": "Double-stranded RNA-binding protein 1", "gene_name": "DRB1; HYL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16428603", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of nuclear dicing bodies containing proteins for microRNA biogenesis in living Arabidopsis plants.", "journal": "Curr. Biol.", "date": "2007", "authors": "Fang Yuda, Spector David L", "reference": { "type": "PubMed", "id": "17442570", "url": "https://pubmed.ncbi.nlm.nih.gov/17442570" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZVD0-1", "protein_name": "Serrate RNA effector molecule", "gene_name": "SE", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04492-1", "protein_name": "Double-stranded RNA-binding protein 1", "gene_name": "DRB1; HYL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17442570", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DICER-LIKE 1 and DICER-LIKE 3 redundantly act to promote flowering via repression of FLOWERING LOCUS C in Arabidopsis thaliana.", "journal": "Genetics", "date": "2007-06", "authors": "Schmitz Robert J, Hong Lewis, Fitzpatrick Kathleen E, Amasino Richard M", "reference": { "type": "PubMed", "id": "17579240", "url": "https://pubmed.ncbi.nlm.nih.gov/17579240" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LXW7-1", "protein_name": "Endoribonuclease Dicer homolog 3", "gene_name": "DCL3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17579240", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel class of bacteria-induced small RNAs in Arabidopsis.", "journal": "Genes & development", "date": "2007-12-01", "authors": "Katiyar-Agarwal Surekha, Gao Shang, Vivian-Smith Adam, Jin Hailing", "reference": { "type": "PubMed", "id": "18003861", "url": "https://pubmed.ncbi.nlm.nih.gov/18003861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VZE7-1", "protein_name": "RAP domain-containing protein, chloroplastic", "gene_name": "RAP", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C793-1", "protein_name": "Protein argonaute 7", "gene_name": "AGO7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P84634-1", "protein_name": "Dicer-like protein 4", "gene_name": "DCL4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18003861", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The RNA-binding proteins HYL1 and SE promote accurate in vitro processing of pri-miRNA by DCL1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008-07-22", "authors": "Dong Zhicheng, Han Meng-Hsuan, Fedoroff Nina", "reference": { "type": "PubMed", "id": "18632569", "url": "https://pubmed.ncbi.nlm.nih.gov/18632569" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZVD0-1", "protein_name": "Serrate RNA effector molecule", "gene_name": "SE", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04492-1", "protein_name": "Double-stranded RNA-binding protein 1", "gene_name": "DRB1; HYL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18632569", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis DRB4, AGO1, AGO7, and RDR6 participate in a DCL4-initiated antiviral RNA silencing pathway negatively regulated by DCL1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008-09-23", "authors": "Qu Feng, Ye Xiaohong, Morris T Jack", "reference": { "type": "PubMed", "id": "18799732", "url": "https://pubmed.ncbi.nlm.nih.gov/18799732" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04379-1", "protein_name": "Protein argonaute 1", "gene_name": "AGO1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H1D4-1", "protein_name": "Double-stranded RNA-binding protein 4", "gene_name": "DBR4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C793-1", "protein_name": "Protein argonaute 7", "gene_name": "AGO7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P84634-1", "protein_name": "Dicer-like protein 4", "gene_name": "DCL4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18799732", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A dominant mutation in DCL1 suppresses the hyl1 mutant phenotype by promoting the processing of miRNA.", "journal": "RNA (New York, N.Y.)", "date": "2009-03", "authors": "Tagami Yuko, Motose Hiroyasu, Watanabe Yuichiro", "reference": { "type": "PubMed", "id": "19155326", "url": "https://pubmed.ncbi.nlm.nih.gov/19155326" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SP32-1", "protein_name": "Endoribonuclease Dicer homolog 1", "gene_name": "DCL1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 395, "end_pos": 395, "sequence_org": "E", "sequence_mut": "K", "comment": "In dcl1-13; early-flowering and decreased number of leaves. Suppresses hyl1 mutant phenotype.", "evidence": [ { "database": "UniProtKB", "id": "Q9SP32", "url": "https://www.uniprot.org/uniprotkb/Q9SP32" }, { "database": "PubMed", "id": "19155326", "url": "https://pubmed.ncbi.nlm.nih.gov/19155326" } ], "uniprot_canonical_ac": "Q9SP32-1" } ], "record_id": "pubmed.19155326", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Specific ER quality control components required for biogenesis of the plant innate immune receptor EFR.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009-09-15", "authors": "Li Jing, Zhao-Hui Chu, Batoux Martine, Nekrasov Vladimir, Roux Milena, Chinchilla Delphine, Zipfel Cyril, Jones Jonathan D G", "reference": { "type": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04153-1", "protein_name": "Calreticulin-3", "gene_name": "CRT3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8VWI1-1", "protein_name": "ER lumen protein-retaining receptor B", "gene_name": "ERD2B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WL80-1", "protein_name": "UDP-glucose:glycoprotein glucosyltransferase", "gene_name": "EBS1; UGGT", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "C0LGT6-1", "protein_name": "LRR receptor-like serine/threonine-protein kinase EFR", "gene_name": "EFR", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 115, "end_pos": 115, "sequence_org": "G", "sequence_mut": "D", "comment": "In crt3-3; loss of response to the PAMP elf18, but no effect on the response to PAMP flg22.", "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" }, { "database": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" } ], "uniprot_canonical_ac": "O04153-1" }, { "start_pos": 142, "end_pos": 142, "sequence_org": "G", "sequence_mut": "E", "comment": "In crt3-4; loss of response to the PAMP elf18, but no effect on the response to PAMP flg22.", "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" }, { "database": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" } ], "uniprot_canonical_ac": "O04153-1" }, { "start_pos": 147, "end_pos": 147, "sequence_org": "G", "sequence_mut": "E", "comment": "In crt3-5; loss of response to the PAMP elf18, but no effect on the response to PAMP flg22.", "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" }, { "database": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" } ], "uniprot_canonical_ac": "O04153-1" }, { "start_pos": 179, "end_pos": 179, "sequence_org": "H", "sequence_mut": "Y", "comment": "In crt3-6; loss of response to the PAMP elf18, but no effect on the response to PAMP flg22.", "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" }, { "database": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" } ], "uniprot_canonical_ac": "O04153-1" }, { "start_pos": 203, "end_pos": 203, "sequence_org": "G", "sequence_mut": "D", "comment": "In crt3-7; loss of response to the PAMP elf18, but no effect on the response to PAMP flg22.", "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" }, { "database": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" } ], "uniprot_canonical_ac": "O04153-1" }, { "start_pos": 293, "end_pos": 293, "sequence_org": "P", "sequence_mut": "S", "comment": "In crt3-10; loss of response to the PAMP elf18, but no effect on the response to PAMP flg22.", "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" }, { "database": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" } ], "uniprot_canonical_ac": "O04153-1" }, { "start_pos": 161, "end_pos": 161, "sequence_org": "R", "sequence_mut": "H", "comment": "In erd2b-4; strongly reduced response to the PAMP elf18, but no effect on the response to PAMP flg22.", "evidence": [ { "database": "UniProtKB", "id": "Q8VWI1", "url": "https://www.uniprot.org/uniprotkb/Q8VWI1" }, { "database": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" } ], "uniprot_canonical_ac": "Q8VWI1-1" }, { "start_pos": 186, "end_pos": 186, "sequence_org": "A", "sequence_mut": "V", "comment": "In erd2b-5; strongly reduced response to the PAMP elf18, but no effect on the response to PAMP flg22.", "evidence": [ { "database": "UniProtKB", "id": "Q8VWI1", "url": "https://www.uniprot.org/uniprotkb/Q8VWI1" }, { "database": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" } ], "uniprot_canonical_ac": "Q8VWI1-1" }, { "start_pos": 8, "end_pos": 8, "sequence_org": "G", "sequence_mut": "D", "comment": "In erd2b-1; strongly reduced response to the PAMP elf18, but no effect on the response to PAMP flg22.", "evidence": [ { "database": "UniProtKB", "id": "Q8VWI1", "url": "https://www.uniprot.org/uniprotkb/Q8VWI1" }, { "database": "PubMed", "id": "19717464", "url": "https://pubmed.ncbi.nlm.nih.gov/19717464" } ], "uniprot_canonical_ac": "Q8VWI1-1" } ], "record_id": "pubmed.19717464", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Receptor quality control in the endoplasmic reticulum for plant innate immunity.", "journal": "The EMBO journal", "date": "2009-11-04", "authors": "Saijo Yusuke, Tintor Nico, Lu Xunli, Rauf Philipp, Pajerowska-Mukhtar Karolina, H\u00e4weker Heidrun, Dong Xinnian, Robatzek Silke, Schulze-Lefert Paul", "reference": { "type": "PubMed", "id": "19763087", "url": "https://pubmed.ncbi.nlm.nih.gov/19763087" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04153-1", "protein_name": "Calreticulin-3", "gene_name": "CRT3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93ZY3-1", "protein_name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A", "gene_name": "STT3A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q0WL80-1", "protein_name": "UDP-glucose:glycoprotein glucosyltransferase", "gene_name": "EBS1; UGGT", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "C0LGT6-1", "protein_name": "LRR receptor-like serine/threonine-protein kinase EFR", "gene_name": "EFR", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 244, "end_pos": 244, "sequence_org": "G", "sequence_mut": "S", "comment": "In psl1-3; no effect on EFR accumulation, but decreased response to the PAMP elf18.", "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" }, { "database": "PubMed", "id": "19763087", "url": "https://pubmed.ncbi.nlm.nih.gov/19763087" } ], "uniprot_canonical_ac": "O04153-1" }, { "start_pos": 335, "end_pos": 335, "sequence_org": "S", "sequence_mut": "L", "comment": "In psl1-4; loss of EFR accumulation and loss of response to the PAMP elf18.", "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" }, { "database": "PubMed", "id": "19763087", "url": "https://pubmed.ncbi.nlm.nih.gov/19763087" } ], "uniprot_canonical_ac": "O04153-1" }, { "start_pos": 67, "end_pos": 67, "sequence_org": "P", "sequence_mut": "L", "comment": "In psl1-1; no effect on EFR accumulation, but decreased response to the PAMP