[ { "title": "Molecular characterization of homozygous variegate porphyria.", "journal": "Human molecular genetics", "date": "1998", "authors": "Roberts AG, Puy H, Dailey TA, Morgan RR, Whatley SD, Dailey HA, Martasek P, Nordmann Y, Deybach JC, Elder GH", "reference": { "type": "PubMed", "id": "9811936", "url": "https://pubmed.ncbi.nlm.nih.gov/9811936" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P50336-1", "protein_name": "Protoporphyrinogen oxidase", "gene_name": "PPOX", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P50336", "url": "https://www.uniprot.org/uniprotkb/P50336" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9811936", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutations in RECQL4 cause a subset of cases of Rothmund-Thomson syndrome.", "journal": "Nature genetics", "date": "1999", "authors": "Kitao S, Shimamoto A, Goto M, Miller RW, Smithson WA, Lindor NM, Furuichi Y", "reference": { "type": "PubMed", "id": "10319867", "url": "https://pubmed.ncbi.nlm.nih.gov/10319867" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10319867", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rothmund-Thomson syndrome responsible gene, RECQL4: genomic structure and products.", "journal": "Genomics", "date": "1999", "authors": "Kitao S, Lindor N M, Shiratori M, Furuichi Y, Shimamoto A", "reference": { "type": "PubMed", "id": "10552928", "url": "https://pubmed.ncbi.nlm.nih.gov/10552928" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10552928", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Rothmund-Thomson syndrome due to RECQ4 helicase mutations: report and clinical and molecular comparisons with Bloom syndrome and Werner syndrome.", "journal": "Am. J. Med. Genet.", "date": "2000", "authors": "Lindor N M, Furuichi Y, Kitao S, Shimamoto A, Arndt C, Jalal S", "reference": { "type": "PubMed", "id": "10678659", "url": "https://pubmed.ncbi.nlm.nih.gov/10678659" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10678659", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Differential regulation of human RecQ family helicases in cell transformation and cell cycle.", "journal": "Oncogene", "date": "2000", "authors": "Kawabe T, Tsuyama N, Kitao S, Nishikawa K, Shimamoto A, Shiratori M, Matsumoto T, Anno K, Sato T, Mitsui Y, Seki M, Enomoto T, Goto M, Ellis N A, Ide T, Furuichi Y, Sugimoto M", "reference": { "type": "PubMed", "id": "11032027", "url": "https://pubmed.ncbi.nlm.nih.gov/11032027" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11032027", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification of two novel RECQL4exonic SNPs and genomic characterization of the IVS12 minisatellite.", "journal": "J. Hum. Genet.", "date": "2003", "authors": "Roversi Gaia, Beghini Alessandro, Zambruno Giovanna, Paradisi Mauro, Larizza Lidia", "reference": { "type": "PubMed", "id": "12601557", "url": "https://pubmed.ncbi.nlm.nih.gov/12601557" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12601557", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Association between osteosarcoma and deleterious mutations in the RECQL4 gene in Rothmund-Thomson syndrome.", "journal": "Journal of the National Cancer Institute", "date": "2003", "authors": "Wang LL, Gannavarapu A, Kozinetz CA, Levy ML, Lewis RA, Chintagumpala MM, Ruiz-Maldanado R, Contreras-Ruiz J, Cunniff C, Erickson RP, Lev D, Rogers M, Zackai EH, Plon SE", "reference": { "type": "PubMed", "id": "12734318", "url": "https://pubmed.ncbi.nlm.nih.gov/12734318" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12734318", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular defect of RAPADILINO syndrome expands the phenotype spectrum of RECQL diseases.", "journal": "Hum. Mol. Genet.", "date": "2003", "authors": "Siitonen HA, Kopra O, Kaariainen H, Haravuori H, Winter RM, Saamanen AM, Peltonen L, Kestila M", "reference": { "type": "PubMed", "id": "12952869", "url": "https://pubmed.ncbi.nlm.nih.gov/12952869" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q75NR7-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "Recql4", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12952869", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mutation analysis of the RECQL4 gene in sporadic osteosarcomas.", "journal": "Int. J. Cancer", "date": "2004", "authors": "Nishijo K, Nakayama T, Aoyama T, Okamoto T, Ishibe T, Yasura K, Shima Y, Shibata KR, Tsuboyama T, Nakamura T, Toguchida J", "reference": { "type": "PubMed", "id": "15221963", "url": "https://pubmed.ncbi.nlm.nih.gov/15221963" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15221963", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RECQL4, mutated in the Rothmund-Thomson and RAPADILINO syndromes, interacts with ubiquitin ligases UBR1 and UBR2 of the N-end rule pathway.", "journal": "Human molecular genetics", "date": "2004-10-15", "authors": "Yin Jinhu, Kwon Yong Tae, Varshavsky Alexander, Wang Weidong", "reference": { "type": "PubMed", "id": "15317757", "url": "https://pubmed.ncbi.nlm.nih.gov/15317757" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWV7-1", "protein_name": "E3 ubiquitin-protein ligase UBR1", "gene_name": "UBR1", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IWV8-1", "protein_name": "E3 ubiquitin-protein ligase UBR2", "gene_name": "UBR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15317757", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Revisiting the craniosynostosis-radial ray hypoplasia association: Baller-Gerold syndrome caused by mutations in the RECQL4 gene.", "journal": "Journal of medical genetics", "date": "2006", "authors": "Van Maldergem L, Siitonen HA, Jalkh N, Chouery E, De Roy M, Delague V, Muenke M, Jabs EW, Cai J, Wang LL, Plon SE, Fourneau C, Kestila M, Gillerot Y, Megarbane A, Verloes A", "reference": { "type": "PubMed", "id": "15964893", "url": "https://pubmed.ncbi.nlm.nih.gov/15964893" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15964893", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Multiple malignant diseases in a patient with Rothmund-Thomson syndrome with RECQL4 mutations: Case report and literature review.", "journal": "American journal of medical genetics. Part A", "date": "2010", "authors": "Simon T, Kohlhase J, Wilhelm C, Kochanek M, De Carolis B, Berthold F", "reference": { "type": "PubMed", "id": "20503338", "url": "https://pubmed.ncbi.nlm.nih.gov/20503338" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20503338", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The structural and functional characterization of human RecQ4 reveals insights into its helicase mechanism.", "journal": "Nature communications", "date": "2017-06-27", "authors": "Kaiser Sebastian, Sauer Florian, Kisker Caroline", "reference": { "type": "PubMed", "id": "28653661", "url": "https://pubmed.ncbi.nlm.nih.gov/28653661" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 1117, "end_pos": 1208, "sequence_org": "GGMEDAQGPEPGQARLQDWEDQVRCDIRQFLSLRPEEKFSSRAVARIFHGIGSPCYPAQVYGQDRRFWRKYLHLSFHALVGLATEELLQVAR", "sequence_mut": "", "comment": "Decreases helicase activity 5-fold, decreased ssDNA-binding (in a fragment of residues 427-1208).", "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" }, { "database": "PubMed", "id": "28653661", "url": "https://pubmed.ncbi.nlm.nih.gov/28653661" } ], "uniprot_canonical_ac": "O94761-1" }, { "start_pos": 508, "end_pos": 508, "sequence_org": "K", "sequence_mut": "A", "comment": "No helicase activity (in a fragment of residues 427-1208).", "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" }, { "database": "PubMed", "id": "28653661", "url": "https://pubmed.ncbi.nlm.nih.gov/28653661" } ], "uniprot_canonical_ac": "O94761-1" }, { "start_pos": 605, "end_pos": 605, "sequence_org": "D", "sequence_mut": "A", "comment": "No helicase activity (in a fragment of residues 427-1208).", "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" }, { "database": "PubMed", "id": "28653661", "url": "https://pubmed.ncbi.nlm.nih.gov/28653661" } ], "uniprot_canonical_ac": "O94761-1" }, { "start_pos": 618, "end_pos": 618, "sequence_org": "R", "sequence_mut": "L", "comment": "Loss of helicase activity, 20% ATPase activity (in a fragment of residues 427-1208).", "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" }, { "database": "PubMed", "id": "28653661", "url": "https://pubmed.ncbi.nlm.nih.gov/28653661" } ], "uniprot_canonical_ac": "O94761-1" }, { "start_pos": 944, "end_pos": 1032, "sequence_org": "HCRLNCPGGPAQLQALAHRCPPLAVCLAQQLPEDPGQGSSSVEFDMVKLVDSMGWELASVRRALCQLQWDHEPRTGVRRGTGVLVEFSE", "sequence_mut": "", "comment": "About 50% reduction in helicase velocity (in a fragment of residues 427-1208).", "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" }, { "database": "PubMed", "id": "28653661", "url": "https://pubmed.ncbi.nlm.nih.gov/28653661" } ], "uniprot_canonical_ac": "O94761-1" } ], "record_id": "pubmed.28653661", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Cell cycle-dependent phosphorylation regulates RECQL4 pathway choice and ubiquitination in DNA double-strand break repair.", "journal": "Nature communications", "date": "2017", "authors": "Lu H, Shamanna RA, de Freitas JK, Okur M, Khadka P, Kulikowicz T, Holland PP, Tian J, Croteau DL, Davis AJ, Bohr VA", "reference": { "type": "PubMed", "id": "29229926", "url": "https://pubmed.ncbi.nlm.nih.gov/29229926" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 251, "end_pos": 251, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94761", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94761" }, { "database": "PubMed", "id": "29229926", "url": "https://pubmed.ncbi.nlm.nih.gov/29229926" } ], "site_lbl": "Ser251", "uniprot_canonical_ac": "O94761-1" }, { "start_pos": 89, "end_pos": 89, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O94761", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O94761" }, { "database": "PubMed", "id": "29229926", "url": "https://pubmed.ncbi.nlm.nih.gov/29229926" } ], "site_lbl": "Ser89", "uniprot_canonical_ac": "O94761-1" } ], "record_id": "pubmed.29229926", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "TRIM58 functions as a tumor suppressor in colorectal cancer by promoting RECQL4 ubiquitination to inhibit the AKT signaling pathway.", "journal": "World journal of surgical oncology", "date": "2023-07-29", "authors": "Sun Naizhi, Shen Jiacheng, Shi Yuhua, Liu Biao, Gao Shengguo, Chen Yichuan, Sun Jinwei", "reference": { "type": "PubMed", "id": "37516854", "url": "https://pubmed.ncbi.nlm.nih.gov/37516854" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8NG06-1", "protein_name": "E3 ubiquitin-protein ligase TRIM58", "gene_name": "TRIM58", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37516854", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recognition and coacervation of G-quadruplexes by a multifunctional disordered region in RECQ4 helicase.", "journal": "Nature communications", "date": "2023-10-24", "authors": "Papageorgiou Anna C, Pospisilova Michaela, Cibulka Jakub, Ashraf Raghib, Waudby Christopher A, Kade\u0159\u00e1vek Pavel, Maroz Volha, Kubicek Karel, Prokop Zbynek, Krejci Lumir, Tripsianes Konstantinos", "reference": { "type": "PubMed", "id": "37875529", "url": "https://pubmed.ncbi.nlm.nih.gov/37875529" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37875529", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RECQL4 is not critical for firing of human DNA replication origins.", "journal": "Scientific reports", "date": "2024-04-02", "authors": "Padayachy Laura, Ntallis Sotirios G, Halazonetis Thanos D", "reference": { "type": "PubMed", "id": "38565932", "url": "https://pubmed.ncbi.nlm.nih.gov/38565932" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "O94761-1", "protein_name": "ATP-dependent DNA helicase Q4", "gene_name": "RECQL4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O94761", "url": "https://www.uniprot.org/uniprotkb/O94761" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38565932", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A homozygous variant disrupting the PIGH start-codon is associated with developmental delay, epilepsy, and microcephaly.", "journal": "Hum. Mutat.", "date": "2018", "authors": "Pagnamenta AT, Murakami Y, Anzilotti C, Titheradge H, Oates AJ, Morton J, Kinoshita T, Kini U, Taylor JC", "reference": { "type": "PubMed", "id": "29573052", "url": "https://pubmed.ncbi.nlm.nih.gov/29573052" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14442-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit H", "gene_name": "PIGH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14442", "url": "https://www.uniprot.org/uniprotkb/Q14442" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs761543313", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761543313" }, { "id": "29573052", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29573052" } ], "glycoeffect": [], "start_pos": 1, "end_pos": 1, "sequence_org": "M", "sequence_mut": "L", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "14", "chr_pos": "67600203", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M1", "keywords": [ "ebi", "germline" ], "filter_code": "000000000000100000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q14442-1" } ], "record_id": "pubmed.29573052", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A PIGH mutation leading to GPI deficiency is associated with developmental delay and autism.", "journal": "Human mutation", "date": "2018", "authors": "Nguyen TTM, Mahida S, Smith-Hicks C, Campeau PM", "reference": { "type": "PubMed", "id": "29603516", "url": "https://pubmed.ncbi.nlm.nih.gov/29603516" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14442-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit H", "gene_name": "PIGH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14442", "url": "https://www.uniprot.org/uniprotkb/Q14442" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs776038451", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776038451" }, { "id": "rs776038451", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776038451" }, { "id": "rs776038451", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776038451#frequency_tab" }, { "id": "rs776038451", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776038451" }, { "id": "29603516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29603516" }, { "id": "33156547", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33156547" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 103, "end_pos": 103, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "14", "chr_pos": "67593826", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S103", "keywords": [ "ebi", "germline" ], "filter_code": "000000000000000100000.00000000000000.000000000001000000.00001.11.000.001", "uniprot_canonical_ac": "Q14442-1" } ], "record_id": "pubmed.29603516", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Loss of the GPI-anchor in B-lymphoblastic leukemia by epigenetic downregulation of PIGH expression.", "journal": "American journal of hematology", "date": "2019", "authors": "Loeff FC, Rijs K, van Egmond EHM, Zoutman WH, Qiao X, Kroes WGM, Veld SAJ, Griffioen M, Vermeer MH, Neefjes J, Frederik Falkenburg JH, Halkes CJM, Jedema I", "reference": { "type": "PubMed", "id": "30370942", "url": "https://pubmed.ncbi.nlm.nih.gov/30370942" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14442-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit H", "gene_name": "PIGH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14442", "url": "https://www.uniprot.org/uniprotkb/Q14442" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30370942", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PIGH deficiency can be associated with severe neurodevelopmental and skeletal manifestations.", "journal": "Clinical genetics", "date": "2021", "authors": "Tremblay-Laganiere C, Kaiyrzhanov R, Maroofian R, Nguyen TTM, Salayev K, Chilton IT, Chung WK, Madden JA, Phornphutkul C, Agrawal PB, Houlden H, Campeau PM", "reference": { "type": "PubMed", "id": "33156547", "url": "https://pubmed.ncbi.nlm.nih.gov/33156547" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14442-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit H", "gene_name": "PIGH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14442", "url": "https://www.uniprot.org/uniprotkb/Q14442" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs776038451", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776038451" }, { "id": "rs776038451", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776038451" }, { "id": "rs776038451", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776038451#frequency_tab" }, { "id": "rs776038451", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776038451" }, { "id": "29603516", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29603516" }, { "id": "33156547", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33156547" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 103, "end_pos": 103, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "14", "chr_pos": "67593826", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S103", "keywords": [ "ebi", "germline" ], "filter_code": "000000000000000100000.00000000000000.000000000001000000.00001.11.000.001", "uniprot_canonical_ac": "Q14442-1" }, { "evidence": [ { "id": "rs370763975", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370763975" }, { "id": "rs370763975", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370763975" }, { "id": "rs370763975", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370763975#frequency_tab" }, { "id": "rs370763975", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs370763975" }, { "id": "33156547", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33156547" }, { "id": "35445667", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35445667" } ], "glycoeffect": [], "start_pos": 163, "end_pos": 163, "sequence_org": "R", "sequence_mut": "W", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "14", "chr_pos": "67590160", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R163", "keywords": [ "ebi", "germline" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q14442-1" } ], "record_id": "pubmed.33156547", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "An epigenetic GPI anchor defect impairs TLR4 signaling in the B cell transdifferentiation model for primary human monocytes BLaER1.", "journal": "Scientific reports", "date": "2021", "authors": "Wegner J, Zillinger T, Schlee-Guimaraes TM, Bartok E, Schlee M", "reference": { "type": "PubMed", "id": "34294787", "url": "https://pubmed.ncbi.nlm.nih.gov/34294787" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14442-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit H", "gene_name": "PIGH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14442", "url": "https://www.uniprot.org/uniprotkb/Q14442" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34294787", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Homozygous variant p.(Arg163Trp) in PIGH causes glycosylphosphatidylinositol biosynthesis defect with epileptic encephalopathy and delayed myelination.", "journal": "Clinical dysmorphology", "date": "2022-10-01", "authors": "do Rosario Michelle C, Kaur Parneet, Girisha Katta Mohan, Bielas Stephanie, Shukla Anju", "reference": { "type": "PubMed", "id": "35445667", "url": "https://pubmed.ncbi.nlm.nih.gov/35445667" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14442-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit H", "gene_name": "PIGH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14442", "url": "https://www.uniprot.org/uniprotkb/Q14442" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs370763975", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370763975" }, { "id": "rs370763975", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370763975" }, { "id": "rs370763975", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370763975#frequency_tab" }, { "id": "rs370763975", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs370763975" }, { "id": "33156547", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/33156547" }, { "id": "35445667", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/35445667" } ], "glycoeffect": [], "start_pos": 163, "end_pos": 163, "sequence_org": "R", "sequence_mut": "W", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "14", "chr_pos": "67590160", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R163", "keywords": [ "ebi", "germline" ], "filter_code": "010000000000000000000.00000000000000.000000000001000000.00001.11.000.000", "uniprot_canonical_ac": "Q14442-1" } ], "record_id": "pubmed.35445667", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Correction of the class H defect in glycosylphosphatidylinositol anchor biosynthesis in Ltk- cells by a human cDNA clone.", "journal": "J. Biol. Chem.", "date": "1993", "authors": "Kamitani T, Chang H M, Rollins C, Waneck G L, Yeh E T", "reference": { "type": "PubMed", "id": "8407896", "url": "https://pubmed.ncbi.nlm.nih.gov/8407896" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q14442-1", "protein_name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit H", "gene_name": "PIGH", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q14442", "url": "https://www.uniprot.org/uniprotkb/Q14442" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8407896", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Serological cloning of a melanocyte rab guanosine 5'-triphosphate-binding protein and a chromosome condensation protein from a melanoma complementary DNA library.", "journal": "Cancer Res.", "date": "2000", "authors": "Jager D, Stockert E, Jager E, Gure AO, Scanlan MJ, Knuth A, Old LJ, Chen YT", "reference": { "type": "PubMed", "id": "10910072", "url": "https://pubmed.ncbi.nlm.nih.gov/10910072" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P57729-1", "protein_name": "Ras-related protein Rab-38", "gene_name": "RAB38", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9BPX3-1", "protein_name": "Condensin complex subunit 3", "gene_name": "NCAPG", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P57729", "url": "https://www.uniprot.org/uniprotkb/P57729" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10910072", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Characterization of the human RAB38 and RAB7 genes: exclusion of new major pathological loci for Japanese OCA.", "journal": "Journal of dermatological science", "date": "2003", "authors": "Suzuki T, Miyamura Y, Inagaki K, Tomita Y", "reference": { "type": "PubMed", "id": "12850305", "url": "https://pubmed.ncbi.nlm.nih.gov/12850305" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P57729-1", "protein_name": "Ras-related protein Rab-38", "gene_name": "RAB38", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P57729", "url": "https://www.uniprot.org/uniprotkb/P57729" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12850305", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "RAB38 Facilitates Energy Metabolism and Counteracts Cell Death in Glioblastoma Cells.", "journal": "Cells", "date": "2021", "authors": "Bianchetti E, Bates SJ, Nguyen TTT, Siegelin MD, Roth KA", "reference": { "type": "PubMed", "id": "34209035", "url": "https://pubmed.ncbi.nlm.nih.gov/34209035" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P57729-1", "protein_name": "Ras-related protein Rab-38", "gene_name": "RAB38", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P57729", "url": "https://www.uniprot.org/uniprotkb/P57729" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34209035", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Evaluation of CRISPR/Cas9 exon-skipping vector for choroideremia using human induced pluripotent stem cell-derived RPE.", "journal": "The journal of gene medicine", "date": "2022-11-22", "authors": "Iwagawa Toshiro, Masumoto Hiroki, Tabuchi Hitoshi, Tani Kenzaburo, Conklin Bruce R, Watanabe Sumiko", "reference": { "type": "PubMed", "id": "36413603", "url": "https://pubmed.ncbi.nlm.nih.gov/36413603" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P57729-1", "protein_name": "Ras-related protein Rab-38", "gene_name": "RAB38", "tax_name": "Human" }, { "uniprot_canonical_ac": "P24386-1", "protein_name": "Rab proteins geranylgeranyltransferase component A 1", "gene_name": "CHM", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P57729", "url": "https://www.uniprot.org/uniprotkb/P57729" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36413603", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A pathogenic variant in the uncharacterized RNF212B gene results in severe aneuploidy male infertility and repeated IVF failure.", "journal": "HGG advances", "date": "2023-07-13", "authors": "Gershoni Moran, Braun Tslil, Hauser Ron, Barda Shimi, Lehavi Ofer, Malcov Mira, Frumkin Tsvia, Kalma Yael, Pietrokovski Shmuel, Arama Eli, Kleiman Sandra E", "reference": { "type": "PubMed", "id": "37124137", "url": "https://pubmed.ncbi.nlm.nih.gov/37124137" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "A8MTL3-1", "protein_name": "E3 ubiquitin-protein ligase RNF212B", "gene_name": "RNF212B", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "A8MTL3", "url": "https://www.uniprot.org/uniprotkb/A8MTL3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.37124137", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Syndrome of developmental retardation, facial and skeletal anomalies, and hyperphosphatasia in two sisters: nosology and genetics of the Coffin-Siris syndrome.", "journal": "American journal of medical genetics", "date": "1991-12-01", "authors": "Rabe P, Haverkamp F, Emons D, Rosskamp R, Zerres K, Passarge E", "reference": { "type": "PubMed", "id": "1724113", "url": "https://pubmed.ncbi.nlm.nih.gov/1724113" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs139073416", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139073416#frequency_tab" }, { "id": "rs139073416", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139073416" }, { "id": "1724113", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1724113" }, { "id": "20578257", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20578257" }, { "id": "20802478", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" }, { "id": "21739589", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21739589" }, { "id": "22315194", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22315194" } ], "glycoeffect": [], "start_pos": 341, "end_pos": 341, "sequence_org": "A", "sequence_mut": "E", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26795056", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A341", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "100000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" } ], "record_id": "pubmed.1724113", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Severe mental retardation, epilepsy, anal anomalies, and distal phalangeal hypoplasia in siblings.", "journal": "Clinical dysmorphology", "date": "2007-04", "authors": "Marcelis Carlo L, Rieu Paul, Beemer Frits, Brunner Han G", "reference": { "type": "PubMed", "id": "17351347", "url": "https://pubmed.ncbi.nlm.nih.gov/17351347" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs267606952", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267606952" }, { "id": "rs267606952", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs267606952" }, { "id": "17351347", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17351347" }, { "id": "20802478", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" } ], "glycoeffect": [], "start_pos": 256, "end_pos": 256, "sequence_org": "Q", "sequence_mut": "K", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26794800", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Q256", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000100000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" } ], "record_id": "pubmed.17351347", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hyperphosphatasia with seizures, neurologic deficit, and characteristic facial features: Five new patients with Mabry syndrome.", "journal": "American journal of medical genetics. Part A", "date": "2010-07", "authors": "Thompson Miles D, Nezarati Marjan M, Gillessen-Kaesbach Gabriele, Meinecke Peter, Mendoza-Londono Roberto, Mendoza Roberto, Mornet Etienne, Brun-Heath Isabelle, Squarcioni Catherine Prost, Legeai-Mallet Laurence, Munnich Arnold, Cole David E C", "reference": { "type": "PubMed", "id": "20578257", "url": "https://pubmed.ncbi.nlm.nih.gov/20578257" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs139073416", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139073416#frequency_tab" }, { "id": "rs139073416", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139073416" }, { "id": "1724113", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1724113" }, { "id": "20578257", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20578257" }, { "id": "20802478", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" }, { "id": "21739589", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21739589" }, { "id": "22315194", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22315194" } ], "glycoeffect": [], "start_pos": 341, "end_pos": 341, "sequence_org": "A", "sequence_mut": "E", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26795056", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A341", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "100000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" } ], "record_id": "pubmed.20578257", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identity-by-descent filtering of exome sequence data identifies PIGV mutations in hyperphosphatasia mental retardation syndrome.", "journal": "Nature genetics", "date": "2010", "authors": "Krawitz PM, Schweiger MR, Rodelsperger C, Marcelis C, Kolsch U, Meisel C, Stephani F, Kinoshita T, Murakami Y, Bauer S, Isau M, Fischer A, Dahl A, Kerick M, Hecht J, Kohler S, Jager M, Grunhagen J, de Condor BJ, Doelken S, Brunner HG, Meinecke P, Passarge E, Thompson MD, Cole DE, Horn D, Roscioli T, Mundlos S, Robinson PN", "reference": { "type": "PubMed", "id": "20802478", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs267606952", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267606952" }, { "id": "rs267606952", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs267606952" }, { "id": "17351347", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/17351347" }, { "id": "20802478", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" } ], "glycoeffect": [], "start_pos": 256, "end_pos": 256, "sequence_org": "Q", "sequence_mut": "K", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26794800", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "Q256", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000100000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" }, { "evidence": [ { "id": "rs139073416", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139073416#frequency_tab" }, { "id": "rs139073416", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139073416" }, { "id": "1724113", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1724113" }, { "id": "20578257", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20578257" }, { "id": "20802478", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" }, { "id": "21739589", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21739589" }, { "id": "22315194", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22315194" } ], "glycoeffect": [], "start_pos": 341, "end_pos": 341, "sequence_org": "A", "sequence_mut": "E", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26795056", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A341", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "100000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" }, { "evidence": [ { "id": "rs139073416", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139073416#frequency_tab" }, { "id": "rs139073416", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139073416" }, { "id": "20802478", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" } ], "glycoeffect": [], "start_pos": 341, "end_pos": 341, "sequence_org": "A", "sequence_mut": "V", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26795056", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A341", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "100000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" }, { "evidence": [ { "id": "rs267606951", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267606951" }, { "id": "rs267606951", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs267606951" }, { "id": "rs267606951", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs267606951" }, { "id": "20802478", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" } ], "glycoeffect": [], "start_pos": 385, "end_pos": 385, "sequence_org": "H", "sequence_mut": "P", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26795188", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "H385", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000000001000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" } ], "record_id": "pubmed.20802478", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hyperphosphatasia-mental retardation syndrome due to PIGV mutations: expanded clinical spectrum.", "journal": "American journal of medical genetics. Part A", "date": "2011", "authors": "Horn D, Krawitz P, Mannhardt A, Korenke GC, Meinecke P", "reference": { "type": "PubMed", "id": "21739589", "url": "https://pubmed.ncbi.nlm.nih.gov/21739589" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs387907023", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387907023" }, { "id": "rs387907023", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs387907023" }, { "id": "rs387907023", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs387907023#frequency_tab" }, { "id": "rs387907023", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs387907023" }, { "id": "21739589", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21739589" } ], "glycoeffect": [], "start_pos": 156, "end_pos": 156, "sequence_org": "C", "sequence_mut": "Y", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26794501", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C156", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "000010000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" }, { "evidence": [ { "id": "rs139073416", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139073416#frequency_tab" }, { "id": "rs139073416", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139073416" }, { "id": "1724113", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1724113" }, { "id": "20578257", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20578257" }, { "id": "20802478", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" }, { "id": "21739589", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21739589" }, { "id": "22315194", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22315194" } ], "glycoeffect": [], "start_pos": 341, "end_pos": 341, "sequence_org": "A", "sequence_mut": "E", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26795056", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A341", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "100000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" } ], "record_id": "pubmed.21739589", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mechanism for release of alkaline phosphatase caused by glycosylphosphatidylinositol deficiency in patients with hyperphosphatasia mental retardation syndrome.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Murakami Y, Kanzawa N, Saito K, Krawitz PM, Mundlos S, Robinson PN, Karadimitris A, Maeda Y, Kinoshita T", "reference": { "type": "PubMed", "id": "22228761", "url": "https://pubmed.ncbi.nlm.nih.gov/22228761" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22228761", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phenotypic variability in hyperphosphatasia with seizures and neurologic deficit (Mabry syndrome).", "journal": "American journal of medical genetics. Part A", "date": "2012-03", "authors": "Thompson Miles D, Roscioli Tony, Marcelis Carlo, Nezarati Marjan M, Stolte-Dijkstra Irene, Sharom Frances J, Lu Peihua, Phillips John A, Sweeney Elizabeth, Robinson Peter N, Krawitz Peter, Yntema Helger G, Andrade Danielle M, Brunner Han G, Cole David E C", "reference": { "type": "PubMed", "id": "22315194", "url": "https://pubmed.ncbi.nlm.nih.gov/22315194" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "snv": [ { "evidence": [ { "id": "rs376328153", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376328153" }, { "id": "rs376328153", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376328153" }, { "id": "rs376328153", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376328153#frequency_tab" }, { "id": "rs376328153", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs376328153" }, { "id": "22315194", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22315194" } ], "glycoeffect": [], "start_pos": 165, "end_pos": 165, "sequence_org": "A", "sequence_mut": "E", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26794528", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A165", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "100000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" }, { "evidence": [ { "id": "rs139073416", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs139073416" }, { "id": "rs139073416", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs139073416#frequency_tab" }, { "id": "rs139073416", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs139073416" }, { "id": "1724113", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/1724113" }, { "id": "20578257", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20578257" }, { "id": "20802478", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/20802478" }, { "id": "21739589", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/21739589" }, { "id": "22315194", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/22315194" } ], "glycoeffect": [], "start_pos": 341, "end_pos": 341, "sequence_org": "A", "sequence_mut": "E", "comment": "Germline mutation passed 1 filters: glycogene of type=glycogene, glycosyltransferase.", "chr_id": "1", "chr_pos": "26795056", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A341", "disease": [ { "disease_id": "DOID:0070431", "recommended_name": { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with impaired intellectual development syndrome", "description": "An autosomal recessive intellectual developmental disorder characterized by hyperphosphatasia and intellectual disability. Distinctive facial features including hypertelorism, long palpebral fissures, a nose with a broad bridge and a rounded tip, downturned corners of the mouth, and a thin upper lip are also often observed." }, "synonyms": [ { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "HPMRS", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry disease", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "Mabry syndrome", "description": "" }, { "id": "DOID:0070431", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070431", "name": "hyperphosphatasia with mental retardation syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0070431", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070431" } ] }, { "disease_id": "DOID:0070433", "recommended_name": { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with impaired intellectual development syndrome 1", "description": "A hyperphosphatasia with impaired intellectual development syndrome that has_material_basis_in homozygous or compound heterozygous mutation in the PIGV gene on chromosome 1p36." }, "synonyms": [ { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "GPIBD2", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "HPMRS1", "description": "" }, { "id": "DOID:0070433", "resource": "Disease Ontology", "url": "https://disease-ontology.org/term/DOID:0070433", "name": "glycosylphosphatidylinositol biosynthesis defect 2", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "Any hyperphosphatasia-intellectual disability syndrome in which the cause of the disease is a mutation in the PIGV gene." }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "PIGV hyperphosphatasia-intellectual disability syndrome", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with intellectual disability syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia with mental retardation syndrome type 1", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "hyperphosphatasia-intellectual disability syndrome caused by mutation in PIGV", "description": "" }, { "id": "MONDO:0009398", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398", "name": "HPMRS1", "description": "" }, { "id": "MIM:239300", "resource": "MIM", "url": "https://www.omim.org/entry/239300", "name": "Hyperphosphatasia with impaired intellectual development syndrome 1", "description": "Hyperphosphatasia with impaired intellectual development syndrome 1" } ], "unlinked_id_list": [], "evidence": [ { "id": "0009398", "database": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009398" }, { "id": "239300", "database": "MIM", "url": "https://www.omim.org/entry/239300" }, { "id": "PIGV", "database": "Genomics England", "url": "https://panelapp.genomicsengland.co.uk/panels/25/gene/PIGV/#!details" }, { "id": "55650", "database": "GlyCosmos", "url": "https://glycosmos.org/glycogenes/show/55650#disease" }, { "id": "0070433", "database": "AGR", "url": "https://www.alliancegenome.org/disease/DOID:0070433" } ] } ], "keywords": [ "ebi", "germline", "disease" ], "filter_code": "100000000000000000000.00000000000000.000000000001000000.00001.10.000.000", "uniprot_canonical_ac": "Q9NUD9-1" } ], "record_id": "pubmed.22315194", "abstract": "", "glycosylation": [], "mutagenesis": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Glycosylphosphatidylinositol mannosyltransferase II is the rate-limiting enzyme in glycosylphosphatidylinositol biosynthesis under limited dolichol-phosphate mannose availability.", "journal": "Journal of biochemistry", "date": "2013", "authors": "Hirata T, Fujita M, Kanzawa N, Murakami Y, Maeda Y, Kinoshita T", "reference": { "type": "PubMed", "id": "23694781", "url": "https://pubmed.ncbi.nlm.nih.gov/23694781" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" }, { "uniprot_canonical_ac": "A0A8C2M425-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Chinese hamster" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23694781", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Delineation of PIGV mutation spectrum and associated phenotypes in hyperphosphatasia with mental retardation syndrome.", "journal": "European journal of human genetics : EJHG", "date": "2014", "authors": "Horn D, Wieczorek D, Metcalfe K, Baric I, Palezac L, Cuk M, Petkovic Ramadza D, Kruger U, Demuth S, Heinritz W, Linden T, Koenig J, Robinson PN, Krawitz P", "reference": { "type": "PubMed", "id": "24129430", "url": "https://pubmed.ncbi.nlm.nih.gov/24129430" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24129430", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Familial hyperphosphatase with mental retardation, seizures, and neurologic deficits.", "journal": "J. Pediatr.", "date": "1970", "authors": "Mabry C C, Bautista A, Kirk R F, Dubilier L D, Braunstein H, Koepke J A", "reference": { "type": "PubMed", "id": "5465362", "url": "https://pubmed.ncbi.nlm.nih.gov/5465362" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9NUD9-1", "protein_name": "GPI alpha-1,6-mannosyltransferase 2", "gene_name": "PIGV", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9NUD9", "url": "https://www.uniprot.org/uniprotkb/Q9NUD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.5465362", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The human REV1 gene codes for a DNA template-dependent dCMP transferase.", "journal": "Nucleic acids research", "date": "1999", "authors": "Lin W, Xin H, Zhang Y, Wu X, Yuan F, Wang Z", "reference": { "type": "PubMed", "id": "10536157", "url": "https://pubmed.ncbi.nlm.nih.gov/10536157" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10536157", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A human REV7 homolog that interacts with the polymerase zeta catalytic subunit hREV3 and the spindle assembly checkpoint protein hMAD2.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Murakumo Y, Roth T, Ishii H, Rasio D, Numata S, Croce CM, Fishel R", "reference": { "type": "PubMed", "id": "10660610", "url": "https://pubmed.ncbi.nlm.nih.gov/10660610" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10660610", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The function of the human homolog of Saccharomyces cerevisiae REV1 is required for mutagenesis induced by UV light.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Gibbs PE, Wang XD, Li Z, McManus TP, McGregor WG, Lawrence CW, Maher VM", "reference": { "type": "PubMed", "id": "10760286", "url": "https://pubmed.ncbi.nlm.nih.gov/10760286" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.10760286", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interactions in the error-prone postreplication repair proteins hREV1, hREV3, and hREV7.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Murakumo Y, Ogura Y, Ishii H, Numata S, Ichihara M, Croce CM, Fishel R, Takahashi M", "reference": { "type": "PubMed", "id": "11485998", "url": "https://pubmed.ncbi.nlm.nih.gov/11485998" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11485998", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Response of human REV1 to different DNA damage: preferential dCMP insertion opposite the lesion.", "journal": "Nucleic acids research", "date": "2002", "authors": "Zhang Y, Wu X, Rechkoblit O, Geacintov NE, Taylor JS, Wang Z", "reference": { "type": "PubMed", "id": "11917024", "url": "https://pubmed.ncbi.nlm.nih.gov/11917024" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11917024", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Mammalian translesion DNA synthesis across an acrolein-derived deoxyguanosine adduct. Participation of DNA polymerase eta in error-prone synthesis in human cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang IY, Miller H, Wang Z, Frank EG, Ohmori H, Hanaoka F, Moriya M", "reference": { "type": "PubMed", "id": "12584190", "url": "https://pubmed.ncbi.nlm.nih.gov/12584190" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA4-1", "protein_name": "DNA polymerase iota", "gene_name": "POLI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12584190", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Studies of the cloned 37-kDa subunit of activator 1 (replication factor C) of HeLa cells.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1992", "authors": "Chen M, Pan ZQ, Hurwitz J", "reference": { "type": "PubMed", "id": "1351677", "url": "https://pubmed.ncbi.nlm.nih.gov/1351677" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.1351677", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Interaction of hREV1 with three human Y-family DNA polymerases.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2004", "authors": "Ohashi E, Murakumo Y, Kanjo N, Akagi J, Masutani C, Hanaoka F, Ohmori H", "reference": { "type": "PubMed", "id": "15189446", "url": "https://pubmed.ncbi.nlm.nih.gov/15189446" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA4-1", "protein_name": "DNA polymerase iota", "gene_name": "POLI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15189446", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Replication by human DNA polymerase-iota occurs by Hoogsteen base-pairing.", "journal": "Nature", "date": "2004", "authors": "Nair DT, Johnson RE, Prakash S, Prakash L, Aggarwal AK", "reference": { "type": "PubMed", "id": "15254543", "url": "https://pubmed.ncbi.nlm.nih.gov/15254543" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA4-1", "protein_name": "DNA polymerase iota", "gene_name": "POLI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15254543", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A single domain in human DNA polymerase iota mediates interaction with PCNA: implications for translesion DNA synthesis.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Haracska L, Acharya N, Unk I, Johnson RE, Hurwitz J, Prakash L, Prakash S", "reference": { "type": "PubMed", "id": "15657443", "url": "https://pubmed.ncbi.nlm.nih.gov/15657443" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA4-1", "protein_name": "DNA polymerase iota", "gene_name": "POLI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15657443", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitinated proliferating cell nuclear antigen activates translesion DNA polymerases eta and REV1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Garg P, Burgers PM", "reference": { "type": "PubMed", "id": "16344468", "url": "https://pubmed.ncbi.nlm.nih.gov/16344468" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16344468", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Ubiquitin-binding domains in Y-family polymerases regulate translesion synthesis.