elf18.", "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" }, { "database": "PubMed", "id": "19763087", "url": "https://pubmed.ncbi.nlm.nih.gov/19763087" } ], "uniprot_canonical_ac": "O04153-1" }, { "start_pos": 1497, "end_pos": 1497, "sequence_org": "D", "sequence_mut": "N", "comment": "In psl2-1;; loss of response to the PAMP elf18.", "evidence": [ { "database": "UniProtKB", "id": "Q0WL80", "url": "https://www.uniprot.org/uniprotkb/Q0WL80" }, { "database": "PubMed", "id": "19763087", "url": "https://pubmed.ncbi.nlm.nih.gov/19763087" } ], "uniprot_canonical_ac": "Q0WL80-1" }, { "start_pos": 306, "end_pos": 306, "sequence_org": "E", "sequence_mut": "K", "comment": "In psl2-2; loss of response to the PAMP elf18.", "evidence": [ { "database": "UniProtKB", "id": "Q0WL80", "url": "https://www.uniprot.org/uniprotkb/Q0WL80" }, { "database": "PubMed", "id": "19763087", "url": "https://pubmed.ncbi.nlm.nih.gov/19763087" } ], "uniprot_canonical_ac": "Q0WL80-1" } ], "record_id": "pubmed.19763087", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Abundant accumulation of the calcium-binding molecular chaperone calreticulin in specific floral tissues of Arabidopsis thaliana.", "journal": "Plant Physiol.", "date": "1997", "authors": "Nelson D E, Glaunsinger B, Bohnert H J", "reference": { "type": "PubMed", "id": "9159940", "url": "https://pubmed.ncbi.nlm.nih.gov/9159940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04153-1", "protein_name": "Calreticulin-3", "gene_name": "CRT3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O04151-1", "protein_name": "Calreticulin-1", "gene_name": "CRT1A; CRT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38858-1", "protein_name": "Calreticulin-2", "gene_name": "CRT2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04153", "url": "https://www.uniprot.org/uniprotkb/O04153" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9159940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis BODENLOS gene encodes an auxin response protein inhibiting MONOPTEROS-mediated embryo patterning.", "journal": "Genes Dev.", "date": "2002", "authors": "Hamann Thorsten, Benkova Eva, B\u00e4urle Isabel, Kientz Marika, J\u00fcrgens Gerd", "reference": { "type": "PubMed", "id": "12101120", "url": "https://pubmed.ncbi.nlm.nih.gov/12101120" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38830-1", "protein_name": "Auxin-responsive protein IAA12", "gene_name": "IAA12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93024-1", "protein_name": "Auxin response factor 5", "gene_name": "ARF5; MP", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38830", "url": "https://www.uniprot.org/uniprotkb/Q38830" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12101120", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TOPLESS mediates auxin-dependent transcriptional repression during Arabidopsis embryogenesis.", "journal": "Science (New York, N.Y.)", "date": "2008-03-07", "authors": "Szemenyei Heidi, Hannon Mike, Long Jeff A", "reference": { "type": "PubMed", "id": "18258861", "url": "https://pubmed.ncbi.nlm.nih.gov/18258861" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38830-1", "protein_name": "Auxin-responsive protein IAA12", "gene_name": "IAA12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38826-1", "protein_name": "Auxin-responsive protein IAA8", "gene_name": "IAA8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38827-1", "protein_name": "Auxin-responsive protein IAA9", "gene_name": "IAA9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O24408-1", "protein_name": "Auxin-responsive protein IAA18", "gene_name": "IAA18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P33077-1", "protein_name": "Auxin-responsive protein IAA4", "gene_name": "IAA4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49677-1", "protein_name": "Auxin-responsive protein IAA1", "gene_name": "IAA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P93830-1", "protein_name": "Auxin-responsive protein IAA17", "gene_name": "IAA17", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38824-1", "protein_name": "Auxin-responsive protein IAA6", "gene_name": "IAA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38831-1", "protein_name": "Auxin-responsive protein IAA13", "gene_name": "IAA13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94AI7-1", "protein_name": "Protein TOPLESS", "gene_name": "TPL", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9XFM0-1", "protein_name": "Auxin-responsive protein IAA28", "gene_name": "IAA28", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ZSY8-1", "protein_name": "Auxin-responsive protein IAA27", "gene_name": "IAA27", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38832-1", "protein_name": "Auxin-responsive protein IAA14", "gene_name": "IAA14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8LAL2-1", "protein_name": "Auxin-responsive protein IAA26", "gene_name": "IAA26; PAP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49678-1", "protein_name": "Auxin-responsive protein IAA2", "gene_name": "IAA2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38822-1", "protein_name": "Auxin-responsive protein IAA3", "gene_name": "IAA3; SHY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38829-1", "protein_name": "Auxin-responsive protein IAA11", "gene_name": "IAA11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38830", "url": "https://www.uniprot.org/uniprotkb/Q38830" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 20, "end_pos": 20, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased interaction with TPL; when associated with A-22 and A-24.", "evidence": [ { "database": "UniProtKB", "id": "Q38830", "url": "https://www.uniprot.org/uniprotkb/Q38830" }, { "database": "PubMed", "id": "18258861", "url": "https://pubmed.ncbi.nlm.nih.gov/18258861" } ], "uniprot_canonical_ac": "Q38830-1" }, { "start_pos": 22, "end_pos": 22, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased interaction with TPL; when associated with A-20 and A-24.", "evidence": [ { "database": "UniProtKB", "id": "Q38830", "url": "https://www.uniprot.org/uniprotkb/Q38830" }, { "database": "PubMed", "id": "18258861", "url": "https://pubmed.ncbi.nlm.nih.gov/18258861" } ], "uniprot_canonical_ac": "Q38830-1" }, { "start_pos": 24, "end_pos": 24, "sequence_org": "L", "sequence_mut": "A", "comment": "Decreased interaction with TPL; when associated with A-20 and A-22.", "evidence": [ { "database": "UniProtKB", "id": "Q38830", "url": "https://www.uniprot.org/uniprotkb/Q38830" }, { "database": "PubMed", "id": "18258861", "url": "https://pubmed.ncbi.nlm.nih.gov/18258861" } ], "uniprot_canonical_ac": "Q38830-1" } ], "record_id": "pubmed.18258861", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The PS-IAA4/5-like family of early auxin-inducible mRNAs in Arabidopsis thaliana.", "journal": "J. Mol. Biol.", "date": "1995", "authors": "Abel S, Nguyen M D, Theologis A", "reference": { "type": "PubMed", "id": "7658471", "url": "https://pubmed.ncbi.nlm.nih.gov/7658471" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q38830-1", "protein_name": "Auxin-responsive protein IAA12", "gene_name": "IAA12", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38826-1", "protein_name": "Auxin-responsive protein IAA8", "gene_name": "IAA8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38827-1", "protein_name": "Auxin-responsive protein IAA9", "gene_name": "IAA9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P33077-1", "protein_name": "Auxin-responsive protein IAA4", "gene_name": "IAA4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P33078-1", "protein_name": "Auxin-responsive protein IAA5", "gene_name": "IAA5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49677-1", "protein_name": "Auxin-responsive protein IAA1", "gene_name": "IAA1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38824-1", "protein_name": "Auxin-responsive protein IAA6", "gene_name": "IAA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38828-1", "protein_name": "Auxin-responsive protein IAA10", "gene_name": "IAA10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38831-1", "protein_name": "Auxin-responsive protein IAA13", "gene_name": "IAA13", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38825-1", "protein_name": "Auxin-responsive protein IAA7", "gene_name": "IAA7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38832-1", "protein_name": "Auxin-responsive protein IAA14", "gene_name": "IAA14", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49678-1", "protein_name": "Auxin-responsive protein IAA2", "gene_name": "IAA2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38822-1", "protein_name": "Auxin-responsive protein IAA3", "gene_name": "IAA3; SHY2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38829-1", "protein_name": "Auxin-responsive protein IAA11", "gene_name": "IAA11", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q38830", "url": "https://www.uniprot.org/uniprotkb/Q38830" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7658471", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 14 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "B and C floral organ identity functions require SEPALLATA MADS-box genes.", "journal": "Nature", "date": "2000-05-11", "authors": "Pelaz S, Ditta G S, Baumann E, Wisman E, Yanofsky M F", "reference": { "type": "PubMed", "id": "10821278", "url": "https://pubmed.ncbi.nlm.nih.gov/10821278" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22456-1", "protein_name": "Developmental protein SEPALLATA 3", "gene_name": "SEP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P29384-1", "protein_name": "Developmental protein SEPALLATA 2", "gene_name": "SEP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P29382-1", "protein_name": "Developmental protein SEPALLATA 1", "gene_name": "SEP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22456", "url": "https://www.uniprot.org/uniprotkb/O22456" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.10821278", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Complexes of MADS-box proteins are sufficient to convert leaves into floral organs.", "journal": "Nature", "date": "2001-01-25", "authors": "Honma T, Goto K", "reference": { "type": "PubMed", "id": "11206550", "url": "https://pubmed.ncbi.nlm.nih.gov/11206550" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22456-1", "protein_name": "Developmental protein SEPALLATA 3", "gene_name": "SEP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P35632-1", "protein_name": "Floral homeotic protein APETALA 3", "gene_name": "AP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P35631-1", "protein_name": "Floral homeotic protein APETALA 1", "gene_name": "AP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P48007-1", "protein_name": "Floral homeotic protein PISTILLATA", "gene_name": "PI", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22456", "url": "https://www.uniprot.org/uniprotkb/O22456" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11206550", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutant analysis, protein-protein interactions and subcellular localization of the Arabidopsis B sister (ABS) protein.", "journal": "Molecular genetics and genomics : MGG", "date": "2005-09", "authors": "Kaufmann Kerstin, Anfang Nicole, Saedler