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Bienko M, Green CM, Crosetto N, Rudolf F, Zapart G, Coull B, Kannouche P, Wider G, Peter M, Lehmann AR, Hofmann K, Dikic I", "reference": { "type": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q6R3M4-1", "protein_name": "DNA polymerase iota", "gene_name": "Poli", "tax_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y253-1", "protein_name": "DNA polymerase eta", "gene_name": "POLH", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA4-1", "protein_name": "DNA polymerase iota", "gene_name": "POLI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 496, "end_pos": 524, "sequence_org": "LPEGVDQEVFKQLPADIQEEILYGKSREN", "sequence_mut": "", "comment": "Abolishes ubiquitin binding and localization to nuclear foci after UV-induced DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "Q6R3M4", "url": "https://www.uniprot.org/uniprotkb/Q6R3M4" }, { "database": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" } ], "uniprot_canonical_ac": "Q6R3M4-1" }, { "start_pos": 508, "end_pos": 508, "sequence_org": "L", "sequence_mut": "A", "comment": "Impairs ubiquitin binding and post-translation modification via ubiquitination; when associated with A-509. Abolishes ubiquitin binding and localization to nuclear foci after UV-induced DNA damage but does not affect catalytic activity; when associated with A-508, A-693 and A-694.", "evidence": [ { "database": "UniProtKB", "id": "Q6R3M4", "url": "https://www.uniprot.org/uniprotkb/Q6R3M4" }, { "database": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" } ], "uniprot_canonical_ac": "Q6R3M4-1" }, { "start_pos": 509, "end_pos": 509, "sequence_org": "P", "sequence_mut": "A", "comment": "Impairs ubiquitin binding and post-translation modification via ubiquitination; when associated with A-508. Abolishes ubiquitin binding and localization to nuclear foci after UV-induced DNA damage but does not affect catalytic activity; when associated with A-509, A-693 and A-694.", "evidence": [ { "database": "UniProtKB", "id": "Q6R3M4", "url": "https://www.uniprot.org/uniprotkb/Q6R3M4" }, { "database": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" } ], "uniprot_canonical_ac": "Q6R3M4-1" }, { "start_pos": 681, "end_pos": 709, "sequence_org": "FPPDIDPQVFYELPEEVQKELMAEWERAG", "sequence_mut": "", "comment": "Abolishes ubiquitin binding and localization to nuclear foci after UV-induced DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "Q6R3M4", "url": "https://www.uniprot.org/uniprotkb/Q6R3M4" }, { "database": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" } ], "uniprot_canonical_ac": "Q6R3M4-1" }, { "start_pos": 693, "end_pos": 693, "sequence_org": "L", "sequence_mut": "A", "comment": "Impairs ubiquitin binding and post-translation modification via ubiquitination; when associated with A-694. Abolishes ubiquitin binding and localization to nuclear foci after UV-induced DNA damage but does not affect catalytic activity; when associated with A-508, A-509 and A-694.", "evidence": [ { "database": "UniProtKB", "id": "Q6R3M4", "url": "https://www.uniprot.org/uniprotkb/Q6R3M4" }, { "database": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" } ], "uniprot_canonical_ac": "Q6R3M4-1" }, { "start_pos": 694, "end_pos": 694, "sequence_org": "P", "sequence_mut": "A", "comment": "Impairs ubiquitin binding and post-translation modification via ubiquitination; when associated with A-693. Abolishes ubiquitin binding and localization to nuclear foci after UV-induced DNA damage but does not affect catalytic activity; when associated with A-508, A-509 and A-693.", "evidence": [ { "database": "UniProtKB", "id": "Q6R3M4", "url": "https://www.uniprot.org/uniprotkb/Q6R3M4" }, { "database": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" } ], "uniprot_canonical_ac": "Q6R3M4-1" }, { "start_pos": 638, "end_pos": 638, "sequence_org": "C", "sequence_mut": "A", "comment": "Reduces cell resistance to UV-induced DNA damage.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y253", "url": "https://www.uniprot.org/uniprotkb/Q9Y253" }, { "database": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" } ], "uniprot_canonical_ac": "Q9Y253-1" }, { "start_pos": 652, "end_pos": 652, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes ubiquitin binding and localization to nuclear foci after UV-induced DNA damage but does not affect catalytic activity.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y253", "url": "https://www.uniprot.org/uniprotkb/Q9Y253" }, { "database": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" } ], "uniprot_canonical_ac": "Q9Y253-1" }, { "start_pos": 705, "end_pos": 713, "sequence_org": "ESFFKPLTH", "sequence_mut": "", "comment": "Reduces cell resistance to UV-induced DNA damage. Reduces binding to chromatin and to monoubiquitinated PCNA. Abolishes binding to monoubiquitinated PCNA; when associated with 324-A--A-326.", "evidence": [ { "database": "UniProtKB", "id": "Q9Y253", "url": "https://www.uniprot.org/uniprotkb/Q9Y253" }, { "database": "PubMed", "id": "15149598", "url": "https://pubmed.ncbi.nlm.nih.gov/15149598" }, { "database": "PubMed", "id": "16357261", "url": "https://pubmed.ncbi.nlm.nih.gov/16357261" } ], "uniprot_canonical_ac": "Q9Y253-1" } ], "record_id": "pubmed.16357261", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 19 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Hoogsteen base pair formation promotes synthesis opposite the 1,N6-ethenodeoxyadenosine lesion by human DNA polymerase iota.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Nair DT, Johnson RE, Prakash L, Prakash S, Aggarwal AK", "reference": { "type": "PubMed", "id": "16819516", "url": "https://pubmed.ncbi.nlm.nih.gov/16819516" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA4-1", "protein_name": "DNA polymerase iota", "gene_name": "POLI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16819516", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A ubiquitin-binding motif in the translesion DNA polymerase Rev1 mediates its essential functional interaction with ubiquitinated proliferating cell nuclear antigen in response to DNA damage.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Wood A, Garg P, Burgers PM", "reference": { "type": "PubMed", "id": "17517887", "url": "https://pubmed.ncbi.nlm.nih.gov/17517887" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.17517887", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Comparative analysis of in vivo interactions between Rev1 protein and other Y-family DNA polymerases in animals and yeasts.", "journal": "DNA repair", "date": "2008", "authors": "Kosarek JN, Woodruff RV, Rivera-Begeman A, Guo C, D'Souza S, Koonin EV, Walker GC, Friedberg EC", "reference": { "type": "PubMed", "id": "18242152", "url": "https://pubmed.ncbi.nlm.nih.gov/18242152" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA4-1", "protein_name": "DNA polymerase iota", "gene_name": "POLI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12689-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P38927-1", "protein_name": "DNA polymerase zeta processivity subunit", "gene_name": "REV7", "tax_name": "Baker's yeast" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9W0P2-1", "protein_name": "DNA repair protein Rev1", "gene_name": "Rev1", "tax_name": "Fruit fly" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.18242152", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Unconventional ubiquitin recognition by the ubiquitin-binding motif within the Y family DNA polymerases iota and Rev1.", "journal": "Molecular cell", "date": "2010", "authors": "Bomar MG, D'Souza S, Bienko M, Dikic I, Walker GC, Zhou P", "reference": { "type": "PubMed", "id": "20159559", "url": "https://pubmed.ncbi.nlm.nih.gov/20159559" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UNA4-1", "protein_name": "DNA polymerase iota", "gene_name": "POLI", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20159559", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Crystal structure of human REV7 in complex with a human REV3 fragment and structural implication of the interaction between DNA polymerase zeta and REV1.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Hara K, Hashimoto H, Murakumo Y, Kobayashi S, Kogame T, Unzai S, Akashi S, Takeda S, Shimizu T, Sato M", "reference": { "type": "PubMed", "id": "20164194", "url": "https://pubmed.ncbi.nlm.nih.gov/20164194" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q4KWZ6-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Chicken" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "mutagenesis": [ { "start_pos": 171, "end_pos": 171, "sequence_org": "W", "sequence_mut": "A", "comment": "Loss of function in DNA repair; when associated with Y-63.", "evidence": [ { "database": "UniProtKB", "id": "Q4KWZ6", "url": "https://www.uniprot.org/uniprotkb/Q4KWZ6" }, { "database": "PubMed", "id": "20164194", "url": "https://pubmed.ncbi.nlm.nih.gov/20164194" } ], "uniprot_canonical_ac": "Q4KWZ6-1" }, { "start_pos": 63, "end_pos": 63, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of function in DNA repair; when associated with W-171.", "evidence": [ { "database": "UniProtKB", "id": "Q4KWZ6", "url": "https://www.uniprot.org/uniprotkb/Q4KWZ6" }, { "database": "PubMed", "id": "20164194", "url": "https://pubmed.ncbi.nlm.nih.gov/20164194" } ], "uniprot_canonical_ac": "Q4KWZ6-1" }, { "start_pos": 124, "end_pos": 124, "sequence_org": "R", "sequence_mut": "A", "comment": "Induces structural changes that increase affinity for REV3L and REV1. No effect on interaction with REV1; when associated with A-171.", "evidence": [ { "database": "UniProtKB", "id": "Q9UI95", "url": "https://www.uniprot.org/uniprotkb/Q9UI95" }, { "database": "PubMed", "id": "20164194", "url": "https://pubmed.ncbi.nlm.nih.gov/20164194" } ], "uniprot_canonical_ac": "Q9UI95-1" }, { "start_pos": 171, "end_pos": 171, "sequence_org": "W", "sequence_mut": "A", "comment": "Alters interaction with REV3L and REV1. Loss of interaction with REV3L; when associated with A-63. No effect on interaction with REV1; when associated with A-124.", "evidence": [ { "database": "UniProtKB", "id": "Q9UI95", "url": "https://www.uniprot.org/uniprotkb/Q9UI95" }, { "database": "PubMed", "id": "20164194", "url": "https://pubmed.ncbi.nlm.nih.gov/20164194" } ], "uniprot_canonical_ac": "Q9UI95-1" }, { "start_pos": 186, "end_pos": 186, "sequence_org": "L", "sequence_mut": "A", "comment": "Significantly prevents interaction with REV1; no effect on interaction with REV3L.", "evidence": [ { "database": "UniProtKB", "id": "Q9UI95", "url": "https://www.uniprot.org/uniprotkb/Q9UI95" }, { "database": "PubMed", "id": "20164194", "url": "https://pubmed.ncbi.nlm.nih.gov/20164194" } ], "uniprot_canonical_ac": "Q9UI95-1" }, { "start_pos": 200, "end_pos": 200, "sequence_org": "Q", "sequence_mut": "A", "comment": "Significantly prevents interaction with REV1; no effect on interaction with REV3L.", "evidence": [ { "database": "UniProtKB", "id": "Q9UI95", "url": "https://www.uniprot.org/uniprotkb/Q9UI95" }, { "database": "PubMed", "id": "20164194", "url": "https://pubmed.ncbi.nlm.nih.gov/20164194" } ], "uniprot_canonical_ac": "Q9UI95-1" }, { "start_pos": 202, "end_pos": 202, "sequence_org": "Y", "sequence_mut": "A", "comment": "Significantly prevents interaction with REV1; no effect on interaction with REV3L.", "evidence": [ { "database": "UniProtKB", "id": "Q9UI95", "url": "https://www.uniprot.org/uniprotkb/Q9UI95" }, { "database": "PubMed", "id": "20164194", "url": "https://pubmed.ncbi.nlm.nih.gov/20164194" } ], "uniprot_canonical_ac": "Q9UI95-1" }, { "start_pos": 63, "end_pos": 63, "sequence_org": "Y", "sequence_mut": "A", "comment": "Alters interaction with REV3L. Loss of interaction with REV3L; when associated with A-171.", "evidence": [ { "database": "UniProtKB", "id": "Q9UI95", "url": "https://www.uniprot.org/uniprotkb/Q9UI95" }, { "database": "PubMed", "id": "20164194", "url": "https://pubmed.ncbi.nlm.nih.gov/20164194" } ], "uniprot_canonical_ac": "Q9UI95-1" } ], "record_id": "pubmed.20164194", "abstract": "", "glycosylation": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 17 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structural basis of recruitment of DNA polymerase zeta by interaction between REV1 and REV7 proteins.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Kikuchi S, Hara K, Shimizu T, Sato M, Hashimoto H", "reference": { "type": "PubMed", "id": "22859296", "url": "https://pubmed.ncbi.nlm.nih.gov/22859296" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35244-1", "protein_name": "Replication protein A 14 kDa subunit", "gene_name": "RPA3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P27694-1", "protein_name": "Replication protein A 70 kDa DNA-binding subunit", "gene_name": "RPA1", "tax_name": "Human" }, { "uniprot_canonical_ac": "O60673-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "REV3L", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P15927-1", "protein_name": "Replication protein A 32 kDa subunit", "gene_name": "RPA2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P12004-1", "protein_name": "DNA sliding clamp PCNA", "gene_name": "PCNA", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62979-1", "protein_name": "Ubiquitin-ribosomal protein eS31 fusion protein", "gene_name": "RPS27A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG47-1", "protein_name": "Polyubiquitin-B", "gene_name": "UBB", "tax_name": "Human" }, { "uniprot_canonical_ac": "P62987-1", "protein_name": "Ubiquitin-ribosomal protein eL40 fusion protein", "gene_name": "UBA52", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UBZ9-1", "protein_name": "Translesion synthesis protein REV1", "gene_name": "REV1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P0CG48-1", "protein_name": "Polyubiquitin-C", "gene_name": "UBC", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q9UI95-1", "protein_name": "Mitotic spindle assembly checkpoint protein MAD2B", "gene_name": "MAD2L2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22859296", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 16 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Sequential gene expression analysis of cervical malignant transformation identifies RFC4 as a novel diagnostic and prognostic biomarker.", "journal": "BMC medicine", "date": "2022-11-09", "authors": "Zhang Jianwei, Meng Silu, Wang Xiaoyan, Wang Jun, Fan Xinran, Sun Haiying, Ning Ruoqi, Xiao Bing, Li Xiangqin, Jia Yao, Kong Dongli, Chen Ruqi, Wang Changyu, Ma Ding, Li Shuang", "reference": { "type": "PubMed", "id": "36352434", "url": "https://pubmed.ncbi.nlm.nih.gov/36352434" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36352434", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Knockdown of RFC4 inhibits the cell proliferation of nasopharyngeal carcinoma in vitro and in vivo.", "journal": "Frontiers of medicine", "date": "2023-02", "authors": "Guan Shuzhen, Feng Lin, Wei Jinrui, Wang Guizhen, Wu Lichuan", "reference": { "type": "PubMed", "id": "36562948", "url": "https://pubmed.ncbi.nlm.nih.gov/36562948" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.36562948", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Expanding the genetic and phenotypic landscape of replication factor C complex-related disorders: RFC4 deficiency is linked to a multisystemic disorder.", "journal": "American journal of human genetics", "date": "2024-09-05", "authors": "Morimoto Marie, Ryu Eunjin, Steger Benjamin J, Dixit Abhijit, Saito Yoshihiko, Yoo Juyeong, van der Ven Amelie T, Hauser Natalie, Steinbach Peter J, Oura Kazumasa, Huang Alden Y, Kort\u00fcm Fanny, Ninomiya Shinsuke, Rosenthal Elisabeth A, Robinson Hannah K, Guegan Katie, Denecke Jonas, Subramony Sankarasubramoney H, Diamonstein Callie J, Ping Jie, Fenner Mark, Balton Elsa V, Strohbehn Sam, Allworth Aimee, Bamshad Michael J, Gandhi Mahi, Dipple Katrina M, Blue Elizabeth E, Jarvik Gail P, , Lau C Christopher, Holm Ingrid A, Weisz-Hubshman Monika, Solomon Benjamin D, , Nelson Stanley F, Nishino Ichizo, Adams David R, Kang Sukhyun, Gahl William A, Toro Camilo, Myung Kyungjae, Malicdan May Christine V", "reference": { "type": "PubMed", "id": "39106866", "url": "https://pubmed.ncbi.nlm.nih.gov/39106866" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q96QE3-1", "protein_name": "ATPase family AAA domain-containing protein 5", "gene_name": "ATAD5", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8WVB6-1", "protein_name": "Chromosome transmission fidelity protein 18 homolog", "gene_name": "CHTF18", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39106866", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 3 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Reconstitution of recombinant human replication factor C (RFC) and identification of an RFC subcomplex possessing DNA-dependent ATPase activity.