Heinz, Theissen G\u00fcnter", "reference": { "type": "PubMed", "id": "16080001", "url": "https://pubmed.ncbi.nlm.nih.gov/16080001" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22456-1", "protein_name": "Developmental protein SEPALLATA 3", "gene_name": "SEP3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P29384-1", "protein_name": "Developmental protein SEPALLATA 2", "gene_name": "SEP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P29382-1", "protein_name": "Developmental protein SEPALLATA 1", "gene_name": "SEP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P29383-1", "protein_name": "Agamous-like MADS-box protein AGL3", "gene_name": "AGL3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8RYD9-1", "protein_name": "Protein TRANSPARENT TESTA 16", "gene_name": "TT16", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P35631-1", "protein_name": "Floral homeotic protein APETALA 1", "gene_name": "AP1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22456", "url": "https://www.uniprot.org/uniprotkb/O22456" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16080001", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis for the oligomerization of the MADS domain transcription factor SEPALLATA3 in Arabidopsis.", "journal": "Plant Cell", "date": "2014", "authors": "Puranik Sriharsha, Acajjaoui Samira, Conn Simon, Costa Luca, Conn Vanessa, Vial Anthony, Marcellin Romain, Melzer Rainer, Brown Elizabeth, Hart Darren, Thei\u00dfen G\u00fcnter, Silva Catarina S, Parcy Fran\u00e7ois, Dumas Renaud, Nanao Max, Zubieta Chloe", "reference": { "type": "PubMed", "id": "25228343", "url": "https://pubmed.ncbi.nlm.nih.gov/25228343" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22456-1", "protein_name": "Developmental protein SEPALLATA 3", "gene_name": "SEP3", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22456", "url": "https://www.uniprot.org/uniprotkb/O22456" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.25228343", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtSAP18, an orthologue of human SAP18, is involved in the regulation of salt stress and mediates transcriptional repression in Arabidopsis.", "journal": "Plant molecular biology", "date": "2006-01", "authors": "Song Chun-Peng, Galbraith David W", "reference": { "type": "PubMed", "id": "16429262", "url": "https://pubmed.ncbi.nlm.nih.gov/16429262" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O64644-1", "protein_name": "Histone deacetylase complex subunit SAP18", "gene_name": "SAP18", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80339-1", "protein_name": "Ethylene-responsive transcription factor 3", "gene_name": "ERF3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O80340-1", "protein_name": "Ethylene-responsive transcription factor 4", "gene_name": "ERF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O22446-1", "protein_name": "Histone deacetylase 19", "gene_name": "HD1; HDA19", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O64644", "url": "https://www.uniprot.org/uniprotkb/O64644" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16429262", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNA-binding proteins and circadian rhythms in Arabidopsis thaliana.", "journal": "Philosophical transactions of the Royal Society of London. Series B, Biological sciences", "date": "2001-11-29", "authors": "Staiger D", "reference": { "type": "PubMed", "id": "11710982", "url": "https://pubmed.ncbi.nlm.nih.gov/11710982" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11710982", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The circadian clock regulated RNA-binding protein AtGRP7 autoregulates its expression by influencing alternative splicing of its own pre-mRNA.", "journal": "The Plant journal : for cell and molecular biology", "date": "2003-01", "authors": "Staiger Dorothee, Zecca Laura, Wieczorek Kirk Dominika A, Apel Klaus, Eckstein Luca", "reference": { "type": "PubMed", "id": "12535349", "url": "https://pubmed.ncbi.nlm.nih.gov/12535349" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12535349", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis transportin1 is the nuclear import receptor for the circadian clock-regulated RNA-binding protein AtGRP7.", "journal": "Plant Mol. Biol.", "date": "2003", "authors": "Ziemienowicz Alicja, Haasen Dorothea, Staiger Dorothee, Merkle Thomas", "reference": { "type": "PubMed", "id": "14756317", "url": "https://pubmed.ncbi.nlm.nih.gov/14756317" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8H0U4-1", "protein_name": "Transportin-1", "gene_name": "TRN1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q8W034-1", "protein_name": "Heterogeneous nuclear ribonucleoprotein 1", "gene_name": "RNP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P41916-1", "protein_name": "GTP-binding nuclear protein Ran-1", "gene_name": "RAN1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14756317", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of transgenic Arabidopsis plants overexpressing GR-RBP4 under high salinity, dehydration, or cold stress.", "journal": "Journal of experimental botany", "date": "2005-11", "authors": "Kwak Kyung Jin, Kim Yeon Ok, Kang Hunseung", "reference": { "type": "PubMed", "id": "16207746", "url": "https://pubmed.ncbi.nlm.nih.gov/16207746" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SIX3-1", "protein_name": "Probable glycine-rich RNA-binding protein 1", "gene_name": "RBG1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FZ84-1", "protein_name": "Small ribosomal subunit protein mS86", "gene_name": "RBG6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNR1-1", "protein_name": "Glycine-rich RNA-binding protein 3, mitochondrial", "gene_name": "RBG3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LIS2-1", "protein_name": "Glycine-rich RNA-binding protein 4, mitochondrial", "gene_name": "RBG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVM8-1", "protein_name": "Glycine-rich RNA-binding protein 2, mitochondrial", "gene_name": "RBG2; RBGA5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.16207746", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 7 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtGRP7 is involved in the regulation of abscisic acid and stress responses in Arabidopsis.", "journal": "Cellular & molecular biology letters", "date": "2006", "authors": "Cao Shuqing, Jiang Li, Song Shiyong, Jing Ran, Xu Guosheng", "reference": { "type": "PubMed", "id": "17001447", "url": "https://pubmed.ncbi.nlm.nih.gov/17001447" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17001447", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cold shock domain proteins and glycine-rich RNA-binding proteins from Arabidopsis thaliana can promote the cold adaptation process in Escherichia coli.", "journal": "Nucleic acids research", "date": "2007", "authors": "Kim Jin Sun, Park Su Jung, Kwak Kyung Jin, Kim Yeon Ok, Kim Joo Yeol, Song Jinkyung, Jang Boseung, Jung Che-Hun, Kang Hunseung", "reference": { "type": "PubMed", "id": "17169986", "url": "https://pubmed.ncbi.nlm.nih.gov/17169986" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O65639-1", "protein_name": "Cold shock protein 1", "gene_name": "CSDP1; CSP1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LIS2-1", "protein_name": "Glycine-rich RNA-binding protein 4, mitochondrial", "gene_name": "RBG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q41188-1", "protein_name": "Cold shock protein 2", "gene_name": "CSP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVM8-1", "protein_name": "Glycine-rich RNA-binding protein 2, mitochondrial", "gene_name": "RBG2; RBGA5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17169986", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Auto-regulation of the circadian slave oscillator component AtGRP7 and regulation of its targets is impaired by a single RNA recognition motif point mutation.", "journal": "The Plant journal : for cell and molecular biology", "date": "2007-12", "authors": "Sch\u00f6ning Jan C, Streitner Corinna, Page Damian R, Hennig Sven, Uchida Kenko, Wolf Eva, Furuya Masaki, Staiger Dorothee", "reference": { "type": "PubMed", "id": "17924945", "url": "https://pubmed.ncbi.nlm.nih.gov/17924945" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 49, "end_pos": 49, "sequence_org": "R", "sequence_mut": "K", "comment": "Abolishes ADP-ribosylation by HopU1. Enable to complement the rbg7 mutant.", "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" }, { "database": "PubMed", "id": "17924945", "url": "https://pubmed.ncbi.nlm.nih.gov/17924945" }, { "database": "PubMed", "id": "23042250", "url": "https://pubmed.ncbi.nlm.nih.gov/23042250" }, { "database": "PubMed", "id": "17450127", "url": "https://pubmed.ncbi.nlm.nih.gov/17450127" }, { "database": "PubMed", "id": "22013065", "url": "https://pubmed.ncbi.nlm.nih.gov/22013065" } ], "uniprot_canonical_ac": "Q03250-1" }, { "start_pos": 49, "end_pos": 49, "sequence_org": "R", "sequence_mut": "Q", "comment": "Impairs RNA-binding and consequently impairs the regulation of its pre-mRNA and its downstream pre-mRNA target RBG8. Affects the alternative splicing of numerous targets.", "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" }, { "database": "PubMed", "id": "17924945", "url": "https://pubmed.ncbi.nlm.nih.gov/17924945" }, { "database": "PubMed", "id": "23042250", "url": "https://pubmed.ncbi.nlm.nih.gov/23042250" }, { "database": "PubMed", "id": "17450127", "url": "https://pubmed.ncbi.nlm.nih.gov/17450127" }, { "database": "PubMed", "id": "22013065", "url": "https://pubmed.ncbi.nlm.nih.gov/22013065" } ], "uniprot_canonical_ac": "Q03250-1" } ], "record_id": "pubmed.17924945", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glycine-rich RNA-binding protein 7 affects abiotic stress responses by regulating stomata opening and closing in Arabidopsis thaliana.", "journal": "The Plant journal : for cell and molecular biology", "date": "2008-08", "authors": "Kim Jin Sun, Jung Hyun Ju, Lee Hwa Jung, Kim Kyung Ae, Goh Chang-Hyo, Woo Youngmin, Oh Seung Han, Han Yeon Soo, Kang Hunseung", "reference": { "type": "PubMed", "id": "18410480", "url": "https://pubmed.ncbi.nlm.nih.gov/18410480" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18410480", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The small glycine-rich RNA binding protein AtGRP7 promotes floral transition in Arabidopsis thaliana.", "journal": "The Plant journal : for cell and molecular biology", "date": "2008-10", "authors": "Streitner Corinna, Danisman Selahattin, Wehrle Franziska, Sch\u00f6ning Jan C, Alfano James R, Staiger Dorothee", "reference": { "type": "PubMed", "id": "18573194", "url": "https://pubmed.ncbi.nlm.nih.gov/18573194" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9S7Q7-1", "protein_name": "MADS-box protein FLOWERING LOCUS C", "gene_name": "FLC", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18573194", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Changes in conformational dynamics of mRNA upon AtGRP7 binding studied by fluorescence correlation spectroscopy.", "journal": "J. Am. Chem. Soc.", "date": "2008", "authors": "Sch\u00fcttpelz Mark, Sch\u00f6ning Jan C, Doose S\u00f6ren, Neuweiler Hannes, Peters Elisabeth, Staiger Dorothee, Sauer Markus", "reference": { "type": "PubMed", "id": "18576621", "url": "https://pubmed.ncbi.nlm.nih.gov/18576621" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18576621", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reciprocal regulation of glycine-rich RNA-binding proteins via an interlocked feedback loop coupling alternative splicing to nonsense-mediated decay in Arabidopsis.", "journal": "Nucleic acids research", "date": "2008-12", "authors": "Sch\u00f6ning Jan C, Streitner Corinna, Meyer Irmtraud M, Gao Yahong, Staiger Dorothee", "reference": { "type": "PubMed", "id": "18987006", "url": "https://pubmed.ncbi.nlm.nih.gov/18987006" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 47, "end_pos": 47, "sequence_org": "R", "sequence_mut": "Q", "comment": "Impairs RNA-binding and consequently impairs the regulation of its pre-mRNA and its downstream pre-mRNA target RBG7.", "evidence": [ { "database": "UniProtKB", "id": "Q03251", "url": "https://www.uniprot.org/uniprotkb/Q03251" }, { "database": "PubMed", "id": "18987006", "url": "https://pubmed.ncbi.nlm.nih.gov/18987006" } ], "uniprot_canonical_ac": "Q03251-1" } ], "record_id": "pubmed.18987006", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RNA-protein interaction mediating post-transcriptional regulation in the circadian system.