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Ellison V, Stillman B", "reference": { "type": "PubMed", "id": "9488738", "url": "https://pubmed.ncbi.nlm.nih.gov/9488738" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P35249-1", "protein_name": "Replication factor C subunit 4", "gene_name": "RFC4", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35251-1", "protein_name": "Replication factor C subunit 1", "gene_name": "RFC1", "tax_name": "Human" }, { "uniprot_canonical_ac": "P35250-1", "protein_name": "Replication factor C subunit 2", "gene_name": "RFC2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40938-1", "protein_name": "Replication factor C subunit 3", "gene_name": "RFC3", "tax_name": "Human" }, { "uniprot_canonical_ac": "P40937-1", "protein_name": "Replication factor C subunit 5", "gene_name": "RFC5", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P35249", "url": "https://www.uniprot.org/uniprotkb/P35249" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9488738", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemerin activation by serine proteases of the coagulation, fibrinolytic, and inflammatory cascades.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Zabel BA, Allen SJ, Kulig P, Allen JA, Cichy J, Handel TM, Butcher EC", "reference": { "type": "PubMed", "id": "16096270", "url": "https://pubmed.ncbi.nlm.nih.gov/16096270" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.16096270", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Proteolytic regulatory mechanism of chemerin bioactivity.", "journal": "Acta Biochim. Biophys. Sin.", "date": "2009", "authors": "Du Xiao-Yan, Leung Lawrence L K", "reference": { "type": "PubMed", "id": "20011981", "url": "https://pubmed.ncbi.nlm.nih.gov/20011981" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20011981", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemerin, a novel adipokine in the regulation of angiogenesis.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2010-05", "authors": "Bozaoglu Kiymet, Curran Joanne E, Stocker Claire J, Zaibi Mohamed S, Segal David, Konstantopoulos Nicky, Morrison Shona, Carless Melanie, Dyer Thomas D, Cole Shelley A, Goring Harald H H, Moses Eric K, Walder Ken, Cawthorne Michael A, Blangero John, Jowett Jeremy B M", "reference": { "type": "PubMed", "id": "20237162", "url": "https://pubmed.ncbi.nlm.nih.gov/20237162" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20237162", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemerin: at the crossroads of inflammation and obesity.", "journal": "Trends Endocrinol. Metab.", "date": "2010", "authors": "Ernst Matthew C, Sinal Christopher J", "reference": { "type": "PubMed", "id": "20817486", "url": "https://pubmed.ncbi.nlm.nih.gov/20817486" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.20817486", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemerin and its receptors in leukocyte trafficking, inflammation and metabolism.", "journal": "Cytokine Growth Factor Rev.", "date": "2011", "authors": "Bondue Benjamin, Wittamer Val\u00e9rie, Parmentier Marc", "reference": { "type": "PubMed", "id": "22119008", "url": "https://pubmed.ncbi.nlm.nih.gov/22119008" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22119008", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemerin: a potential endocrine link between obesity and type 2 diabetes.", "journal": "Endocrine", "date": "2012", "authors": "Roman Alexandra A, Parlee Sebastian D, Sinal Christopher J", "reference": { "type": "PubMed", "id": "22610747", "url": "https://pubmed.ncbi.nlm.nih.gov/22610747" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.22610747", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel adipocytokine, chemerin exerts anti-inflammatory roles in human vascular endothelial cells.", "journal": "Biochemical and biophysical research communications", "date": "2012-06-22", "authors": "Yamawaki Hideyuki, Kameshima Satoshi, Usui Tatsuya, Okada Muneyoshi, Hara Yukio", "reference": { "type": "PubMed", "id": "22634313", "url": "https://pubmed.ncbi.nlm.nih.gov/22634313" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P31749-1", "protein_name": "RAC-alpha serine/threonine-protein kinase", "gene_name": "AKT1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 473, "end_pos": 473, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by IKKE, MTOR, PRKDC and TBK1; alternate", "evidence": [ { "database": "UniProtKB", "id": "P31749", "url": "https://www.uniprot.org/uniprotkb/P31749" }, { "database": "iPTMnet", "id": "P31749", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P31749" }, { "database": "PubMed", "id": "11445557", "url": "https://pubmed.ncbi.nlm.nih.gov/11445557" }, { "database": "PubMed", "id": "11723139", "url": "https://pubmed.ncbi.nlm.nih.gov/11723139" }, { "database": "PubMed", "id": "12149249", "url": "https://pubmed.ncbi.nlm.nih.gov/12149249" }, { "database": "PubMed", "id": "12176337", "url": "https://pubmed.ncbi.nlm.nih.gov/12176337" }, { "database": "PubMed", "id": "14500673", "url": "https://pubmed.ncbi.nlm.nih.gov/14500673" }, { "database": "PubMed", "id": "16253990", "url": "https://pubmed.ncbi.nlm.nih.gov/16253990" }, { "database": "PubMed", "id": "16603397", "url": "https://pubmed.ncbi.nlm.nih.gov/16603397" }, { "database": "PubMed", "id": "16917505", "url": "https://pubmed.ncbi.nlm.nih.gov/16917505" }, { "database": "PubMed", "id": "16260598", "url": "https://pubmed.ncbi.nlm.nih.gov/16260598" }, { "database": "IntAct", "id": "P31749", "url": "https://www.ebi.ac.uk/intact/interactors/id:P31749*" }, { "database": "PubMed", "id": "21658387", "url": "https://pubmed.ncbi.nlm.nih.gov/21658387" }, { "database": "PubMed", "id": "18650932", "url": "https://pubmed.ncbi.nlm.nih.gov/18650932" }, { "database": "PubMed", "id": "16437163", "url": "https://pubmed.ncbi.nlm.nih.gov/16437163" }, { "database": "PubMed", "id": "21965657", "url": "https://pubmed.ncbi.nlm.nih.gov/21965657" }, { "database": "PRO", "id": "P31749", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=P31749" }, { "database": "PubMed", "id": "16549426", "url": "https://pubmed.ncbi.nlm.nih.gov/16549426" }, { "database": "PubMed", "id": "8978681", "url": "https://pubmed.ncbi.nlm.nih.gov/8978681" }, { "database": "PubMed", "id": "10226025", "url": "https://pubmed.ncbi.nlm.nih.gov/10226025" }, { "database": "PubMed", "id": "10226029", "url": "https://pubmed.ncbi.nlm.nih.gov/10226029" }, { "database": "PubMed", "id": "10477751", "url": "https://pubmed.ncbi.nlm.nih.gov/10477751" }, { "database": "PubMed", "id": "10488096", "url": "https://pubmed.ncbi.nlm.nih.gov/10488096" }, { "database": "PubMed", "id": "10579725", "url": "https://pubmed.ncbi.nlm.nih.gov/10579725" }, { "database": "PubMed", "id": "10601235", "url": "https://pubmed.ncbi.nlm.nih.gov/10601235" }, { "database": "PubMed", "id": "10716737", "url": "https://pubmed.ncbi.nlm.nih.gov/10716737" }, { "database": "PubMed", "id": "10722653", "url": "https://pubmed.ncbi.nlm.nih.gov/10722653" }, { "database": "PubMed", "id": "10746662", "url": "https://pubmed.ncbi.nlm.nih.gov/10746662" }, { "database": "PubMed", "id": "10825497", "url": "https://pubmed.ncbi.nlm.nih.gov/10825497" }, { "database": "PubMed", "id": "10827191", "url": "https://pubmed.ncbi.nlm.nih.gov/10827191" }, { "database": "PubMed", "id": "10874027", "url": "https://pubmed.ncbi.nlm.nih.gov/10874027" }, { "database": "PubMed", "id": "10898514", "url": "https://pubmed.ncbi.nlm.nih.gov/10898514" }, { "database": "PubMed", "id": "10908564", "url": "https://pubmed.ncbi.nlm.nih.gov/10908564" }, { "database": "PubMed", "id": "10949937", "url": "https://pubmed.ncbi.nlm.nih.gov/10949937" }, { "database": "PubMed", "id": "10958690", "url": "https://pubmed.ncbi.nlm.nih.gov/10958690" }, { "database": "PubMed", "id": "10986289", "url": "https://pubmed.ncbi.nlm.nih.gov/10986289" }, { "database": "PubMed", "id": "10994851", "url": "https://pubmed.ncbi.nlm.nih.gov/10994851" }, { "database": "PubMed", "id": "11003625", "url": "https://pubmed.ncbi.nlm.nih.gov/11003625" }, { "database": "PubMed", "id": "11007949", "url": "https://pubmed.ncbi.nlm.nih.gov/11007949" }, { "database": "PubMed", "id": "11027222", "url": "https://pubmed.ncbi.nlm.nih.gov/11027222" }, { "database": "PubMed", "id": "11029403", "url": "https://pubmed.ncbi.nlm.nih.gov/11029403" }, { "database": "PubMed", "id": "11042204", "url": "https://pubmed.ncbi.nlm.nih.gov/11042204" }, { "database": "PubMed", "id": "11162573", "url": "https://pubmed.ncbi.nlm.nih.gov/11162573" }, { "database": "PubMed", "id": "11162641", "url": "https://pubmed.ncbi.nlm.nih.gov/11162641" }, { "database": "PubMed", "id": "11162904", "url": "https://pubmed.ncbi.nlm.nih.gov/11162904" }, { "database": "PubMed", "id": "11208609", "url": "https://pubmed.ncbi.nlm.nih.gov/11208609" }, { "database": "PubMed", "id": "11278269", "url": "https://pubmed.ncbi.nlm.nih.gov/11278269" }, { "database": "PubMed", "id": "11289110", "url": "https://pubmed.ncbi.nlm.nih.gov/11289110" }, { "database": "PubMed", "id": "11311245", "url": "https://pubmed.ncbi.nlm.nih.gov/11311245" }, { "database": "PubMed", "id": "11313365", "url": "https://pubmed.ncbi.nlm.nih.gov/11313365" }, { "database": "PubMed", "id": "11323521", "url": "https://pubmed.ncbi.nlm.nih.gov/11323521" }, { "database": "PubMed", "id": "11340092", "url": "https://pubmed.ncbi.nlm.nih.gov/11340092" }, { "database": "PubMed", "id": "11350959", "url": "https://pubmed.ncbi.nlm.nih.gov/11350959" }, { "database": "PubMed", "id": "11358816", "url": "https://pubmed.ncbi.nlm.nih.gov/11358816" }, { "database": "PubMed", "id": "11359783", "url": "https://pubmed.ncbi.nlm.nih.gov/11359783" }, { "database": "PubMed", "id": "11389054", "url": "https://pubmed.ncbi.nlm.nih.gov/11389054" }, { "database": "PubMed", "id": "11409731", "url": "https://pubmed.ncbi.nlm.nih.gov/11409731" }, { "database": "PubMed", "id": "11602740", "url": "https://pubmed.ncbi.nlm.nih.gov/11602740" }, { "database": "PubMed", "id": "11679435", "url": "https://pubmed.ncbi.nlm.nih.gov/11679435" }, { "database": "PubMed", "id": "11711890", "url": "https://pubmed.ncbi.nlm.nih.gov/11711890" }, { "database": "PubMed", "id": "11731021", "url": "https://pubmed.ncbi.nlm.nih.gov/11731021" }, { "database": "PubMed", "id": "11731414", "url": "https://pubmed.ncbi.nlm.nih.gov/11731414" }, { "database": "PubMed", "id": "11752635", "url": "https://pubmed.ncbi.nlm.nih.gov/11752635" }, { "database": "PubMed", "id": "11756242", "url": "https://pubmed.ncbi.nlm.nih.gov/11756242" }, { "database": "PubMed", "id": "11777539", "url": "https://pubmed.ncbi.nlm.nih.gov/11777539" }, { "database": "PubMed", "id": "11818508", "url": "https://pubmed.ncbi.nlm.nih.gov/11818508" }, { "database": "PubMed", "id": "11825911", "url": "https://pubmed.ncbi.nlm.nih.gov/11825911" }, { "database": "PubMed", "id": "11902114", "url": "https://pubmed.ncbi.nlm.nih.gov/11902114" }, { "database": "PubMed", "id": "11960368", "url": "https://pubmed.ncbi.nlm.nih.gov/11960368" }, { "database": "PubMed", "id": "12000750", "url": "https://pubmed.ncbi.nlm.nih.gov/12000750" }, { "database": "PubMed", "id": "12000752", "url": "https://pubmed.ncbi.nlm.nih.gov/12000752" }, { "database": "PubMed", "id": "12034358", "url": "https://pubmed.ncbi.nlm.nih.gov/12034358" }, { "database": "PubMed", "id": "12060641", "url": "https://pubmed.ncbi.nlm.nih.gov/12060641" }, { "database": "PubMed", "id": "12070228", "url": "https://pubmed.ncbi.nlm.nih.gov/12070228" }, { "database": "PubMed", "id": "12089369", "url": "https://pubmed.ncbi.nlm.nih.gov/12089369" }, { "database": "PubMed", "id": "12105188", "url": "https://pubmed.ncbi.nlm.nih.gov/12105188" }, { "database": "PubMed", "id": "12115344", "url": "https://pubmed.ncbi.nlm.nih.gov/12115344" }, { "database": "PubMed", "id": "12164932", "url": "https://pubmed.ncbi.nlm.nih.gov/12164932" }, { "database": "PubMed", "id": "12171932", "url": "https://pubmed.ncbi.nlm.nih.gov/12171932" }, { "database": "PubMed", "id": "12181443", "url": "https://pubmed.ncbi.nlm.nih.gov/12181443" }, { "database": "PubMed", "id": "12198650", "url": "https://pubmed.ncbi.nlm.nih.gov/12198650" }, { "database": "PubMed", "id": "12208782", "url": "https://pubmed.ncbi.nlm.nih.gov/12208782" }, { "database": "PubMed", "id": "12210737", "url": "https://pubmed.ncbi.nlm.nih.gov/12210737" }, { "database": "PubMed", "id": "12351701", "url": "https://pubmed.ncbi.nlm.nih.gov/12351701" }, { "database": "PubMed", "id": "12370495", "url": "https://pubmed.ncbi.nlm.nih.gov/12370495" }, { "database": "PubMed", "id": "12373610", "url": "https://pubmed.ncbi.nlm.nih.gov/12373610" }, { "database": "PubMed", "id": "12401518", "url": "https://pubmed.ncbi.nlm.nih.gov/12401518" }, { "database": "PubMed", "id": "12429987", "url": "https://pubmed.ncbi.nlm.nih.gov/12429987" }, { "database": "PubMed", "id": "12438236", "url": "https://pubmed.ncbi.nlm.nih.gov/12438236" }, { "database": "PubMed", "id": "12446602", "url": "https://pubmed.ncbi.nlm.nih.gov/12446602" }, { "database": "PubMed", "id": "12466352", "url": "https://pubmed.ncbi.nlm.nih.gov/12466352" }, { "database": "PubMed", "id": "12504922", "url": "https://pubmed.ncbi.nlm.nih.gov/12504922" }, { "database": "PubMed", "id": "12556562", "url": "https://pubmed.ncbi.nlm.nih.gov/12556562" }, { "database": "PubMed", "id": "12606948", "url": "https://pubmed.ncbi.nlm.nih.gov/12606948" }, { "database": "PubMed", "id": "12644590", "url": "https://pubmed.ncbi.nlm.nih.gov/12644590" }, { "database": "PubMed", "id": "12644839", "url": "https://pubmed.ncbi.nlm.nih.gov/12644839" }, { "database": "PubMed", "id": "12649200", "url": "https://pubmed.ncbi.nlm.nih.gov/12649200" }, { "database": "PubMed", "id": "12654898", "url": "https://pubmed.ncbi.nlm.nih.gov/12654898" }, { "database": "PubMed", "id": "12657951", "url": "https://pubmed.ncbi.nlm.nih.gov/12657951" }, { "database": "PubMed", "id": "12682057", "url": "https://pubmed.ncbi.nlm.nih.gov/12682057" }, { "database": "PubMed", "id": "12686550", "url": "https://pubmed.ncbi.nlm.nih.gov/12686550" }, { "database": "PubMed", "id": "12763754", "url": "https://pubmed.ncbi.nlm.nih.gov/12763754" }, { "database": "PubMed", "id": "12801607", "url": "https://pubmed.ncbi.nlm.nih.gov/12801607" }, { "database": "PubMed", "id": "12835332", "url": "https://pubmed.ncbi.nlm.nih.gov/12835332" }, { "database": "PubMed", "id": "12838322", "url": "https://pubmed.ncbi.nlm.nih.gov/12838322" }, { "database": "PubMed", "id": "12839924", "url": "https://pubmed.ncbi.nlm.nih.gov/12839924" }, { "database": "PubMed", "id": "12869408", "url": "https://pubmed.ncbi.nlm.nih.gov/12869408" }, { "database": "PubMed", "id": "12876303", "url": "https://pubmed.ncbi.nlm.nih.gov/12876303" }, { "database": "PubMed", "id": "12939297", "url": "https://pubmed.ncbi.nlm.nih.gov/12939297" }, { "database": "PubMed", "id": "14550274", "url": "https://pubmed.ncbi.nlm.nih.gov/14550274" }, { "database": "PubMed", "id": "14551191", "url": "https://pubmed.ncbi.nlm.nih.gov/14551191" }, { "database": "PubMed", "id": "14568991", "url": "https://pubmed.ncbi.nlm.nih.gov/14568991" }, { "database": "PubMed", "id": "14603261", "url": "https://pubmed.ncbi.nlm.nih.gov/14603261" }, { "database": "PubMed", "id": "14660586", "url": "https://pubmed.ncbi.nlm.nih.gov/14660586" }, { "database": "PubMed", "id": "14668339", "url": "https://pubmed.ncbi.nlm.nih.gov/14668339" }, { "database": "PubMed", "id": "14707121", "url": "https://pubmed.ncbi.nlm.nih.gov/14707121" }, { "database": "PubMed", "id": "14727512", "url": "https://pubmed.ncbi.nlm.nih.gov/14727512" }, { "database": "PubMed", "id": "14747535", "url": "https://pubmed.ncbi.nlm.nih.gov/14747535" }, { "database": "PubMed", "id": "14767876", "url": "https://pubmed.ncbi.nlm.nih.gov/14767876" }, { "database": "PubMed", "id": "14769856", "url": "https://