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2009", "authors": "Sch\u00f6ning Jan C, Staiger Dorothee", "reference": { "type": "PubMed", "id": "19083177", "url": "https://pubmed.ncbi.nlm.nih.gov/19083177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19083177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A proteomic analysis of oligo(dT)-bound mRNP containing oxidative stress-induced Arabidopsis thaliana RNA-binding proteins ATGRP7 and ATGRP8.", "journal": "Mol. Biol. Rep.", "date": "2010", "authors": "Schmidt Fabian, Marnef Aline, Cheung Man-Kim, Wilson Ian, Hancock John, Staiger Dorothee, Ladomery Michael", "reference": { "type": "PubMed", "id": "19672695", "url": "https://pubmed.ncbi.nlm.nih.gov/19672695" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVM8-1", "protein_name": "Glycine-rich RNA-binding protein 2, mitochondrial", "gene_name": "RBG2; RBGA5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19672695", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional diversity of the plant glycine-rich proteins superfamily.", "journal": "Plant Signal. Behav.", "date": "2010", "authors": "Mangeon Amanda, Junqueira Ricardo Magrani, Sachetto-Martins Gilberto", "reference": { "type": "PubMed", "id": "20009520", "url": "https://pubmed.ncbi.nlm.nih.gov/20009520" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SIX3-1", "protein_name": "Probable glycine-rich RNA-binding protein 1", "gene_name": "RBG1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FZ84-1", "protein_name": "Small ribosomal subunit protein mS86", "gene_name": "RBG6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9C909-1", "protein_name": "Glycine-rich RNA-binding protein 5, mitochondrial", "gene_name": "RBG5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FNR1-1", "protein_name": "Glycine-rich RNA-binding protein 3, mitochondrial", "gene_name": "RBG3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LIS2-1", "protein_name": "Glycine-rich RNA-binding protein 4, mitochondrial", "gene_name": "RBG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVM8-1", "protein_name": "Glycine-rich RNA-binding protein 2, mitochondrial", "gene_name": "RBG2; RBGA5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20009520", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 8 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reversible photoswitchable DRONPA-s monitors nucleocytoplasmic transport of an RNA-binding protein in transgenic plants.", "journal": "Traffic", "date": "2011", "authors": "Lummer Martina, Humpert Fabian, Steuwe Christian, Caesar Katharina, Sch\u00fcttpelz Mark, Sauer Markus, Staiger Dorothee", "reference": { "type": "PubMed", "id": "21453442", "url": "https://pubmed.ncbi.nlm.nih.gov/21453442" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21453442", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural determinants crucial to the RNA chaperone activity of glycine-rich RNA-binding proteins 4 and 7 in Arabidopsis thaliana during the cold adaptation process.", "journal": "Journal of experimental botany", "date": "2011-07", "authors": "Kwak Kyung Jin, Park Su Jung, Han Ji Hoon, Kim Min Kyung, Oh Seung Han, Han Yeon Soo, Kang Hunseung", "reference": { "type": "PubMed", "id": "21511907", "url": "https://pubmed.ncbi.nlm.nih.gov/21511907" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.21511907", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure function analysis of an ADP-ribosyltransferase type III effector and its RNA-binding target in plant immunity.", "journal": "The Journal of biological chemistry", "date": "2011-12-16", "authors": "Jeong Byeong-ryool, Lin Yan, Joe Anna, Guo Ming, Korneli Christin, Yang Huirong, Wang Ping, Yu Min, Cerny Ronald L, Staiger Dorothee, Alfano James R, Xu Yanhui", "reference": { "type": "PubMed", "id": "22013065", "url": "https://pubmed.ncbi.nlm.nih.gov/22013065" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 49, "end_pos": 49, "sequence_org": "R", "sequence_mut": "K", "comment": "Abolishes ADP-ribosylation by HopU1. Enable to complement the rbg7 mutant.", "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" }, { "database": "PubMed", "id": "17924945", "url": "https://pubmed.ncbi.nlm.nih.gov/17924945" }, { "database": "PubMed", "id": "23042250", "url": "https://pubmed.ncbi.nlm.nih.gov/23042250" }, { "database": "PubMed", "id": "17450127", "url": "https://pubmed.ncbi.nlm.nih.gov/17450127" }, { "database": "PubMed", "id": "22013065", "url": "https://pubmed.ncbi.nlm.nih.gov/22013065" } ], "uniprot_canonical_ac": "Q03250-1" }, { "start_pos": 49, "end_pos": 49, "sequence_org": "R", "sequence_mut": "Q", "comment": "Impairs RNA-binding and consequently impairs the regulation of its pre-mRNA and its downstream pre-mRNA target RBG8. Affects the alternative splicing of numerous targets.", "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" }, { "database": "PubMed", "id": "17924945", "url": "https://pubmed.ncbi.nlm.nih.gov/17924945" }, { "database": "PubMed", "id": "23042250", "url": "https://pubmed.ncbi.nlm.nih.gov/23042250" }, { "database": "PubMed", "id": "17450127", "url": "https://pubmed.ncbi.nlm.nih.gov/17450127" }, { "database": "PubMed", "id": "22013065", "url": "https://pubmed.ncbi.nlm.nih.gov/22013065" } ], "uniprot_canonical_ac": "Q03250-1" } ], "record_id": "pubmed.22013065", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Different roles of glycine-rich RNA-binding protein7 in plant defense against Pectobacterium carotovorum, Botrytis cinerea, and tobacco mosaic viruses.", "journal": "Plant physiology and biochemistry : PPB", "date": "2012-11", "authors": "Lee Hwa Jung, Kim Jin Seo, Yoo Seung Jin, Kang Eun Young, Han Song Hee, Yang Kwang-Yeol, Kim Young Cheol, McSpadden Gardener Brian, Kang Hunseung", "reference": { "type": "PubMed", "id": "22902796", "url": "https://pubmed.ncbi.nlm.nih.gov/22902796" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22902796", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An hnRNP-like RNA-binding protein affects alternative splicing by in vivo interaction with transcripts in Arabidopsis thaliana.", "journal": "Nucleic acids research", "date": "2012-12", "authors": "Streitner Corinna, K\u00f6ster Tino, Simpson Craig G, Shaw Paul, Danisman Selahattin, Brown John W S, Staiger Dorothee", "reference": { "type": "PubMed", "id": "23042250", "url": "https://pubmed.ncbi.nlm.nih.gov/23042250" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 49, "end_pos": 49, "sequence_org": "R", "sequence_mut": "K", "comment": "Abolishes ADP-ribosylation by HopU1. Enable to complement the rbg7 mutant.", "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" }, { "database": "PubMed", "id": "17924945", "url": "https://pubmed.ncbi.nlm.nih.gov/17924945" }, { "database": "PubMed", "id": "23042250", "url": "https://pubmed.ncbi.nlm.nih.gov/23042250" }, { "database": "PubMed", "id": "17450127", "url": "https://pubmed.ncbi.nlm.nih.gov/17450127" }, { "database": "PubMed", "id": "22013065", "url": "https://pubmed.ncbi.nlm.nih.gov/22013065" } ], "uniprot_canonical_ac": "Q03250-1" }, { "start_pos": 49, "end_pos": 49, "sequence_org": "R", "sequence_mut": "Q", "comment": "Impairs RNA-binding and consequently impairs the regulation of its pre-mRNA and its downstream pre-mRNA target RBG8. Affects the alternative splicing of numerous targets.", "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" }, { "database": "PubMed", "id": "17924945", "url": "https://pubmed.ncbi.nlm.nih.gov/17924945" }, { "database": "PubMed", "id": "23042250", "url": "https://pubmed.ncbi.nlm.nih.gov/23042250" }, { "database": "PubMed", "id": "17450127", "url": "https://pubmed.ncbi.nlm.nih.gov/17450127" }, { "database": "PubMed", "id": "22013065", "url": "https://pubmed.ncbi.nlm.nih.gov/22013065" } ], "uniprot_canonical_ac": "Q03250-1" } ], "record_id": "pubmed.23042250", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Plant SMALL RNA-BINDING PROTEIN 1 Family Mediates Cell-to-Cell Trafficking of RNAi Signals.", "journal": "Molecular plant", "date": "2020-02-03", "authors": "Yan Yan, Ham Byung-Kook, Chong Yee Hang, Yeh Shyi-Dong, Lucas William J", "reference": { "type": "PubMed", "id": "31812689", "url": "https://pubmed.ncbi.nlm.nih.gov/31812689" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LIS2-1", "protein_name": "Glycine-rich RNA-binding protein 4, mitochondrial", "gene_name": "RBG4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SVM8-1", "protein_name": "Glycine-rich RNA-binding protein 2, mitochondrial", "gene_name": "RBG2; RBGA5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.31812689", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RALF1-FERONIA complex affects splicing dynamics to modulate stress responses and growth in plants.", "journal": "Science advances", "date": "2020-05", "authors": "Wang Long, Yang Tao, Wang Bingqian, Lin Qinlu, Zhu Sirui, Li Chiyu, Ma Youchu, Tang Jing, Xing Junjie, Li Xiushan, Liao Hongdong, Staiger Dorothee, Hu Zhiqiang, Yu Feng", "reference": { "type": "PubMed", "id": "32671204", "url": "https://pubmed.ncbi.nlm.nih.gov/32671204" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "phosphorylation": [ { "start_pos": 111, "end_pos": 111, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03250", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03250" }, { "database": "PubMed", "id": "32671204", "url": "https://pubmed.ncbi.nlm.nih.gov/32671204" } ], "site_lbl": "Tyr111", "uniprot_canonical_ac": "Q03250-1" }, { "start_pos": 112, "end_pos": 112, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03250", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03250" }, { "database": "PubMed", "id": "32671204", "url": "https://pubmed.ncbi.nlm.nih.gov/32671204" } ], "site_lbl": "Ser112", "uniprot_canonical_ac": "Q03250-1" }, { "start_pos": 132, "end_pos": 132, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03250", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03250" }, { "database": "PubMed", "id": "23328941", "url": "https://pubmed.ncbi.nlm.nih.gov/23328941" }, { "database": "PubMed", "id": "32671204", "url": "https://pubmed.ncbi.nlm.nih.gov/32671204" } ], "site_lbl": "Ser132", "uniprot_canonical_ac": "Q03250-1" }, { "start_pos": 138, "end_pos": 138, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03250", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03250" }, { "database": "PubMed", "id": "32671204", "url": "https://pubmed.ncbi.nlm.nih.gov/32671204" } ], "site_lbl": "Tyr138", "uniprot_canonical_ac": "Q03250-1" }, { "start_pos": 139, "end_pos": 139, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03250", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03250" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PubMed", "id": "32671204", "url": "https://pubmed.ncbi.nlm.nih.gov/32671204" } ], "site_lbl": "Ser139", "uniprot_canonical_ac": "Q03250-1" }, { "start_pos": 140, "end_pos": 140, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "Q03250", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q03250" }, { "database": "PubMed", "id": "32671204", "url": "https://pubmed.ncbi.nlm.nih.gov/32671204" } ], "site_lbl": "Ser140", "uniprot_canonical_ac": "Q03250-1" } ], "record_id": "pubmed.32671204", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genes encoding glycine-rich Arabidopsis thaliana proteins with RNA-binding motifs are influenced by cold treatment and an endogenous circadian rhythm.", "journal": "Plant Physiol.", "date": "1994", "authors": "Carpenter C D, Kreps J A, Simon A E", "reference": { "type": "PubMed", "id": "7513083", "url": "https://pubmed.ncbi.nlm.nih.gov/7513083" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7513083", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two cDNAs from Arabidopsis thaliana encode putative RNA binding proteins containing glycine-rich domains.", "journal": "Plant Mol. Biol.", "date": "1993", "authors": "van Nocker S, Vierstra R D", "reference": { "type": "PubMed", "id": "8448367", "url": "https://pubmed.ncbi.nlm.nih.gov/8448367" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q03251-1", "protein_name": "Glycine-rich RNA-binding protein 8", "gene_name": "RBG8; RBGA6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8448367", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "AtGRP7, a nuclear RNA-binding protein as a component of a circadian-regulated negative feedback loop in Arabidopsis thaliana.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997-08-05", "authors": "Heintzen C, Nater M, Apel K, Staiger D", "reference": { "type": "PubMed", "id": "9238008", "url": "https://pubmed.ncbi.nlm.nih.gov/9238008" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q03250-1", "protein_name": "Glycine-rich RNA-binding protein 7", "gene_name": "CCR2; RBG7", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q03250", "url": "https://www.uniprot.org/uniprotkb/Q03250" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9238008", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The homeobox genes ATHB12 and ATHB7 encode potential regulators of growth in response to water deficit in Arabidopsis.", "journal": "Plant molecular biology", "date": "2004-07", "authors": "Olsson Anna S B, Engstr\u00f6m Peter, S\u00f6derman Eva", "reference": { "type": "PubMed", "id": "15604708", "url": "https://pubmed.ncbi.nlm.nih.gov/15604708" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46897-1", "protein_name": "Homeobox-leucine zipper protein ATHB-7", "gene_name": "ATHB-7; HB-7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M276-1", "protein_name": "Homeobox-leucine zipper protein ATHB-12", "gene_name": "ATHB-12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P46897", "url": "https://www.uniprot.org/uniprotkb/P46897" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15604708", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plant homeodomain-leucine zipper I transcription factors exhibit different functional AHA motifs that selectively interact with TBP or/and TFIIB.", "journal": "Plant Cell Rep.", "date": "2014", "authors": "Capella Mat\u00edas, R\u00e9 Delfina A, Arce Agust\u00edn L, Chan Raquel L", "reference": { "type": "PubMed", "id": "24531799", "url": "https://pubmed.ncbi.nlm.nih.gov/24531799" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46897-1", "protein_name": "Homeobox-leucine zipper protein ATHB-7", "gene_name": "ATHB-7; HB-7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P28148-1", "protein_name": "TATA-box-binding protein 2", "gene_name": "TBP2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P48512-1", "protein_name": "Transcription initiation factor IIB-1", "gene_name": "TFIIB1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q02283-1", "protein_name": "Homeobox-leucine zipper protein HAT5", "gene_name": "HAT5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M276-1", "protein_name": "Homeobox-leucine zipper protein ATHB-12", "gene_name": "ATHB-12", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P46897", "url": "https://www.uniprot.org/uniprotkb/P46897" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24531799", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression patterns of novel genes encoding homeodomain leucine-zipper proteins in Arabidopsis thaliana.", "journal": "Plant Mol. Biol.", "date": "1994", "authors": "S\u00f6derman E, Mattsson J, Svenson M, Borkird C, Engstr\u00f6m P", "reference": { "type": "PubMed", "id": "7948864", "url": "https://pubmed.ncbi.nlm.nih.gov/7948864" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46897-1", "protein_name": "Homeobox-leucine zipper protein ATHB-7", "gene_name": "ATHB-7; HB-7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P46667-1", "protein_name": "Homeobox-leucine zipper protein ATHB-5", "gene_name": "ATHB-5; HB5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P46668-1", "protein_name": "Homeobox-leucine zipper protein ATHB-6", "gene_name": "ATHB-6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P46897", "url": "https://www.uniprot.org/uniprotkb/P46897" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.7948864", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The Arabidopsis homeobox gene ATHB-7 is induced by water deficit and by abscisic acid.", "journal": "The Plant journal : for cell and molecular biology", "date": "1996-08", "authors": "S\u00f6derman E, Mattsson J, Engstr\u00f6m P", "reference": { "type": "PubMed", "id": "8771791", "url": "https://pubmed.ncbi.nlm.nih.gov/8771791" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P46897-1", "protein_name": "Homeobox-leucine zipper protein ATHB-7", "gene_name": "ATHB-7; HB-7", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P49597-1", "protein_name": "Protein phosphatase 2C 56", "gene_name": "ABI1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "P46897", "url": "https://www.uniprot.org/uniprotkb/P46897" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.8771791", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Truncation of a protein disulfide isomerase, PDIL2-1, delays embryo sac maturation and disrupts pollen tube guidance in Arabidopsis thaliana.", "journal": "The Plant cell", "date": "2008-12", "authors": "Wang Huanzhong, Boavida Leonor C, Ron Mily, McCormick Sheila", "reference": { "type": "PubMed", "id": "19050167", "url": "https://pubmed.ncbi.nlm.nih.gov/19050167" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22263-1", "protein_name": "Protein disulfide-isomerase like 2-1", "gene_name": "PDIL2-1; UNE5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22263", "url": "https://www.uniprot.org/uniprotkb/O22263" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19050167", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis thaliana ferrochelatase-I and -II are not imported into Arabidopsis mitochondria.", "journal": "FEBS Lett.", "date": "2001", "authors": "Lister R, Chew O, Rudhe C, Lee M N, Whelan J", "reference": { "type": "PubMed", "id": "11602264", "url": "https://pubmed.ncbi.nlm.nih.gov/11602264" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04921-1", "protein_name": "Ferrochelatase-2, chloroplastic", "gene_name": "FC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42043-1", "protein_name": "Ferrochelatase-1, chloroplastic/mitochondrial", "gene_name": "FC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04921", "url": "https://www.uniprot.org/uniprotkb/O04921" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11602264", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expression analysis of the two ferrochelatase genes in Arabidopsis in different tissues and under stress conditions reveals their different roles in haem biosynthesis.", "journal": "Plant Mol. Biol.", "date": "2002", "authors": "Singh Davinder Pal, Cornah Johanna E, Hadingham Sophie, Smith Alison G", "reference": { "type": "PubMed", "id": "12374307", "url": "https://pubmed.ncbi.nlm.nih.gov/12374307" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04921-1", "protein_name": "Ferrochelatase-2, chloroplastic", "gene_name": "FC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42043-1", "protein_name": "Ferrochelatase-1, chloroplastic/mitochondrial", "gene_name": "FC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04921", "url": "https://www.uniprot.org/uniprotkb/O04921" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12374307", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Functional characterization of the two ferrochelatases in Arabidopsis thaliana.", "journal": "Plant, cell & environment", "date": "2015-02", "authors": "Scharfenberg Michael, Mittermayr Lukas, VON Roepenack-Lahaye Edda, Schlicke Hagen, Grimm Bernhard, Leister Dario, Kleine Tatjana", "reference": { "type": "PubMed", "id": "24329537", "url": "https://pubmed.ncbi.nlm.nih.gov/24329537" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04921-1", "protein_name": "Ferrochelatase-2, chloroplastic", "gene_name": "FC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42043-1", "protein_name": "Ferrochelatase-1, chloroplastic/mitochondrial", "gene_name": "FC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04921", "url": "https://www.uniprot.org/uniprotkb/O04921" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.24329537", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitin facilitates a quality-control pathway that removes damaged chloroplasts.", "journal": "Science (New York, N.Y.)", "date": "2015-10-23", "authors": "Woodson Jesse D, Joens Matthew S, Sinson Andrew B, Gilkerson Jonathan, Salom\u00e9 Patrice A, Weigel Detlef, Fitzpatrick James A, Chory Joanne", "reference": { "type": "PubMed", "id": "26494759", "url": "https://pubmed.ncbi.nlm.nih.gov/26494759" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04921-1", "protein_name": "Ferrochelatase-2, chloroplastic", "gene_name": "FC2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04921", "url": "https://www.uniprot.org/uniprotkb/O04921" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.26494759", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular localisation of ferrochelatase in higher plant chloroplasts.", "journal": "Eur. J. Biochem.", "date": "1997", "authors": "Roper J M, Smith