pubmed.ncbi.nlm.nih.gov/14769856" }, { "database": "PubMed", "id": "14971662", "url": "https://pubmed.ncbi.nlm.nih.gov/14971662" }, { "database": "PubMed", "id": "14971663", "url": "https://pubmed.ncbi.nlm.nih.gov/14971663" }, { "database": "PubMed", "id": "14981538", "url": "https://pubmed.ncbi.nlm.nih.gov/14981538" }, { "database": "PubMed", "id": "14990993", "url": "https://pubmed.ncbi.nlm.nih.gov/14990993" }, { "database": "PubMed", "id": "15010337", "url": "https://pubmed.ncbi.nlm.nih.gov/15010337" }, { "database": "PubMed", "id": "15026145", "url": "https://pubmed.ncbi.nlm.nih.gov/15026145" }, { "database": "PubMed", "id": "15044083", "url": "https://pubmed.ncbi.nlm.nih.gov/15044083" }, { "database": "PubMed", "id": "15047168", "url": "https://pubmed.ncbi.nlm.nih.gov/15047168" }, { "database": "PubMed", "id": "15048882", "url": "https://pubmed.ncbi.nlm.nih.gov/15048882" }, { "database": "PubMed", "id": "15050414", "url": "https://pubmed.ncbi.nlm.nih.gov/15050414" }, { "database": "PubMed", "id": "15084475", "url": "https://pubmed.ncbi.nlm.nih.gov/15084475" }, { "database": "PubMed", "id": "15122336", "url": "https://pubmed.ncbi.nlm.nih.gov/15122336" }, { "database": "PubMed", "id": "15138635", "url": "https://pubmed.ncbi.nlm.nih.gov/15138635" }, { "database": "PubMed", "id": "15150572", "url": "https://pubmed.ncbi.nlm.nih.gov/15150572" }, { "database": "PubMed", "id": "15157674", "url": "https://pubmed.ncbi.nlm.nih.gov/15157674" }, { "database": "PubMed", "id": "15176055", "url": "https://pubmed.ncbi.nlm.nih.gov/15176055" }, { "database": "PubMed", "id": "15183529", "url": "https://pubmed.ncbi.nlm.nih.gov/15183529" }, { "database": "PubMed", "id": "15289328", "url": "https://pubmed.ncbi.nlm.nih.gov/15289328" }, { "database": "PubMed", "id": "15289499", "url": "https://pubmed.ncbi.nlm.nih.gov/15289499" }, { "database": "PubMed", "id": "15309026", "url": "https://pubmed.ncbi.nlm.nih.gov/15309026" }, { "database": "PubMed", "id": "15319269", "url": "https://pubmed.ncbi.nlm.nih.gov/15319269" }, { "database": "PubMed", "id": "15327518", "url": "https://pubmed.ncbi.nlm.nih.gov/15327518" }, { "database": "PubMed", "id": "15339992", "url": "https://pubmed.ncbi.nlm.nih.gov/15339992" }, { "database": "PubMed", "id": "15353558", "url": "https://pubmed.ncbi.nlm.nih.gov/15353558" }, { "database": "PubMed", "id": "15364809", "url": "https://pubmed.ncbi.nlm.nih.gov/15364809" }, { "database": "PubMed", "id": "15364915", "url": "https://pubmed.ncbi.nlm.nih.gov/15364915" }, { "database": "PubMed", "id": "15372623", "url": "https://pubmed.ncbi.nlm.nih.gov/15372623" }, { "database": "PubMed", "id": "15456405", "url": "https://pubmed.ncbi.nlm.nih.gov/15456405" }, { "database": "PubMed", "id": "15475446", "url": "https://pubmed.ncbi.nlm.nih.gov/15475446" }, { "database": "PubMed", "id": "15489214", "url": "https://pubmed.ncbi.nlm.nih.gov/15489214" }, { "database": "PubMed", "id": "15505622", "url": "https://pubmed.ncbi.nlm.nih.gov/15505622" }, { "database": "PubMed", "id": "15546863", "url": "https://pubmed.ncbi.nlm.nih.gov/15546863" }, { "database": "PubMed", "id": "15574783", "url": "https://pubmed.ncbi.nlm.nih.gov/15574783" }, { "database": "PubMed", "id": "15657900", "url": "https://pubmed.ncbi.nlm.nih.gov/15657900" }, { "database": "PubMed", "id": "15671247", "url": "https://pubmed.ncbi.nlm.nih.gov/15671247" }, { "database": "PubMed", "id": "15684397", "url": "https://pubmed.ncbi.nlm.nih.gov/15684397" }, { "database": "PubMed", "id": "15706421", "url": "https://pubmed.ncbi.nlm.nih.gov/15706421" }, { "database": "PubMed", "id": "15718470", "url": "https://pubmed.ncbi.nlm.nih.gov/15718470" }, { "database": "PubMed", "id": "15733940", "url": "https://pubmed.ncbi.nlm.nih.gov/15733940" }, { "database": "PubMed", "id": "15738003", "url": "https://pubmed.ncbi.nlm.nih.gov/15738003" }, { "database": "PubMed", "id": "15755769", "url": "https://pubmed.ncbi.nlm.nih.gov/15755769" }, { "database": "PubMed", "id": "15782140", "url": "https://pubmed.ncbi.nlm.nih.gov/15782140" }, { "database": "PubMed", "id": "15805282", "url": "https://pubmed.ncbi.nlm.nih.gov/15805282" }, { "database": "PubMed", "id": "15805287", "url": "https://pubmed.ncbi.nlm.nih.gov/15805287" }, { "database": "PubMed", "id": "15862750", "url": "https://pubmed.ncbi.nlm.nih.gov/15862750" }, { "database": "PubMed", "id": "15867245", "url": "https://pubmed.ncbi.nlm.nih.gov/15867245" }, { "database": "PubMed", "id": "15867390", "url": "https://pubmed.ncbi.nlm.nih.gov/15867390" }, { "database": "PubMed", "id": "15870708", "url": "https://pubmed.ncbi.nlm.nih.gov/15870708" }, { "database": "PubMed", "id": "15870831", "url": "https://pubmed.ncbi.nlm.nih.gov/15870831" }, { "database": "PubMed", "id": "15919790", "url": "https://pubmed.ncbi.nlm.nih.gov/15919790" }, { "database": "PubMed", "id": "15942714", "url": "https://pubmed.ncbi.nlm.nih.gov/15942714" }, { "database": "PubMed", "id": "15943787", "url": "https://pubmed.ncbi.nlm.nih.gov/15943787" }, { "database": "PubMed", "id": "15944217", "url": "https://pubmed.ncbi.nlm.nih.gov/15944217" }, { "database": "PubMed", "id": "15987444", "url": "https://pubmed.ncbi.nlm.nih.gov/15987444" }, { "database": "PubMed", "id": "15998799", "url": "https://pubmed.ncbi.nlm.nih.gov/15998799" }, { "database": "PubMed", "id": "16009706", "url": "https://pubmed.ncbi.nlm.nih.gov/16009706" }, { "database": "PubMed", "id": "16009726", "url": "https://pubmed.ncbi.nlm.nih.gov/16009726" }, { "database": "PubMed", "id": "16018579", "url": "https://pubmed.ncbi.nlm.nih.gov/16018579" }, { "database": "PubMed", "id": "16049961", "url": "https://pubmed.ncbi.nlm.nih.gov/16049961" }, { "database": "PubMed", "id": "16100524", "url": "https://pubmed.ncbi.nlm.nih.gov/16100524" }, { "database": "PubMed", "id": "16133873", "url": "https://pubmed.ncbi.nlm.nih.gov/16133873" }, { "database": "PubMed", "id": "16166302", "url": "https://pubmed.ncbi.nlm.nih.gov/16166302" }, { "database": "PubMed", "id": "16168102", "url": "https://pubmed.ncbi.nlm.nih.gov/16168102" }, { "database": "PubMed", "id": "16168126", "url": "https://pubmed.ncbi.nlm.nih.gov/16168126" }, { "database": "PubMed", "id": "16169930", "url": "https://pubmed.ncbi.nlm.nih.gov/16169930" }, { "database": "PubMed", "id": "16172130", "url": "https://pubmed.ncbi.nlm.nih.gov/16172130" }, { "database": "PubMed", "id": "16182322", "url": "https://pubmed.ncbi.nlm.nih.gov/16182322" }, { "database": "PubMed", "id": "16195476", "url": "https://pubmed.ncbi.nlm.nih.gov/16195476" }, { "database": "PubMed", "id": "16210322", "url": "https://pubmed.ncbi.nlm.nih.gov/16210322" }, { "database": "PubMed", "id": "16221682", "url": "https://pubmed.ncbi.nlm.nih.gov/16221682" }, { "database": "PubMed", "id": "16224792", "url": "https://pubmed.ncbi.nlm.nih.gov/16224792" }, { "database": "PubMed", "id": "16275989", "url": "https://pubmed.ncbi.nlm.nih.gov/16275989" }, { "database": "PubMed", "id": "16287065", "url": "https://pubmed.ncbi.nlm.nih.gov/16287065" }, { "database": "PubMed", "id": "16288304", "url": "https://pubmed.ncbi.nlm.nih.gov/16288304" }, { "database": "PubMed", "id": "16299382", "url": "https://pubmed.ncbi.nlm.nih.gov/16299382" }, { "database": "PubMed", "id": "16306364", "url": "https://pubmed.ncbi.nlm.nih.gov/16306364" }, { "database": "PubMed", "id": "16322209", "url": "https://pubmed.ncbi.nlm.nih.gov/16322209" }, { "database": "PubMed", "id": "16330671", "url": "https://pubmed.ncbi.nlm.nih.gov/16330671" }, { "database": "PubMed", "id": "16341040", "url": "https://pubmed.ncbi.nlm.nih.gov/16341040" }, { "database": "PubMed", "id": "16397250", "url": "https://pubmed.ncbi.nlm.nih.gov/16397250" }, { "database": "PubMed", "id": "16475687", "url": "https://pubmed.ncbi.nlm.nih.gov/16475687" }, { "database": "PubMed", "id": "16497409", "url": "https://pubmed.ncbi.nlm.nih.gov/16497409" }, { "database": "PubMed", "id": "16505097", "url": "https://pubmed.ncbi.nlm.nih.gov/16505097" }, { "database": "PubMed", "id": "16531397", "url": "https://pubmed.ncbi.nlm.nih.gov/16531397" }, { "database": "PubMed", "id": "16537601", "url": "https://pubmed.ncbi.nlm.nih.gov/16537601" }, { "database": "PubMed", "id": "16543232", "url": "https://pubmed.ncbi.nlm.nih.gov/16543232" }, { "database": "PubMed", "id": "16545678", "url": "https://pubmed.ncbi.nlm.nih.gov/16545678" }, { "database": "PubMed", "id": "16546978", "url": "https://pubmed.ncbi.nlm.nih.gov/16546978" }, { "database": "PubMed", "id": "16546979", "url": "https://pubmed.ncbi.nlm.nih.gov/16546979" }, { "database": "PubMed", "id": "16567092", "url": "https://pubmed.ncbi.nlm.nih.gov/16567092" }, { "database": "PubMed", "id": "16585200", "url": "https://pubmed.ncbi.nlm.nih.gov/16585200" }, { "database": "PubMed", "id": "16619521", "url": "https://pubmed.ncbi.nlm.nih.gov/16619521" }, { "database": "PubMed", "id": "16636132", "url": "https://pubmed.ncbi.nlm.nih.gov/16636132" }, { "database": "PubMed", "id": "16636147", "url": "https://pubmed.ncbi.nlm.nih.gov/16636147" }, { "database": "PubMed", "id": "16722146", "url": "https://pubmed.ncbi.nlm.nih.gov/16722146" }, { "database": "PubMed", "id": "16731842", "url": "https://pubmed.ncbi.nlm.nih.gov/16731842" }, { "database": "PubMed", "id": "16759849", "url": "https://pubmed.ncbi.nlm.nih.gov/16759849" }, { "database": "PubMed", "id": "16763108", "url": "https://pubmed.ncbi.nlm.nih.gov/16763108" }, { "database": "PubMed", "id": "16785234", "url": "https://pubmed.ncbi.nlm.nih.gov/16785234" }, { "database": "PubMed", "id": "16785763", "url": "https://pubmed.ncbi.nlm.nih.gov/16785763" }, { "database": "PubMed", "id": "16886599", "url": "https://pubmed.ncbi.nlm.nih.gov/16886599" }, { "database": "PubMed", "id": "16895802", "url": "https://pubmed.ncbi.nlm.nih.gov/16895802" }, { "database": "PubMed", "id": "16940331", "url": "https://pubmed.ncbi.nlm.nih.gov/16940331" }, { "database": "PubMed", "id": "16942862", "url": "https://pubmed.ncbi.nlm.nih.gov/16942862" }, { "database": "PubMed", "id": "16951134", "url": "https://pubmed.ncbi.nlm.nih.gov/16951134" }, { "database": "PubMed", "id": "16962287", "url": "https://pubmed.ncbi.nlm.nih.gov/16962287" }, { "database": "PubMed", "id": "16962653", "url": "https://pubmed.ncbi.nlm.nih.gov/16962653" }, { "database": "PubMed", "id": "16987028", "url": "https://pubmed.ncbi.nlm.nih.gov/16987028" }, { "database": "PubMed", "id": "16987514", "url": "https://pubmed.ncbi.nlm.nih.gov/16987514" }, { "database": "PubMed", "id": "17003457", "url": "https://pubmed.ncbi.nlm.nih.gov/17003457" }, { "database": "PubMed", "id": "17007924", "url": "https://pubmed.ncbi.nlm.nih.gov/17007924" }, { "database": "PubMed", "id": "17013611", "url": "https://pubmed.ncbi.nlm.nih.gov/17013611" }, { "database": "PubMed", "id": "17016648", "url": "https://pubmed.ncbi.nlm.nih.gov/17016648" }, { "database": "PubMed", "id": "17028898", "url": "https://pubmed.ncbi.nlm.nih.gov/17028898" }, { "database": "PubMed", "id": "17041888", "url": "https://pubmed.ncbi.nlm.nih.gov/17041888" }, { "database": "PubMed", "id": "17062729", "url": "https://pubmed.ncbi.nlm.nih.gov/17062729" }, { "database": "PubMed", "id": "17077344", "url": "https://pubmed.ncbi.nlm.nih.gov/17077344" }, { "database": "PubMed", "id": "17096325", "url": "https://pubmed.ncbi.nlm.nih.gov/17096325" }, { "database": "PubMed", "id": "17106060", "url": "https://pubmed.ncbi.nlm.nih.gov/17106060" }, { "database": "PubMed", "id": "17156483", "url": "https://pubmed.ncbi.nlm.nih.gov/17156483" }, { "database": "PubMed", "id": "17158952", "url": "https://pubmed.ncbi.nlm.nih.gov/17158952" }, { "database": "PubMed", "id": "17178855", "url": "https://pubmed.ncbi.nlm.nih.gov/17178855" }, { "database": "PubMed", "id": "17196679", "url": "https://pubmed.ncbi.nlm.nih.gov/17196679" }, { "database": "PubMed", "id": "17196933", "url": "https://pubmed.ncbi.nlm.nih.gov/17196933" }, { "database": "PubMed", "id": "17234785", "url": "https://pubmed.ncbi.nlm.nih.gov/17234785" }, { "database": "PubMed", "id": "17237292", "url": "https://pubmed.ncbi.nlm.nih.gov/17237292" }, { "database": "PubMed", "id": "17259384", "url": "https://pubmed.ncbi.nlm.nih.gov/17259384" }, { "database": "PubMed", "id": "17300726", "url": "https://pubmed.ncbi.nlm.nih.gov/17300726" }, { "database": "PubMed", "id": "17308356", "url": "https://pubmed.ncbi.nlm.nih.gov/17308356" }, { "database": "PubMed", "id": "17309805", "url": "https://pubmed.ncbi.nlm.nih.gov/17309805" }, { "database": "PubMed", "id": "17334390", "url": "https://pubmed.ncbi.nlm.nih.gov/17334390" }, { "database": "PubMed", "id": "17339610", "url": "https://pubmed.ncbi.nlm.nih.gov/17339610" }, { "database": "PubMed", "id": "17342093", "url": "https://pubmed.ncbi.nlm.nih.gov/17342093" }, { "database": "PubMed", "id": "17342096", "url": "https://pubmed.ncbi.nlm.nih.gov/17342096" }, { "database": "PubMed", "id": "17342203", "url": "https://pubmed.ncbi.nlm.nih.gov/17342203" }, { "database": "PubMed", "id": "17372251", "url": "https://pubmed.ncbi.nlm.nih.gov/17372251" }, { "database": "PubMed", "id": "17400190", "url": "https://pubmed.ncbi.nlm.nih.gov/17400190" }, { "database": "PubMed", "id": "17407381", "url": "https://pubmed.ncbi.nlm.nih.gov/17407381" }, { "database": "PubMed", "id": "17442374", "url": "https://pubmed.ncbi.nlm.nih.gov/17442374" }, { "database": "PubMed", "id": "17468516", "url": "https://pubmed.ncbi.nlm.nih.gov/17468516" }, { "database": "PubMed", "id": "17545609", "url": "https://pubmed.ncbi.nlm.nih.gov/17545609" }, { "database": "PubMed", "id": "17548608", "url": "https://pubmed.ncbi.nlm.nih.gov/17548608" }, { "database": "PubMed", "id": "17549359", "url": "https://pubmed.ncbi.nlm.nih.gov/17549359" }, { "database": "PubMed", "id": "17556533", "url": "https://pubmed.ncbi.nlm.nih.gov/17556533" }, { "database": "PubMed", "id": "17562705", "url": "https://pubmed.ncbi.nlm.nih.gov/17562705" }, { "database": "PubMed", "id": "17594810", "url": "https://pubmed.ncbi.nlm.nih.gov/17594810" }, { "database": "PubMed", "id": "17615157", "url": "https://pubmed.ncbi.nlm.nih.gov/17615157" }, { "database": "PubMed", "id": "17622239", "url": "https://pubmed.ncbi.nlm.nih.gov/17622239" }, { "database": "PubMed", "id": "17623090", "url": "https://pubmed.ncbi.nlm.nih.gov/17623090" }, { "database": "PubMed", "id": "17634416", "url": "https://pubmed.ncbi.nlm.nih.gov/17634416" }, { "database": "PubMed", "id": "17640984", "url": "https://pubmed.ncbi.nlm.nih.gov/17640984" }, { "database": "PubMed", "id": "17646396", "url": "https://pubmed.ncbi.nlm.nih.gov/17646396" }, { "database": "PubMed", "id": "17646428", "url": "https://pubmed.ncbi.nlm.nih.gov/17646428" }, { "database": "PubMed", "id": "17652589", "url": "https://pubmed.ncbi.nlm.nih.gov/17652589" }, { "database": "PubMed", "id": "17684018", "url": "https://pubmed.ncbi.nlm.nih.gov/17684018" }, { "database": "PubMed", "id": "17684102", "url": "https://pubmed.ncbi.nlm.nih.gov/17684102" }, { "database": "PubMed", "id": "17707343", "url": "https://pubmed.ncbi.nlm.nih.gov/17707343" }, { "database": "PubMed", "id": "17720802", "url": "https://pubmed.ncbi.nlm.nih.gov/17720802" }, { "database": "PubMed", "id": "17721885", "url": "https://pubmed.ncbi.nlm.nih.gov/17721885" }, { "database": "PubMed", "id": "17721914", "url": "https://pubmed.ncbi.nlm.nih.gov/17721914" }, { "database": "PubMed", "id": "17724478", "url": "https://pubmed.ncbi.nlm.nih.gov/17724478" }, { "database": "PubMed", "id": "17822324", "url": "https://pubmed.ncbi.nlm.nih.gov/17822324" }, { "database": "PubMed", "id": "17848732", "url": "https://pubmed.ncbi.nlm.nih.gov/17848732" }, { "database": "PubMed", "id": "17848913", "url": "https://pubmed.ncbi.nlm.nih.gov/17848913" }, { "database": "PubMed", "id": "17875968", "url": "https://pubmed.ncbi.nlm.nih.gov/17875968" }, { "database": "PubMed", "id": "17883592", "url": "https://pubmed.ncbi.nlm.nih.gov/17883592" }, { "database": "PubMed", "id": "17910952", "url": "https://pubmed.ncbi.nlm.nih.gov/17910952" }, { "database": "PubMed", "id": "17922342", "url": "https://pubmed.ncbi.nlm.nih.gov/17922342" }, { "database": "PubMed", "id": "17923279", "url": "https://pubmed.ncbi.nlm.nih.gov/17923279" }, { "database": "PubMed", "id": "17935137", "url": "https://pubmed.ncbi.nlm.nih.gov/17935137" }, { "database": "PubMed", "id": "17941081", "url": "https://pubmed.ncbi.nlm.nih.gov/17941081" }, { "database": "PubMed", "id": "17960559", "url": "https://pubmed.ncbi.nlm.nih.gov/17960559" }, { "database": "PubMed", "id": "17961125", "url": "https://