A G", "reference": { "type": "PubMed", "id": "9210462", "url": "https://pubmed.ncbi.nlm.nih.gov/9210462" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04921-1", "protein_name": "Ferrochelatase-2, chloroplastic", "gene_name": "FC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42043-1", "protein_name": "Ferrochelatase-1, chloroplastic/mitochondrial", "gene_name": "FC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04921", "url": "https://www.uniprot.org/uniprotkb/O04921" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9210462", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two different genes encode ferrochelatase in Arabidopsis: mapping, expression and subcellular targeting of the precursor proteins.", "journal": "Plant J.", "date": "1998", "authors": "Chow K S, Singh D P, Walker A R, Smith A G", "reference": { "type": "PubMed", "id": "9753778", "url": "https://pubmed.ncbi.nlm.nih.gov/9753778" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O04921-1", "protein_name": "Ferrochelatase-2, chloroplastic", "gene_name": "FC2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P42043-1", "protein_name": "Ferrochelatase-1, chloroplastic/mitochondrial", "gene_name": "FC1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O04921", "url": "https://www.uniprot.org/uniprotkb/O04921" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.9753778", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A recessive mutation in the Arabidopsis SSI2 gene confers SA- and NPR1-independent expression of PR genes and resistance against bacterial and oomycete pathogens.", "journal": "The Plant journal : for cell and molecular biology", "date": "2001-03", "authors": "Shah J, Kachroo P, Nandi A, Klessig D F", "reference": { "type": "PubMed", "id": "11309146", "url": "https://pubmed.ncbi.nlm.nih.gov/11309146" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22832-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic", "gene_name": "FAB2; SSI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.11309146", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A fatty acid desaturase modulates the activation of defense signaling pathways in plants.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001-07-31", "authors": "Kachroo P, Shanklin J, Shah J, Whittle E J, Klessig D F", "reference": { "type": "PubMed", "id": "11481500", "url": "https://pubmed.ncbi.nlm.nih.gov/11481500" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22832-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic", "gene_name": "FAB2; SSI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 146, "end_pos": 146, "sequence_org": "L", "sequence_mut": "F", "comment": "In ssi2; reduced activity.", "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" }, { "database": "PubMed", "id": "11481500", "url": "https://pubmed.ncbi.nlm.nih.gov/11481500" } ], "uniprot_canonical_ac": "O22832-1" } ], "record_id": "pubmed.11481500", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A mutant of Arabidopsis with increased levels of stearic acid.", "journal": "Plant Physiol.", "date": "1994", "authors": "Lightner J., Wu J., Browse J.", "reference": { "type": "PubMed", "id": "12232421", "url": "https://pubmed.ncbi.nlm.nih.gov/12232421" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22832-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic", "gene_name": "FAB2; SSI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12232421", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Restoration of defective cross talk in ssi2 mutants: role of salicylic acid, jasmonic acid, and fatty acids in SSI2-mediated signaling.", "journal": "Molecular plant-microbe interactions : MPMI", "date": "2003-11", "authors": "Kachroo Pradeep, Kachroo Aardra, Lapchyk Ludmila, Hildebrand David, Klessig Daniel F", "reference": { "type": "PubMed", "id": "14601670", "url": "https://pubmed.ncbi.nlm.nih.gov/14601670" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22832-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic", "gene_name": "FAB2; SSI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14601670", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Plastidial fatty acid signaling modulates salicylic acid- and jasmonic acid-mediated defense pathways in the Arabidopsis ssi2 mutant.", "journal": "The Plant cell", "date": "2003-12", "authors": "Kachroo Aardra, Lapchyk Ludmila, Fukushige Hirotada, Hildebrand David, Klessig Daniel, Kachroo Pradeep", "reference": { "type": "PubMed", "id": "14615603", "url": "https://pubmed.ncbi.nlm.nih.gov/14615603" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22832-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic", "gene_name": "FAB2; SSI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.14615603", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Enhanced resistance to Cucumber mosaic virus in the Arabidopsis thaliana ssi2 mutant is mediated via an SA-independent mechanism.", "journal": "Molecular plant-microbe interactions : MPMI", "date": "2004-06", "authors": "Sekine Ken-Taro, Nandi Ashis, Ishihara Takeaki, Hase Shu, Ikegami Masato, Shah Jyoti, Takahashi Hideki", "reference": { "type": "PubMed", "id": "15195945", "url": "https://pubmed.ncbi.nlm.nih.gov/15195945" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22832-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic", "gene_name": "FAB2; SSI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15195945", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis ssi2-conferred susceptibility to Botrytis cinerea is dependent on EDS5 and PAD4.", "journal": "Molecular plant-microbe interactions : MPMI", "date": "2005-04", "authors": "Nandi Ashis, Moeder Wolfgang, Kachroo Pradeep, Klessig Daniel F, Shah Jyoti", "reference": { "type": "PubMed", "id": "15828688", "url": "https://pubmed.ncbi.nlm.nih.gov/15828688" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22832-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic", "gene_name": "FAB2; SSI2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15828688", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "LEAFY COTYLEDON1 is a key regulator of fatty acid biosynthesis in Arabidopsis.", "journal": "Plant Physiol.", "date": "2008", "authors": "Mu Jinye, Tan Helin, Zheng Qi, Fu Fuyou, Liang Yan, Zhang Jian, Yang Xiaohui, Wang Tai, Chong Kang, Wang Xiu-Jie, Zuo Jianru", "reference": { "type": "PubMed", "id": "18689444", "url": "https://pubmed.ncbi.nlm.nih.gov/18689444" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22832-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic", "gene_name": "FAB2; SSI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LF04-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 1, chloroplastic", "gene_name": "S-ACP-DES1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M879-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 5, chloroplastic", "gene_name": "S-ACP-DES5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18689444", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional Activation of Two Delta-9 Palmitoyl-ACP Desaturase Genes by MYB115 and MYB118 Is Critical for Biosynthesis of Omega-7 Monounsaturated Fatty Acids in the Endosperm of Arabidopsis Seeds.", "journal": "The Plant cell", "date": "2016-10", "authors": "Troncoso-Ponce Manuel Adri\u00e1n, Barthole Guillaume, Tremblais Geoffrey, To Alexandra, Miquel Martine, Lepiniec Lo\u00efc, Baud S\u00e9bastien", "reference": { "type": "PubMed", "id": "27681170", "url": "https://pubmed.ncbi.nlm.nih.gov/27681170" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22832-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 7, chloroplastic", "gene_name": "FAB2; SSI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LF05-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 3, chloroplastic", "gene_name": "AAD3; S-ACP-DES3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q1PDP9-1", "protein_name": "Transcription factor MYB115", "gene_name": "MYB115", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LVW4-1", "protein_name": "Transcription factor MYB118", "gene_name": "MYB118", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M881-1", "protein_name": "Stearoyl-[acyl-carrier-protein] 9-desaturase 2, chloroplastic", "gene_name": "AAD2; S-ACP-DES2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 219, "end_pos": 219, "sequence_org": "T", "sequence_mut": "F", "comment": "Sufficient to trigger a significant accumulation of omega-7 fatty acids.", "evidence": [ { "database": "UniProtKB", "id": "O22832", "url": "https://www.uniprot.org/uniprotkb/O22832" }, { "database": "PubMed", "id": "27681170", "url": "https://pubmed.ncbi.nlm.nih.gov/27681170" } ], "uniprot_canonical_ac": "O22832-1" } ], "record_id": "pubmed.27681170", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biochemical function of typical and variant Arabidopsis thaliana U-box E3 ubiquitin-protein ligases.", "journal": "The Biochemical journal", "date": "2008-08-01", "authors": "Wiborg Jakob, O'Shea Charlotte, Skriver Karen", "reference": { "type": "PubMed", "id": "18393940", "url": "https://pubmed.ncbi.nlm.nih.gov/18393940" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22785-1", "protein_name": "Pre-mRNA-processing factor 19 homolog 2", "gene_name": "MAC3B; PRP19B", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22785", "url": "https://www.uniprot.org/uniprotkb/O22785" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.18393940", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two Prp19-like U-box proteins in the MOS4-associated complex play redundant roles in plant innate immunity.", "journal": "PLoS pathogens", "date": "2009-07", "authors": "Monaghan Jacqueline, Xu Fang, Gao Minghui, Zhao Qingguo, Palma Kristoffer, Long Chengzu, Chen She, Zhang Yuelin, Li Xin", "reference": { "type": "PubMed", "id": "19629177", "url": "https://pubmed.ncbi.nlm.nih.gov/19629177" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O22785-1", "protein_name": "Pre-mRNA-processing factor 19 homolog 2", "gene_name": "MAC3B; PRP19B", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q42384-1", "protein_name": "Protein pleiotropic regulatory locus 1", "gene_name": "PRL1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q94BR4-1", "protein_name": "Pre-mRNA-processing factor 19 homolog 1", "gene_name": "MAC3A; PRP19A", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P92948-1", "protein_name": "Cell division cycle 5-like protein", "gene_name": "CDC5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q949S9-1", "protein_name": "Pre-mRNA-splicing factor SPF27 homolog", "gene_name": "MOS4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "O22785", "url": "https://www.uniprot.org/uniprotkb/O22785" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.19629177", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The plant ESCRT component FREE1 shuttles to the nucleus to attenuate abscisic acid signalling.", "journal": "Nature plants", "date": "2019-05", "authors": "Li Hongbo, Li Yingzhu, Zhao Qiong, Li Tingting, Wei Juan, Li Baiying, Shen Wenjin, Yang Chao, Zeng Yonglun, Rodriguez Pedro L, Zhao Yunde, Jiang Liwen, Wang Xiaojing, Gao Caiji", "reference": { "type": "PubMed", "id": "30962512", "url": "https://pubmed.ncbi.nlm.nih.gov/30962512" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q39192-1", "protein_name": "Serine/threonine-protein kinase SRK2D", "gene_name": "SNRK22; SRK2D", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q39193-1", "protein_name": "Serine/threonine-protein kinase SRK2I", "gene_name": "SRK2I", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SJN0-1", "protein_name": "Protein ABSCISIC ACID-INSENSITIVE 5", "gene_name": "ABI5", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9ASS2-1", "protein_name": "Protein FREE1", "gene_name": "FREE1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9M7Q2-1", "protein_name": "ABSCISIC ACID-INSENSITIVE 5-like protein 7", "gene_name": "ABF4", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q39192", "url": "https://www.uniprot.org/uniprotkb/Q39192" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 341, "end_pos": 341, "sequence_org": "L", "sequence_mut": "A", "comment": "Localizes predominantly to the nucleus; when associated with A-338 and A-343.", "evidence": [ { "database": "UniProtKB", "id": "Q9ASS2", "url": "https://www.uniprot.org/uniprotkb/Q9ASS2" }, { "database": "PubMed", "id": "30962512", "url": "https://pubmed.ncbi.nlm.nih.gov/30962512" } ], "uniprot_canonical_ac": "Q9ASS2-1" }, { "start_pos": 343, "end_pos": 343, "sequence_org": "M", "sequence_mut": "A", "comment": "Localizes predominantly to the nucleus; when associated with A-338 and A-341.", "evidence": [ { "database": "UniProtKB", "id": "Q9ASS2", "url": "https://www.uniprot.org/uniprotkb/Q9ASS2" }, { "database": "PubMed", "id": "30962512", "url": "https://pubmed.ncbi.nlm.nih.gov/30962512" } ], "uniprot_canonical_ac": "Q9ASS2-1" }, { "start_pos": 530, "end_pos": 530, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation; abolishes abscisic acid-induced nuclear import; when associated with A-533.", "evidence": [ { "database": "UniProtKB", "id": "Q9ASS2", "url": "https://www.uniprot.org/uniprotkb/Q9ASS2" }, { "database": "PubMed", "id": "30962512", "url": "https://pubmed.ncbi.nlm.nih.gov/30962512" } ], "uniprot_canonical_ac": "Q9ASS2-1" }, { "start_pos": 530, "end_pos": 530, "sequence_org": "S", "sequence_mut": "D", "comment": "Mimicks constitutive phosphorylation; accumulates in the nucleus in the absence of abscisic acid treatment; when associated with D-533.", "evidence": [ { "database": "UniProtKB", "id": "Q9ASS2", "url": "https://www.uniprot.org/uniprotkb/Q9ASS2" }, { "database": "PubMed", "id": "30962512", "url": "https://pubmed.ncbi.nlm.nih.gov/30962512" } ], "uniprot_canonical_ac": "Q9ASS2-1" }, { "start_pos": 533, "end_pos": 533, "sequence_org": "S", "sequence_mut": "A", "comment": "Abolishes phosphorylation; abolishes abscisic acid-induced nuclear import; when associated with A-530.", "evidence": [ { "database": "UniProtKB", "id": "Q9ASS2", "url": "https://www.uniprot.org/uniprotkb/Q9ASS2" }, { "database": "PubMed", "id": "30962512", "url": "https://pubmed.ncbi.nlm.nih.gov/30962512" } ], "uniprot_canonical_ac": "Q9ASS2-1" } ], "phosphorylation": [ { "start_pos": 530, "end_pos": 530, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9ASS2", "url": "https://www.uniprot.org/uniprotkb/Q9ASS2" }, { "database": "PubMed", "id": "19245862", "url": "https://pubmed.ncbi.nlm.nih.gov/19245862" }, { "database": "PubMed", "id": "30962512", "url": "https://pubmed.ncbi.nlm.nih.gov/30962512" }, { "database": "iPTMnet", "id": "Q9ASS2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9ASS2" }, { "database": "PubMed", "id": "21768351", "url": "https://pubmed.ncbi.nlm.nih.gov/21768351" }, { "database": "PubMed", "id": "23111157", "url": "https://pubmed.ncbi.nlm.nih.gov/23111157" }, { "database": "PubMed", "id": "23572148", "url": "https://pubmed.ncbi.nlm.nih.gov/23572148" }, { "database": "PubMed", "id": "23660473", "url": "https://pubmed.ncbi.nlm.nih.gov/23660473" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PubMed", "id": "30833711", "url": "https://pubmed.ncbi.nlm.nih.gov/30833711" } ], "site_lbl": "Ser530", "uniprot_canonical_ac": "Q9ASS2-1" }, { "start_pos": 533, "end_pos": 533, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "Q9ASS2", "url": "https://www.uniprot.org/uniprotkb/Q9ASS2" }, { "database": "PubMed", "id": "30962512", "url": "https://pubmed.ncbi.nlm.nih.gov/30962512" }, { "database": "iPTMnet", "id": "Q9ASS2", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q9ASS2" }, { "database": "PubMed", "id": "21768351", "url": "https://pubmed.ncbi.nlm.nih.gov/21768351" }, { "database": "PubMed", "id": "23328941", "url": "https://pubmed.ncbi.nlm.nih.gov/23328941" }, { "database": "PubMed", "id": "23660473", "url": "https://pubmed.ncbi.nlm.nih.gov/23660473" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PubMed", "id": "30833711", "url": "https://pubmed.ncbi.nlm.nih.gov/30833711" } ], "site_lbl": "Ser533", "uniprot_canonical_ac": "Q9ASS2-1" } ], "record_id": "pubmed.30962512", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis IQD1, a novel calmodulin-binding nuclear protein, stimulates glucosinolate accumulation and plant defense.", "journal": "The Plant journal : for cell and molecular biology", "date": "2005-07", "authors": "Levy Maggie, Wang Qiaomei, Kaspi Roy, Parrella Michael P, Abel Steffen", "reference": { "type": "PubMed", "id": "15960618", "url": "https://pubmed.ncbi.nlm.nih.gov/15960618" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SF32-1", "protein_name": "Protein IQ-DOMAIN 1", "gene_name": "IQD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O64852-1", "protein_name": "Protein IQ-DOMAIN 6", "gene_name": "IQD6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93ZH7-1", "protein_name": "Protein IQ-DOMAIN 2", "gene_name": "IQD2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4IUJ7-1", "protein_name": "Protein IQ-DOMAIN 4", "gene_name": "IQD4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FT53-1", "protein_name": "Protein IQ-DOMAIN 3", "gene_name": "IQD3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4J061-1", "protein_name": "Protein IQ-DOMAIN 5", "gene_name": "IQD5", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SF32", "url": "https://www.uniprot.org/uniprotkb/Q9SF32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.15960618", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The emerging function of IQD proteins as scaffolds in cellular signaling and trafficking.", "journal": "Plant Signal. Behav.", "date": "2013", "authors": "Abel Steffen, B\u00fcrstenbinder Katharina, M\u00fcller Jens", "reference": { "type": "PubMed", "id": "23531692", "url": "https://pubmed.ncbi.nlm.nih.gov/23531692" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9SF32-1", "protein_name": "Protein IQ-DOMAIN 1", "gene_name": "IQD1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "O81629-1", "protein_name": "Protein KINESIN LIGHT CHAIN-RELATED 1", "gene_name": "KLCR1", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9SF32", "url": "https://www.uniprot.org/uniprotkb/Q9SF32" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23531692", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Secreted peptide signals required for maintenance of root stem cell niche in Arabidopsis.", "journal": "Science (New York, N.Y.)", "date": "2010-08-27", "authors": "Matsuzaki Yo, Ogawa-Ohnishi Mari, Mori Ayaka, Matsubayashi Yoshikatsu", "reference": { "type": "PubMed", "id": "20798316", "url": "https://pubmed.ncbi.nlm.nih.gov/20798316" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LI64-1", "protein_name": "Protein GOLVEN 3", "gene_name": "GLV3; RGF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3E880-1", "protein_name": "Protein GOLVEN 11", "gene_name": "GLV11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SI57-1", "protein_name": "Protein GOLVEN 6", "gene_name": "GLV6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FGF6-1", "protein_name": "Protein GOLVEN 2", "gene_name": "GLV2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6DSU1-1", "protein_name": "Protein GOLVEN 5", "gene_name": "GLV5; RGF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6ID76-1", "protein_name": "Protein GOLVEN 7", "gene_name": "GLV7; RGF3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5YGP7-1", "protein_name": "AP2-like ethylene-responsive transcription factor PLT2", "gene_name": "PLT2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5YGP8-1", "protein_name": "AP2-like ethylene-responsive transcription factor PLT1", "gene_name": "PLT1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NNL3-1", "protein_name": "Protein GOLVEN 4", "gene_name": "GLV4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B3H5J1-1", "protein_name": "Protein GOLVEN 10", "gene_name": "GLV10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93VK8-1", "protein_name": "Protein GOLVEN 1", "gene_name": "GLV1; RGF6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LI64", "url": "https://www.uniprot.org/uniprotkb/Q9LI64" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.20798316", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GOLVEN secretory peptides regulate auxin carrier turnover during plant gravitropic responses.", "journal": "Developmental cell", "date": "2012-03-13", "authors": "Whitford Ryan, Fernandez Ana, Tejos Ricardo, P\u00e9rez Amparo Cu\u00e9llar, Kleine-Vehn J\u00fcrgen, Vanneste Steffen, Drozdzecki Andrzej, Leitner Johannes, Abas Lindy, Aerts Maarten, Hoogewijs Kurt, Baster Pawel, De Groodt Ruth, Lin Yao-Cheng, Storme V\u00e9ronique, Van de Peer Yves, Beeckman Tom, Madder Annemieke, Devreese Bart, Luschnig Christian, Friml Ji\u0159\u00ed, Hilson Pierre", "reference": { "type": "PubMed", "id": "22421050", "url": "https://pubmed.ncbi.nlm.nih.gov/22421050" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LI64-1", "protein_name": "Protein GOLVEN 3", "gene_name": "GLV3; RGF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FGF6-1", "protein_name": "Protein GOLVEN 2", "gene_name": "GLV2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93VK8-1", "protein_name": "Protein GOLVEN 1", "gene_name": "GLV1; RGF6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LI64", "url": "https://www.uniprot.org/uniprotkb/Q9LI64" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.22421050", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Transcriptional and functional classification of the GOLVEN/ROOT GROWTH FACTOR/CLE-like signaling peptides reveals their role in lateral root and hair formation.", "journal": "Plant physiology", "date": "2013-02", "authors": "Fernandez Ana, Drozdzecki Andrzej, Hoogewijs Kurt, Nguyen Anh, Beeckman Tom, Madder Annemieke, Hilson Pierre", "reference": { "type": "PubMed", "id": "23370719", "url": "https://pubmed.ncbi.nlm.nih.gov/23370719" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LI64-1", "protein_name": "Protein GOLVEN 3", "gene_name": "GLV3; RGF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3E880-1", "protein_name": "Protein GOLVEN 11", "gene_name": "GLV11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9SI57-1", "protein_name": "Protein GOLVEN 6", "gene_name": "GLV6", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4KB79-1", "protein_name": "Protein GOLVEN 9", "gene_name": "GLV9", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9FGF6-1", "protein_name": "Protein GOLVEN 2", "gene_name": "GLV2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6DSU1-1", "protein_name": "Protein GOLVEN 5", "gene_name": "GLV5; RGF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6ID76-1", "protein_name": "Protein GOLVEN 7", "gene_name": "GLV7; RGF3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6NNL3-1", "protein_name": "Protein GOLVEN 4", "gene_name": "GLV4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B3H5J1-1", "protein_name": "Protein GOLVEN 10", "gene_name": "GLV10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B3H5Q2-1", "protein_name": "Protein GOLVEN 8", "gene_name": "GLV8", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q93VK8-1", "protein_name": "Protein GOLVEN 1", "gene_name": "GLV1; RGF6", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LI64", "url": "https://www.uniprot.org/uniprotkb/Q9LI64" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.23370719", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 11 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of three LRR-RKs involved in perception of root meristem growth factor in Arabidopsis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2016", "authors": "Shinohara Hidefumi, Mori Ayaka, Yasue Naoko, Sumida Kumiko, Matsubayashi Yoshikatsu", "reference": { "type": "PubMed", "id": "27001831", "url": "https://pubmed.ncbi.nlm.nih.gov/27001831" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9LI64-1", "protein_name": "Protein GOLVEN 3", "gene_name": "GLV3; RGF4", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q3E880-1", "protein_name": "Protein GOLVEN 11", "gene_name": "GLV11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LHP4-1", "protein_name": "LRR receptor-like serine/threonine-protein kinase RGI1", "gene_name": "RGI1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6DSU1-1", "protein_name": "Protein GOLVEN 5", "gene_name": "GLV5; RGF2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q6ID76-1", "protein_name": "Protein GOLVEN 7", "gene_name": "GLV7; RGF3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "B3H5J1-1", "protein_name": "Protein GOLVEN 10", "gene_name": "GLV10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "C0LGR3-1", "protein_name": "LRR receptor-like serine/threonine-protein kinase RGI3", "gene_name": "RGI3", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "C0LGV1-1", "protein_name": "LRR receptor-like serine/threonine-protein kinase RGI2", "gene_name": "RGI2", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "F4JBX1-1", "protein_name": "Root meristem growth factor 10", "gene_name": "RGF10", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q9LI64", "url": "https://www.uniprot.org/uniprotkb/Q9LI64" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.27001831", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 9 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A geminivirus replication protein interacts with a protein kinase and a motor protein that display different expression patterns during plant development and infection.", "journal": "The Plant cell", "date": "2002-08", "authors": "Kong Ling-Jie, Hanley-Bowdoin Linda", "reference": { "type": "PubMed", "id": "12172024", "url": "https://pubmed.ncbi.nlm.nih.gov/12172024" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q93V58-1", "protein_name": "Serine/threonine-protein kinase GRIK1", "gene_name": "GRIK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q9LX99-1", "protein_name": "Kinesin-like protein KIN-14A", "gene_name": "KIN14A", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q93V58", "url": "https://www.uniprot.org/uniprotkb/Q93V58" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.12172024", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Geminivirus infection up-regulates the expression of two Arabidopsis protein kinases related to yeast SNF1- and mammalian AMPK-activating kinases.", "journal": "Plant physiology", "date": "2006-12", "authors": "Shen Wei, Hanley-Bowdoin Linda", "reference": { "type": "PubMed", "id": "17041027", "url": "https://pubmed.ncbi.nlm.nih.gov/17041027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q93V58-1", "protein_name": "Serine/threonine-protein kinase GRIK1", "gene_name": "GRIK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5HZ38-1", "protein_name": "Serine/threonine-protein kinase GRIK2", "gene_name": "GRIK2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q93V58", "url": "https://www.uniprot.org/uniprotkb/Q93V58" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17041027", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "DNA sequences from Arabidopsis, which encode protein kinases and function as upstream regulators of Snf1 in yeast.", "journal": "The Journal of biological chemistry", "date": "2007-04-06", "authors": "Hey Sandra, Mayerhofer Hubert, Halford Nigel G, Dickinson J Richard", "reference": { "type": "PubMed", "id": "17237223", "url": "https://pubmed.ncbi.nlm.nih.gov/17237223" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q93V58-1", "protein_name": "Serine/threonine-protein kinase GRIK1", "gene_name": "GRIK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5HZ38-1", "protein_name": "Serine/threonine-protein kinase GRIK2", "gene_name": "GRIK2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q93V58", "url": "https://www.uniprot.org/uniprotkb/Q93V58" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "record_id": "pubmed.17237223", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Arabidopsis protein kinases GRIK1 and GRIK2 specifically activate SnRK1 by phosphorylating its activation loop.", "journal": "Plant physiology", "date": "2009-06", "authors": "Shen Wei, Reyes Maria Ines, Hanley-Bowdoin Linda", "reference": { "type": "PubMed", "id": "19339507", "url": "https://pubmed.ncbi.nlm.nih.gov/19339507" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q93V58-1", "protein_name": "Serine/threonine-protein kinase GRIK1", "gene_name": "GRIK1", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q38997-2", "protein_name": "SNF1-related protein kinase catalytic subunit alpha KIN10", "gene_name": "KIN10", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "P92958-1", "protein_name": "SNF1-related protein kinase catalytic subunit alpha KIN11", "gene_name": "KIN11", "tax_name": "Mouse-ear cress" }, { "uniprot_canonical_ac": "Q5HZ38-1", "protein_name": "Serine/threonine-protein kinase GRIK2", "gene_name": "GRIK2", "tax_name": "Mouse-ear cress" } ], "species": [ { "name": "Arabidopsis thaliana", "taxid": 3702, "evidence": [ { "database": "UniProtKB", "id": "Q93V58", "url": "https://www.uniprot.org/uniprotkb/Q93V58" } ], "common_name": "Mouse-ear cress", "glygen_name": "Arabidopsis", "reference_species": "Arabidopsis thaliana [3702]" } ], "mutagenesis": [ { "start_pos": 137, "end_pos": 137, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes autophosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q93V58", "url": "https://www.uniprot.org/uniprotkb/Q93V58" }, { "database": "PubMed", "id": "19339507", "url": "https://pubmed.ncbi.nlm.nih.gov/19339507" } ], "uniprot_canonical_ac": "Q93V58-1" }, { "start_pos": 175, "end_pos": 175, "sequence_org": "T", "sequence_mut": "A", "comment": "Abolishes phosphorylation by GRIK1 or GRIK2 leading to inactivation of the protein. Enhances sensitivity to submergence.", "evidence": [ { "database": "UniProtKB", "id": "Q38997", "url": "https://www.uniprot.org/uniprotkb/Q38997" }, { "database": "PubMed", "id": "19339507", "url": "https://pubmed.ncbi.nlm.nih.gov/19339507" }, { "database": "PubMed", "id": "20164192", "url": "https://pubmed.ncbi.nlm.nih.gov/20164192" }, { "database": "PubMed", "id": "17671505", "url": "https://pubmed.ncbi.nlm.nih.gov/17671505" }, { "database": "PubMed", "id": "27029354", "url": "https://pubmed.ncbi.nlm.nih.gov/27029354" } ], "uniprot_canonical_ac": "Q38997-2" }, { "start_pos": 136, "end_pos": 136, "sequence_org": "K", "sequence_mut": "A", "comment": "Abolishes autophosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "Q5HZ38", "url": "https://www.uniprot.org/uniprotkb/Q5HZ38" }, { "database": "PubMed", "id": "19339507", "url": "https://pubmed.ncbi.nlm.nih.gov/19339507" } ], "uniprot_canonical_ac": "Q5HZ38-1" } ], "phosphorylation": [ { "start_pos": 175, "end_pos": 175, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by GRIK1 or GRIK2", "evidence": [ { "database": "UniProtKB", "id": "Q38997", "url": "https://www.uniprot.org/uniprotkb/Q38997" }, { "database": "iPTMnet", "id": "Q38997", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q38997" }, { "database": "PubMed", "id": "23111157", "url": "https://pubmed.ncbi.nlm.nih.gov/23111157" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PubMed", "id": "29167316", "url": "https://pubmed.ncbi.nlm.nih.gov/29167316" }, { "database": "PubMed", "id": "30833711", "url": "https://pubmed.ncbi.nlm.nih.gov/30833711" }, { "database": "PubMed", "id": "32843632", "url": "https://pubmed.ncbi.nlm.nih.gov/32843632" }, { "database": "PubMed", "id": "19339507", "url": "https://pubmed.ncbi.nlm.nih.gov/19339507" }, { "database": "PubMed", "id": "24179127", "url": "https://pubmed.ncbi.nlm.nih.gov/24179127" }, { "database": "PubMed", "id": "27029354", "url": "https://pubmed.ncbi.nlm.nih.gov/27029354" }, { "database": "PubMed", "id": "27545962", "url": "https://pubmed.ncbi.nlm.nih.gov/27545962" }, { "database": "PubMed", "id": "19302419", "url": "https://pubmed.ncbi.nlm.nih.gov/19302419" } ], "site_lbl": "Thr175", "uniprot_canonical_ac": "Q38997-2" }, { "start_pos": 176, "end_pos": 176, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by GRIK1 or GRIK2", "evidence": [ { "database": "UniProtKB", "id": "P92958", "url": "https://www.uniprot.org/uniprotkb/P92958" }, { "database": "iPTMnet", "id": "P92958", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P92958" }, { "database": "PubMed", "id": "23111157", "url": "https://pubmed.ncbi.nlm.nih.gov/23111157" }, { "database": "PubMed", "id": "23328941", "url": "https://pubmed.ncbi.nlm.nih.gov/23328941" }, { "database": "PubMed", "id": "23572148", "url": "https://pubmed.ncbi.nlm.nih.gov/23572148" }, { "database": "PubMed", "id": "23660473", "url": "https://pubmed.ncbi.nlm.nih.gov/23660473" }, { "database": "PubMed", "id": "23776212", "url": "https://pubmed.ncbi.nlm.nih.gov/23776212" }, { "database": "PubMed", "id": "24601666", "url": "https://pubmed.ncbi.nlm.nih.gov/24601666" }, { "database": "PubMed", "id": "25561503", "url": "https://pubmed.ncbi.nlm.nih.gov/25561503" }, { "database": "PubMed", "id": "27532006", "url": "https://pubmed.ncbi.nlm.nih.gov/27532006" }, { "database": "PubMed", "id": "29167316", "url": "https://pubmed.ncbi.nlm.nih.gov/29167316" }, { "database": "PubMed", "id": "30833711", "url": "https://pubmed.ncbi.nlm.nih.gov/30833711" }, { "database": "PubMed", "id": "27029354", "url": "https://pubmed.ncbi.nlm.nih.gov/27029354" }, { "database": "PubMed", "id": "27545962", "url": "https://pubmed.ncbi.nlm.nih.gov/27545962" }, { "database": "PubMed", "id": "19339507", "url": "https://pubmed.ncbi.nlm.nih.gov/19339507" } ], "site_lbl": "Thr176", "uniprot_canonical_ac": "P92958-1" } ], "record_id": "pubmed.19339507", "abstract": "", "glycosylation": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]