pubmed.ncbi.nlm.nih.gov/17961125" }, { "database": "PubMed", "id": "17967879", "url": "https://pubmed.ncbi.nlm.nih.gov/17967879" }, { "database": "PubMed", "id": "17971124", "url": "https://pubmed.ncbi.nlm.nih.gov/17971124" }, { "database": "PubMed", "id": "17974987", "url": "https://pubmed.ncbi.nlm.nih.gov/17974987" }, { "database": "PubMed", "id": "17977950", "url": "https://pubmed.ncbi.nlm.nih.gov/17977950" }, { "database": "PubMed", "id": "17983605", "url": "https://pubmed.ncbi.nlm.nih.gov/17983605" }, { "database": "PubMed", "id": "18006275", "url": "https://pubmed.ncbi.nlm.nih.gov/18006275" }, { "database": "PubMed", "id": "18006659", "url": "https://pubmed.ncbi.nlm.nih.gov/18006659" }, { "database": "PubMed", "id": "18041091", "url": "https://pubmed.ncbi.nlm.nih.gov/18041091" }, { "database": "PubMed", "id": "18054038", "url": "https://pubmed.ncbi.nlm.nih.gov/18054038" }, { "database": "PubMed", "id": "18059161", "url": "https://pubmed.ncbi.nlm.nih.gov/18059161" }, { "database": "PubMed", "id": "18068336", "url": "https://pubmed.ncbi.nlm.nih.gov/18068336" }, { "database": "PubMed", "id": "18159236", "url": "https://pubmed.ncbi.nlm.nih.gov/18159236" }, { "database": "PubMed", "id": "18197291", "url": "https://pubmed.ncbi.nlm.nih.gov/18197291" }, { "database": "PubMed", "id": "18199958", "url": "https://pubmed.ncbi.nlm.nih.gov/18199958" }, { "database": "PubMed", "id": "18204829", "url": "https://pubmed.ncbi.nlm.nih.gov/18204829" }, { "database": "PubMed", "id": "18215105", "url": "https://pubmed.ncbi.nlm.nih.gov/18215105" }, { "database": "PubMed", "id": "18235224", "url": "https://pubmed.ncbi.nlm.nih.gov/18235224" }, { "database": "PubMed", "id": "18256540", "url": "https://pubmed.ncbi.nlm.nih.gov/18256540" }, { "database": "PubMed", "id": "18261725", "url": "https://pubmed.ncbi.nlm.nih.gov/18261725" }, { "database": "PubMed", "id": "18262492", "url": "https://pubmed.ncbi.nlm.nih.gov/18262492" }, { "database": "PubMed", "id": "18305032", "url": "https://pubmed.ncbi.nlm.nih.gov/18305032" }, { "database": "PubMed", "id": "18321849", "url": "https://pubmed.ncbi.nlm.nih.gov/18321849" }, { "database": "PubMed", "id": "18332867", "url": "https://pubmed.ncbi.nlm.nih.gov/18332867" }, { "database": "PubMed", "id": "18339839", "url": "https://pubmed.ncbi.nlm.nih.gov/18339839" }, { "database": "PubMed", "id": "18349842", "url": "https://pubmed.ncbi.nlm.nih.gov/18349842" }, { "database": "PubMed", "id": "18356579", "url": "https://pubmed.ncbi.nlm.nih.gov/18356579" }, { "database": "PubMed", "id": "18363844", "url": "https://pubmed.ncbi.nlm.nih.gov/18363844" }, { "database": "PubMed", "id": "18370992", "url": "https://pubmed.ncbi.nlm.nih.gov/18370992" }, { "database": "PubMed", "id": "18381446", "url": "https://pubmed.ncbi.nlm.nih.gov/18381446" }, { "database": "PubMed", "id": "18391071", "url": "https://pubmed.ncbi.nlm.nih.gov/18391071" }, { "database": "PubMed", "id": "18397976", "url": "https://pubmed.ncbi.nlm.nih.gov/18397976" }, { "database": "PubMed", "id": "18409144", "url": "https://pubmed.ncbi.nlm.nih.gov/18409144" }, { "database": "PubMed", "id": "18426604", "url": "https://pubmed.ncbi.nlm.nih.gov/18426604" }, { "database": "PubMed", "id": "18443205", "url": "https://pubmed.ncbi.nlm.nih.gov/18443205" }, { "database": "PubMed", "id": "18455702", "url": "https://pubmed.ncbi.nlm.nih.gov/18455702" }, { "database": "PubMed", "id": "18477468", "url": "https://pubmed.ncbi.nlm.nih.gov/18477468" }, { "database": "PubMed", "id": "18480058", "url": "https://pubmed.ncbi.nlm.nih.gov/18480058" }, { "database": "PubMed", "id": "18487214", "url": "https://pubmed.ncbi.nlm.nih.gov/18487214" }, { "database": "PubMed", "id": "18498165", "url": "https://pubmed.ncbi.nlm.nih.gov/18498165" }, { "database": "PubMed", "id": "18508192", "url": "https://pubmed.ncbi.nlm.nih.gov/18508192" }, { "database": "PubMed", "id": "18519679", "url": "https://pubmed.ncbi.nlm.nih.gov/18519679" }, { "database": "PubMed", "id": "18535836", "url": "https://pubmed.ncbi.nlm.nih.gov/18535836" }, { "database": "PubMed", "id": "18556572", "url": "https://pubmed.ncbi.nlm.nih.gov/18556572" }, { "database": "PubMed", "id": "18557931", "url": "https://pubmed.ncbi.nlm.nih.gov/18557931" }, { "database": "PubMed", "id": "18565837", "url": "https://pubmed.ncbi.nlm.nih.gov/18565837" }, { "database": "PubMed", "id": "18577685", "url": "https://pubmed.ncbi.nlm.nih.gov/18577685" }, { "database": "PubMed", "id": "18586515", "url": "https://pubmed.ncbi.nlm.nih.gov/18586515" }, { "database": "PubMed", "id": "18615850", "url": "https://pubmed.ncbi.nlm.nih.gov/18615850" }, { "database": "PubMed", "id": "18632646", "url": "https://pubmed.ncbi.nlm.nih.gov/18632646" }, { "database": "PubMed", "id": "18665222", "url": "https://pubmed.ncbi.nlm.nih.gov/18665222" }, { "database": "PubMed", "id": "18670617", "url": "https://pubmed.ncbi.nlm.nih.gov/18670617" }, { "database": "PubMed", "id": "18678787", "url": "https://pubmed.ncbi.nlm.nih.gov/18678787" }, { "database": "PubMed", "id": "18687633", "url": "https://pubmed.ncbi.nlm.nih.gov/18687633" }, { "database": "PubMed", "id": "18691227", "url": "https://pubmed.ncbi.nlm.nih.gov/18691227" }, { "database": "PubMed", "id": "18694847", "url": "https://pubmed.ncbi.nlm.nih.gov/18694847" }, { "database": "PubMed", "id": "18725386", "url": "https://pubmed.ncbi.nlm.nih.gov/18725386" }, { "database": "PubMed", "id": "18725974", "url": "https://pubmed.ncbi.nlm.nih.gov/18725974" }, { "database": "PubMed", "id": "18728666", "url": "https://pubmed.ncbi.nlm.nih.gov/18728666" }, { "database": "PubMed", "id": "18805899", "url": "https://pubmed.ncbi.nlm.nih.gov/18805899" }, { "database": "PubMed", "id": "18812223", "url": "https://pubmed.ncbi.nlm.nih.gov/18812223" }, { "database": "PubMed", "id": "18818526", "url": "https://pubmed.ncbi.nlm.nih.gov/18818526" }, { "database": "PubMed", "id": "18821707", "url": "https://pubmed.ncbi.nlm.nih.gov/18821707" }, { "database": "PubMed", "id": "18831768", "url": "https://pubmed.ncbi.nlm.nih.gov/18831768" }, { "database": "PubMed", "id": "18832563", "url": "https://pubmed.ncbi.nlm.nih.gov/18832563" }, { "database": "PubMed", "id": "18838385", "url": "https://pubmed.ncbi.nlm.nih.gov/18838385" }, { "database": "PubMed", "id": "18838554", "url": "https://pubmed.ncbi.nlm.nih.gov/18838554" }, { "database": "PubMed", "id": "18854827", "url": "https://pubmed.ncbi.nlm.nih.gov/18854827" }, { "database": "PubMed", "id": "18931031", "url": "https://pubmed.ncbi.nlm.nih.gov/18931031" }, { "database": "PubMed", "id": "18931700", "url": "https://pubmed.ncbi.nlm.nih.gov/18931700" }, { "database": "PubMed", "id": "19011679", "url": "https://pubmed.ncbi.nlm.nih.gov/19011679" }, { "database": "PubMed", "id": "19018257", "url": "https://pubmed.ncbi.nlm.nih.gov/19018257" }, { "database": "PubMed", "id": "19036927", "url": "https://pubmed.ncbi.nlm.nih.gov/19036927" }, { "database": "PubMed", "id": "19039330", "url": "https://pubmed.ncbi.nlm.nih.gov/19039330" }, { "database": "PubMed", "id": "19055752", "url": "https://pubmed.ncbi.nlm.nih.gov/19055752" }, { "database": "PubMed", "id": "19055754", "url": "https://pubmed.ncbi.nlm.nih.gov/19055754" }, { "database": "PubMed", "id": "19057672", "url": "https://pubmed.ncbi.nlm.nih.gov/19057672" }, { "database": "PubMed", "id": "19064616", "url": "https://pubmed.ncbi.nlm.nih.gov/19064616" }, { "database": "PubMed", "id": "19074832", "url": "https://pubmed.ncbi.nlm.nih.gov/19074832" }, { "database": "PubMed", "id": "19079341", "url": "https://pubmed.ncbi.nlm.nih.gov/19079341" }, { "database": "PubMed", "id": "19109987", "url": "https://pubmed.ncbi.nlm.nih.gov/19109987" }, { "database": "PubMed", "id": "19114562", "url": "https://pubmed.ncbi.nlm.nih.gov/19114562" }, { "database": "PubMed", "id": "19117990", "url": "https://pubmed.ncbi.nlm.nih.gov/19117990" }, { "database": "PubMed", "id": "19133120", "url": "https://pubmed.ncbi.nlm.nih.gov/19133120" }, { "database": "PubMed", "id": "19134195", "url": "https://pubmed.ncbi.nlm.nih.gov/19134195" }, { "database": "PubMed", "id": "19134226", "url": "https://pubmed.ncbi.nlm.nih.gov/19134226" }, { "database": "PubMed", "id": "19158829", "url": "https://pubmed.ncbi.nlm.nih.gov/19158829" }, { "database": "PubMed", "id": "19164772", "url": "https://pubmed.ncbi.nlm.nih.gov/19164772" }, { "database": "PubMed", "id": "19166270", "url": "https://pubmed.ncbi.nlm.nih.gov/19166270" }, { "database": "PubMed", "id": "19166928", "url": "https://pubmed.ncbi.nlm.nih.gov/19166928" }, { "database": "PubMed", "id": "19171933", "url": "https://pubmed.ncbi.nlm.nih.gov/19171933" }, { "database": "PubMed", "id": "19175524", "url": "https://pubmed.ncbi.nlm.nih.gov/19175524" }, { "database": "PubMed", "id": "19183465", "url": "https://pubmed.ncbi.nlm.nih.gov/19183465" }, { "database": "PubMed", "id": "19209957", "url": "https://pubmed.ncbi.nlm.nih.gov/19209957" }, { "database": "PubMed", "id": "19211028", "url": "https://pubmed.ncbi.nlm.nih.gov/19211028" }, { "database": "PubMed", "id": "19216748", "url": "https://pubmed.ncbi.nlm.nih.gov/19216748" }, { "database": "PubMed", "id": "19238332", "url": "https://pubmed.ncbi.nlm.nih.gov/19238332" }, { "database": "PubMed", "id": "19244117", "url": "https://pubmed.ncbi.nlm.nih.gov/19244117" }, { "database": "PubMed", "id": "19255520", "url": "https://pubmed.ncbi.nlm.nih.gov/19255520" }, { "database": "PubMed", "id": "19262695", "url": "https://pubmed.ncbi.nlm.nih.gov/19262695" }, { "database": "PubMed", "id": "19284309", "url": "https://pubmed.ncbi.nlm.nih.gov/19284309" }, { "database": "PubMed", "id": "19293927", "url": "https://pubmed.ncbi.nlm.nih.gov/19293927" }, { "database": "PubMed", "id": "19320971", "url": "https://pubmed.ncbi.nlm.nih.gov/19320971" }, { "database": "PubMed", "id": "19323821", "url": "https://pubmed.ncbi.nlm.nih.gov/19323821" }, { "database": "PubMed", "id": "19331694", "url": "https://pubmed.ncbi.nlm.nih.gov/19331694" }, { "database": "PubMed", "id": "19349584", "url": "https://pubmed.ncbi.nlm.nih.gov/19349584" }, { "database": "PubMed", "id": "19372546", "url": "https://pubmed.ncbi.nlm.nih.gov/19372546" }, { "database": "PubMed", "id": "19388003", "url": "https://pubmed.ncbi.nlm.nih.gov/19388003" }, { "database": "PubMed", "id": "19402821", "url": "https://pubmed.ncbi.nlm.nih.gov/19402821" }, { "database": "PubMed", "id": "19422047", "url": "https://pubmed.ncbi.nlm.nih.gov/19422047" }, { "database": "PubMed", "id": "19424604", "url": "https://pubmed.ncbi.nlm.nih.gov/19424604" }, { "database": "PubMed", "id": "19448664", "url": "https://pubmed.ncbi.nlm.nih.gov/19448664" }, { "database": "PubMed", "id": "19462258", "url": "https://pubmed.ncbi.nlm.nih.gov/19462258" }, { "database": "PubMed", "id": "19463178", "url": "https://pubmed.ncbi.nlm.nih.gov/19463178" }, { "database": "PubMed", "id": "19465931", "url": "https://pubmed.ncbi.nlm.nih.gov/19465931" }, { "database": "PubMed", "id": "19472218", "url": "https://pubmed.ncbi.nlm.nih.gov/19472218" }, { "database": "PubMed", "id": "19483721", "url": "https://pubmed.ncbi.nlm.nih.gov/19483721" }, { "database": "PubMed", "id": "19492080", "url": "https://pubmed.ncbi.nlm.nih.gov/19492080" }, { "database": "PubMed", "id": "19505958", "url": "https://pubmed.ncbi.nlm.nih.gov/19505958" }, { "database": "PubMed", "id": "19517019", "url": "https://pubmed.ncbi.nlm.nih.gov/19517019" }, { "database": "PubMed", "id": "19550420", "url": "https://pubmed.ncbi.nlm.nih.gov/19550420" }, { "database": "PubMed", "id": "19564927", "url": "https://pubmed.ncbi.nlm.nih.gov/19564927" }, { "database": "PubMed", "id": "19568785", "url": "https://pubmed.ncbi.nlm.nih.gov/19568785" }, { "database": "PubMed", "id": "19574087", "url": "https://pubmed.ncbi.nlm.nih.gov/19574087" }, { "database": "PubMed", "id": "19574502", "url": "https://pubmed.ncbi.nlm.nih.gov/19574502" }, { "database": "PubMed", "id": "19602055", "url": "https://pubmed.ncbi.nlm.nih.gov/19602055" }, { "database": "PubMed", "id": "19602587", "url": "https://pubmed.ncbi.nlm.nih.gov/19602587" }, { "database": "PubMed", "id": "19615971", "url": "https://pubmed.ncbi.nlm.nih.gov/19615971" }, { "database": "PubMed", "id": "19616927", "url": "https://pubmed.ncbi.nlm.nih.gov/19616927" }, { "database": "PubMed", "id": "19633130", "url": "https://pubmed.ncbi.nlm.nih.gov/19633130" }, { "database": "PubMed", "id": "19636556", "url": "https://pubmed.ncbi.nlm.nih.gov/19636556" }, { "database": "PubMed", "id": "19638206", "url": "https://pubmed.ncbi.nlm.nih.gov/19638206" }, { "database": "PubMed", "id": "19644030", "url": "https://pubmed.ncbi.nlm.nih.gov/19644030" }, { "database": "PubMed", "id": "19661305", "url": "https://pubmed.ncbi.nlm.nih.gov/19661305" }, { "database": "PubMed", "id": "19661333", "url": "https://pubmed.ncbi.nlm.nih.gov/19661333" }, { "database": "PubMed", "id": "19676105", "url": "https://pubmed.ncbi.nlm.nih.gov/19676105" }, { "database": "PubMed", "id": "19690545", "url": "https://pubmed.ncbi.nlm.nih.gov/19690545" }, { "database": "PubMed", "id": "19701246", "url": "https://pubmed.ncbi.nlm.nih.gov/19701246" }, { "database": "PubMed", "id": "19703998", "url": "https://pubmed.ncbi.nlm.nih.gov/19703998" }, { "database": "PubMed", "id": "19720745", "url": "https://pubmed.ncbi.nlm.nih.gov/19720745" }, { "database": "PubMed", "id": "19720798", "url": "https://pubmed.ncbi.nlm.nih.gov/19720798" }, { "database": "PubMed", "id": "19724902", "url": "https://pubmed.ncbi.nlm.nih.gov/19724902" }, { "database": "PubMed", "id": "19757038", "url": "https://pubmed.ncbi.nlm.nih.gov/19757038" }, { "database": "PubMed", "id": "19762915", "url": "https://pubmed.ncbi.nlm.nih.gov/19762915" }, { "database": "PubMed", "id": "19779850", "url": "https://pubmed.ncbi.nlm.nih.gov/19779850" }, { "database": "PubMed", "id": "19786063", "url": "https://pubmed.ncbi.nlm.nih.gov/19786063" }, { "database": "PubMed", "id": "19789339", "url": "https://pubmed.ncbi.nlm.nih.gov/19789339" }, { "database": "PubMed", "id": "19796390", "url": "https://pubmed.ncbi.nlm.nih.gov/19796390" }, { "database": "PubMed", "id": "19834495", "url": "https://pubmed.ncbi.nlm.nih.gov/19834495" }, { "database": "PubMed", "id": "19855434", "url": "https://pubmed.ncbi.nlm.nih.gov/19855434" }, { "database": "PubMed", "id": "19863783", "url": "https://pubmed.ncbi.nlm.nih.gov/19863783" }, { "database": "PubMed", "id": "19891769", "url": "https://pubmed.ncbi.nlm.nih.gov/19891769" }, { "database": "PubMed", "id": "19902931", "url": "https://pubmed.ncbi.nlm.nih.gov/19902931" }, { "database": "PubMed", "id": "19922411", "url": "https://pubmed.ncbi.nlm.nih.gov/19922411" }, { "database": "PubMed", "id": "19943972", "url": "https://pubmed.ncbi.nlm.nih.gov/19943972" }, { "database": "PubMed", "id": "19946332", "url": "https://pubmed.ncbi.nlm.nih.gov/19946332" }, { "database": "PubMed", "id": "19956873", "url": "https://pubmed.ncbi.nlm.nih.gov/19956873" }, { "database": "PubMed", "id": "19996208", "url": "https://pubmed.ncbi.nlm.nih.gov/19996208" }, { "database": "PubMed", "id": "19997600", "url": "https://pubmed.ncbi.nlm.nih.gov/19997600" }, { "database": "PubMed", "id": "20011604", "url": "https://pubmed.ncbi.nlm.nih.gov/20011604" }, { "database": "PubMed", "id": "20014066", "url": "https://pubmed.ncbi.nlm.nih.gov/20014066" }, { "database": "PubMed", "id": "20026151", "url": "https://pubmed.ncbi.nlm.nih.gov/20026151" }, { "database": "PubMed", "id": "20038548", "url": "https://pubmed.ncbi.nlm.nih.gov/20038548" }, { "database": "PubMed", "id": "20039275", "url": "https://pubmed.ncbi.nlm.nih.gov/20039275" }, { "database": "PubMed", "id": "20042122", "url": "https://pubmed.ncbi.nlm.nih.gov/20042122" }, { "database": "PubMed", "id": "20046351", "url": "https://pubmed.ncbi.nlm.nih.gov/20046351" }, { "database": "PubMed", "id": "20046837", "url": "https://pubmed.ncbi.nlm.nih.gov/20046837" }, { "database": "PubMed", "id": "20049209", "url": "https://pubmed.ncbi.nlm.nih.gov/20049209" }, { "database": "PubMed", "id": "20051961", "url": "https://pubmed.ncbi.nlm.nih.gov/20051961" }, { "database": "PubMed", "id": "20054000", "url": "https://pubmed.ncbi.nlm.nih.gov/20054000" }, { "database": "PubMed", "id": "20054340", "url": "https://pubmed.ncbi.nlm.nih.gov/20054340" }, { "database": "PubMed", "id": "20068168", "url": "https://pubmed.ncbi.nlm.nih.gov/20068168" }, { "database": "PubMed", "id": "20081374", "url": "https://pubmed.ncbi.nlm.nih.gov/20081374" }, { "database": "PubMed", "id": "20084057", "url": "https://pubmed.ncbi.nlm.nih.gov/20084057" }, { "database": "PubMed", "id": "20090934", "url": "https://pubmed.ncbi.nlm.nih.gov/20090934" }, { "database": "PubMed", "id": "20106927", "url": "https://pubmed.ncbi.nlm.nih.gov/20106927" }, { "database": "PubMed", "id": "20112989", "url": "https://pubmed.ncbi.nlm.nih.gov/20112989" }, { "database": "PubMed", "id": "20126311", "url": "https://pubmed.ncbi.nlm.nih.gov/20126311" }, { "database": "PubMed", "id": "20130777", "url": "https://pubmed.ncbi.nlm.nih.gov/20130777" }, { "database": "PubMed", "id": "20150288", "url": "https://pubmed.ncbi.nlm.nih.gov/20150288" }, { "database": "PubMed", "id": "20152809", "url": "https://pubmed.ncbi.nlm.nih.gov/20152809" }, { "database": "PubMed", "id": "20163786", "url": "https://pubmed.ncbi.nlm.nih.gov/20163786" }, { "database": "PubMed", "id": "20167101", "url": "https://pubmed.ncbi.nlm.nih.gov/20167101" }, { "database": "PubMed", "id": "20167420", "url": "https://pubmed.ncbi.nlm.nih.gov/20167420" }, { "database": "PubMed", "id": "20169162", "url": "https://pubmed.ncbi.nlm.nih.gov/20169162" }, { "database": "PubMed", "id": "20183800", "url": "https://pubmed.ncbi.nlm.nih.gov/20183800" }, { "database": "PubMed", "id": "20186153", "url": "https://pubmed.ncbi.nlm.nih.gov/20186153" }, { "database": "PubMed", "id": "20205745", "url": "https://pubmed.ncbi.nlm.nih.gov/20205745" }, { "database": "PubMed", "id": "20216949", "url": "https://pubmed.ncbi.nlm.nih.gov/20216949" }, { "database": "PubMed", "id": "20217555", "url": "https://pubmed.ncbi.nlm.nih.gov/20217555" }, { "database": "PubMed", "id": "20224651", "url": "https://pubmed.ncbi.nlm.nih.gov/20224651" }, { "database": "PubMed", "id": "20332342", "url": "https://pubmed.ncbi.nlm.nih.gov/20332342" }, { "database": "PubMed", "id": "20333467", "url": "https://pubmed.ncbi.nlm.nih.gov/20333467" }, { "database": "PubMed", "id": "20334367", "url": "https://pubmed.ncbi.nlm.nih.gov/20334367" }, { "database": "PubMed", "id": "20361045", "url": "https://pubmed.ncbi.nlm.nih.gov/20361045" }, { "database": "PubMed", "id": "20362557", "url": "https://pubmed.ncbi.nlm.nih.gov/20362557" }, { "database": "PubMed", "id": "20364113", "url": "https://pubmed.ncbi.nlm.nih.gov/20364113" }, { "database": "PubMed", "id": "20371728", "url": "https://pubmed.ncbi.nlm.nih.gov/20371728" }, { "database": "PubMed", "id": "20375905", "url": "https://pubmed.ncbi.nlm.nih.gov/20375905" }, { "database": "PubMed", "id": "20383279", "url": "https://pubmed.ncbi.nlm.nih.gov/20383279" }, { "database": "PubMed", "id": "20384568", "url": "https://pubmed.ncbi.nlm.nih.gov/20384568" }, { "database": "PubMed", "id": "20385969", "url": "https://pubmed.ncbi.nlm.nih.gov/20385969" }, { "database": "PubMed", "id": "20400975", "url": "https://pubmed.ncbi.nlm.nih.gov/20400975" }, { "database": "PubMed", "id": "20412566", "url": "https://pubmed.ncbi.nlm.nih.gov/20412566" }, { "database": "PubMed", "id": "20418907", "url": "https://pubmed.ncbi.nlm.nih.gov/20418907" }, { "database": "PubMed", "id": "20421190", "url": "https://pubmed.ncbi.nlm.nih.gov/20421190" }, { "database": "PubMed", "id": "20451318", "url": "https://pubmed.ncbi.nlm.nih.gov/20451318" }, { "database": "PubMed", "id": "20454577", "url": "https://pubmed.ncbi.nlm.nih.gov/20454577" }, { "database": "PubMed", "id": "20463894", "url": "https://pubmed.ncbi.nlm.nih.gov/20463894" }, { "database": "PubMed", "id": "20470857", "url": "https://pubmed.ncbi.nlm.nih.gov/20470857" }, { "database": "PubMed", "id": "20489726", "url": "https://pubmed.ncbi.nlm.nih.gov/20489726" }, { "database": "PubMed", "id": "20492449", "url": "https://pubmed.ncbi.nlm.nih.gov/20492449" }, { "database": "PubMed", "id": "20494139", "url": "https://pubmed.ncbi.nlm.nih.gov/20494139" }, { "database": "PubMed", "id": "20507646", "url": "https://pubmed.ncbi.nlm.nih.gov/20507646" }, { "database": "PubMed", "id": "20517722", "url": "https://pubmed.ncbi.nlm.nih.gov/20517722" }, { "database": "PubMed", "id": "20520724", "url": "https://pubmed.ncbi.nlm.nih.gov/20520724" }, { "database": "PubMed", "id": "20527022", "url": "https://pubmed.ncbi.nlm.nih.gov/20527022" }, { "database": "PubMed", "id": "20530982", "url": "https://pubmed.ncbi.nlm.nih.gov/20530982" }, { "database": "PubMed", "id": "20537156", "url": "https://pubmed.ncbi.nlm.nih.gov/20537156" }, { "database": "PubMed", "id": "20540782", "url": "https://pubmed.ncbi.nlm.nih.gov/20540782" }, { "database": "PubMed", "id": "20543991", "url": "https://pubmed.ncbi.nlm.nih.gov/20543991" }, { "database": "PubMed", "id": "20547325", "url": "https://pubmed.ncbi.nlm.nih.gov/20547325" }, { "database": "PubMed", "id": "20555032", "url": "https://pubmed.ncbi.nlm.nih.gov/20555032" }, { "database": "PubMed", "id": "20585660", "url": "https://pubmed.ncbi.nlm.nih.gov/20585660" }, { "database": "PubMed", "id": "20597130", "url": "https://pubmed.ncbi.nlm.nih.gov/20597130" }, { "database": "PubMed", "id": "20628892", "url": "https://pubmed.ncbi.nlm.nih.gov/20628892" }, { "database": "PubMed", "id": "20663232", "url": "https://pubmed.ncbi.nlm.nih.gov/20663232" }, { "database": "PubMed", "id": "20679434", "url": "https://pubmed.ncbi.nlm.nih.gov/20679434" }, { "database": "PubMed", "id": "20685965", "url": "https://pubmed.ncbi.nlm.nih.gov/20685965" }, { "database": "PubMed", "id": "20686120", "url": "https://pubmed.ncbi.nlm.nih.gov/20686120" }, { "database": "PubMed", "id": "20691662", "url": "https://pubmed.ncbi.nlm.nih.gov/20691662" }, { "database": "PubMed", "id": "20704701", "url": "https://pubmed.ncbi.nlm.nih.gov/20704701" }, { "database": "PubMed", "id": "20716939", "url": "https://pubmed.ncbi.nlm.nih.gov/20716939" }, { "database": "PubMed", "id": "20729916", "url": "https://pubmed.ncbi.nlm.nih.gov/20729916" }, { "database": "PubMed", "id": "20736160", "url": "https://pubmed.ncbi.nlm.nih.gov/20736160" }, { "database": "PubMed", "id": "20804500", "url": "https://pubmed.ncbi.nlm.nih.gov/20804500" }, { "database": "PubMed", "id": "20811673", "url": "https://pubmed.ncbi.nlm.nih.gov/20811673" }, { "database": "PubMed", "id": "20817061", "url": "https://pubmed.ncbi.nlm.nih.gov/20817061" }, { "database": "PubMed", "id": "20836557", "url": "https://pubmed.ncbi.nlm.nih.gov/20836557" }, { "database": "PubMed", "id": "20844023", "url": "https://pubmed.ncbi.nlm.nih.gov/20844023" }, { "database": "PubMed", "id": "20860815", "url": "https://pubmed.ncbi.nlm.nih.gov/20860815" }, { "database": "PubMed", "id": "20863384", "url": "https://pubmed.ncbi.nlm.nih.gov/20863384" }, { "database": "PubMed", "id": "20863403", "url": "https://pubmed.ncbi.nlm.nih.gov/20863403" }, { "database": "PubMed", "id": "20920357", "url": "https://pubmed.ncbi.nlm.nih.gov/20920357" }, { "database": "PubMed", "id": "20926588", "url": "https://pubmed.ncbi.nlm.nih.gov/20926588" }, { "database": "PubMed", "id": "20927395", "url": "https://pubmed.ncbi.nlm.nih.gov/20927395" }, { "database": "PubMed", "id": "20941790", "url": "https://pubmed.ncbi.nlm.nih.gov/20941790" }, { "database": "PubMed", "id": "20950443", "url": "https://pubmed.ncbi.nlm.nih.gov/20950443" }, { "database": "PubMed", "id": "20952497", "url": "https://pubmed.ncbi.nlm.nih.gov/20952497" }, { "database": "PubMed", "id": "20953381", "url": "https://pubmed.ncbi.nlm.nih.gov/20953381" }, { "database": "PubMed", "id": "20957047", "url": "https://pubmed.ncbi.nlm.nih.gov/20957047" }, { "database": "PubMed", "id": "20975834", "url": "https://pubmed.ncbi.nlm.nih.gov/20975834" }, { "database": "PubMed", "id": "20980511", "url": "https://pubmed.ncbi.nlm.nih.gov/20980511" }, { "database": "PubMed", "id": "21040800", "url": "https://pubmed.ncbi.nlm.nih.gov/21040800" }, { "database": "PubMed", "id": "21049033", "url": "https://pubmed.ncbi.nlm.nih.gov/21049033" }, { "database": "PubMed", "id": "21059203", "url": "https://pubmed.ncbi.nlm.nih.gov/21059203" }, { "database": "PubMed", "id": "21072193", "url": "https://pubmed.ncbi.nlm.nih.gov/21072193" }, { "database": "PubMed", "id": "21078168", "url": "https://pubmed.ncbi.nlm.nih.gov/21078168" }, { "database": "PubMed", "id": "21080918", "url": "https://pubmed.ncbi.nlm.nih.gov/21080918" }, { "database": "PubMed", "id": "21081844", "url": "https://pubmed.ncbi.nlm.nih.gov/21081844" }, { "database": "PubMed", "id": "21086135", "url": "https://pubmed.ncbi.nlm.nih.gov/21086135" }, { "database": "PubMed", "id": "21097843", "url": "https://pubmed.ncbi.nlm.nih.gov/21097843" }, { "database": "PubMed", "id": "21128248", "url": "https://pubmed.ncbi.nlm.nih.gov/21128248" }, { "database": "PubMed", "id": "21131356", "url": "https://pubmed.ncbi.nlm.nih.gov/21131356" }, { "database": "PubMed", "id": "21134280", "url": "https://pubmed.ncbi.nlm.nih.gov/21134280" }, { "database": "PubMed", "id": "21144036", "url": "https://pubmed.ncbi.nlm.nih.gov/21144036" }, { "database": "PubMed", "id": "21148296", "url": "https://pubmed.ncbi.nlm.nih.gov/21148296" }, { "database": "PubMed", "id": "21152033", "url": "https://pubmed.ncbi.nlm.nih.gov/21152033" }, { "database": "PubMed", "id": "21177249", "url": "https://pubmed.ncbi.nlm.nih.gov/21177249" }, { "database": "PubMed", "id": "21183727", "url": "https://pubmed.ncbi.nlm.nih.gov/21183727" }, { "database": "PubMed", "id": "21192818", "url": "https://pubmed.ncbi.nlm.nih.gov/21192818" }, { "database": "PubMed", "id": "21193562", "url": "https://pubmed.ncbi.nlm.nih.gov/21193562" }, { "database": "PubMed", "id": "21204013", "url": "https://pubmed.ncbi.nlm.nih.gov/21204013" }, { "database": "PubMed", "id": "21209911", "url": "https://pubmed.ncbi.nlm.nih.gov/21209911" }, { "database": "PubMed", "id": "21212404", "url": "https://pubmed.ncbi.nlm.nih.gov/21212404" }, { "database": "PubMed", "id": "21215240", "url": "https://pubmed.ncbi.nlm.nih.gov/21215240" }, { "database": "PubMed", "id": "21253589", "url": "https://pubmed.ncbi.nlm.nih.gov/21253589" }, { "database": "PubMed", "id": "21266528", "url": "https://pubmed.ncbi.nlm.nih.gov/21266528" }, { "database": "PubMed", "id": "21278786", "url": "https://pubmed.ncbi.nlm.nih.gov/21278786" }, { "database": "PubMed", "id": "21283818", "url": "https://pubmed.ncbi.nlm.nih.gov/21283818" }, { "database": "PubMed", "id": "21284537", "url": "https://pubmed.ncbi.nlm.nih.gov/21284537" }, { "database": "PubMed", "id": "21291561", "url": "https://pubmed.ncbi.nlm.nih.gov/21291561" }, { "database": "PubMed", "id": "21296133", "url": "https://pubmed.ncbi.nlm.nih.gov/21296133" }, { "database": "PubMed", "id": "21297971", "url": "https://pubmed.ncbi.nlm.nih.gov/21297971" }, { "database": "PubMed", "id": "21300751", "url": "https://pubmed.ncbi.nlm.nih.gov/21300751" }, { "database": "PubMed", "id": "21307779", "url": "https://pubmed.ncbi.nlm.nih.gov/21307779" }, { "database": "PubMed", "id": "21309701", "url": "https://pubmed.ncbi.nlm.nih.gov/21309701" }, { "database": "PubMed", "id": "21310961", "url": "https://pubmed.ncbi.nlm.nih.gov/21310961" }, { "database": "PubMed", "id": "21321111", "url": "https://pubmed.ncbi.nlm.nih.gov/21321111" }, { "database": "PubMed", "id": "21321187", "url": "https://pubmed.ncbi.nlm.nih.gov/21321187" }, { "database": "PubMed", "id": "21325624", "url": "https://pubmed.ncbi.nlm.nih.gov/21325624" }, { "database": "PubMed", "id": "21326806", "url": "https://pubmed.ncbi.nlm.nih.gov/21326806" }, { "database": "PubMed", "id": "21333374", "url": "https://pubmed.ncbi.nlm.nih.gov/21333374" }, { "database": "PubMed", "id": "21350947", "url": "https://pubmed.ncbi.nlm.nih.gov/21350947" }, { "database": "PubMed", "id": "21364639", "url": "https://pubmed.ncbi.nlm.nih.gov/21364639" }, { "database": "PubMed", "id": "21396911", "url": "https://pubmed.ncbi.nlm.nih.gov/21396911" }, { "database": "PubMed", "id": "21402788", "url": "https://pubmed.ncbi.nlm.nih.gov/21402788" }, { "database": "PubMed", "id": "21415306", "url": "https://pubmed.ncbi.nlm.nih.gov/21415306" }, { "database": "PubMed", "id": "21425139", "url": "https://pubmed.ncbi.nlm.nih.gov/21425139" }, { "database": "PubMed", "id": "21436253", "url": "https://pubmed.ncbi.nlm.nih.gov/21436253" }, { "database": "PubMed", "id": "21437771", "url": "https://pubmed.ncbi.nlm.nih.gov/21437771" }, { "database": "PubMed", "id": "21445305", "url": "https://pubmed.ncbi.nlm.nih.gov/21445305" }, { "database": "PubMed", "id": "21447180", "url": "https://pubmed.ncbi.nlm.nih.gov/21447180" }, { "database": "PubMed", "id": "21461637", "url": "https://pubmed.ncbi.nlm.nih.gov/21461637" }, { "database": "PubMed", "id": "21464307", "url": "https://pubmed.ncbi.nlm.nih.gov/21464307" }, { "database": "PubMed", "id": "21471536", "url": "https://pubmed.ncbi.nlm.nih.gov/21471536" }, { "database": "PubMed", "id": "21472003", "url": "https://pubmed.ncbi.nlm.nih.gov/21472003" }, { "database": "PubMed", "id": "21490677", "url": "https://pubmed.ncbi.nlm.nih.gov/21490677" }, { "database": "PubMed", "id": "21496273", "url": "https://pubmed.ncbi.nlm.nih.gov/21496273" }, { "database": "PubMed", "id": "21499296", "url": "https://pubmed.ncbi.nlm.nih.gov/21499296" }, { "database": "PubMed", "id": "21505451", "url": "https://pubmed.ncbi.nlm.nih.gov/21505451" }, { "database": "PubMed", "id": "21514425", "url": "https://pubmed.ncbi.nlm.nih.gov/21514425" }, { "database": "PubMed", "id": "21538438", "url": "https://pubmed.ncbi.nlm.nih.gov/21538438" }, { "database": "PubMed", "id": "21559284", "url": "https://pubmed.ncbi.nlm.nih.gov/21559284" }, { "database": "PubMed", "id": "21559502", "url": "https://pubmed.ncbi.nlm.nih.gov/21559502" }, { "database": "PubMed", "id": "21592956", "url": "https://pubmed.ncbi.nlm.nih.gov/21592956" }, { "database": "PubMed", "id": "21600017", "url": "https://pubmed.ncbi.nlm.nih.gov/21600017" }, { "database": "PubMed", "id": "21600875", "url": "https://pubmed.ncbi.nlm.nih.gov/21600875" }, { "database": "PubMed", "id": "21625516", "url": "https://pubmed.ncbi.nlm.nih.gov/21625516" }, { "database": "PubMed", "id": "21625639", "url": "https://pubmed.ncbi.nlm.nih.gov/21625639" }, { "database": "PubMed", "id": "21644050", "url": "https://pubmed.ncbi.nlm.nih.gov/21644050" }, { "database": "PubMed", "id": "21647420", "url": "https://pubmed.ncbi.nlm.nih.gov/21647420" }, { "database": "PubMed", "id": "21655183", "url": "https://pubmed.ncbi.nlm.nih.gov/21655183" }, { "database": "PubMed", "id": "21660042", "url": "https://pubmed.ncbi.nlm.nih.gov/21660042" }, { "database": "PubMed", "id": "21666717", "url": "https://pubmed.ncbi.nlm.nih.gov/21666717" }, { "database": "PubMed", "id": "21668414", "url": "https://pubmed.ncbi.nlm.nih.gov/21668414" }, { "database": "PubMed", "id": "21672148", "url": "https://pubmed.ncbi.nlm.nih.gov/21672148" }, { "database": "PubMed", "id": "21682918", "url": "https://pubmed.ncbi.nlm.nih.gov/21682918" }, { "database": "PubMed", "id": "21687633", "url": "https://pubmed.ncbi.nlm.nih.gov/21687633" }, { "database": "PubMed", "id": "21698202", "url": "https://pubmed.ncbi.nlm.nih.gov/21698202" }, { "database": "PubMed", "id": "21704120", "url": "https://pubmed.ncbi.nlm.nih.gov/21704120" }, { "database": "PubMed", "id": "21722370", "url": "https://pubmed.ncbi.nlm.nih.gov/21722370" }, { "database": "PubMed", "id": "21723633", "url": "https://pubmed.ncbi.nlm.nih.gov/21723633" }, { "database": "PubMed", "id": "21724622", "url": "https://pubmed.ncbi.nlm.nih.gov/21724622" }, { "database": "PubMed", "id": "21741919", "url": "https://pubmed.ncbi.nlm.nih.gov/21741919" }, { "database": "PubMed", "id": "21747918", "url": "https://pubmed.ncbi.nlm.nih.gov/21747918" }, { "database": "PubMed", "id": "21750652", "url": "https://pubmed.ncbi.nlm.nih.gov/21750652" }, { "database": "PubMed", "id": "21763075", "url": "https://pubmed.ncbi.nlm.nih.gov/21763075" }, { "database": "PubMed", "id": "21763421", "url": "https://pubmed.ncbi.nlm.nih.gov/21763421" }, { "database": "PubMed", "id": "21767636", "url": "https://pubmed.ncbi.nlm.nih.gov/21767636" }, { "database": "PubMed", "id": "21775480", "url": "https://pubmed.ncbi.nlm.nih.gov/21775480" }, { "database": "PubMed", "id": "21789189", "url": "https://pubmed.ncbi.nlm.nih.gov/21789189" }, { "database": "PubMed", "id": "21795477", "url": "https://pubmed.ncbi.nlm.nih.gov/21795477" }, { "database": "PubMed", "id": "21796074", "url": "https://pubmed.ncbi.nlm.nih.gov/21796074" }, { "database": "PubMed", "id": "21804606", "url": "https://pubmed.ncbi.nlm.nih.gov/21804606" }, { "database": "PubMed", "id": "21818627", "url": "https://pubmed.ncbi.nlm.nih.gov/21818627" }, { "database": "PubMed", "id": "21821012", "url": "https://pubmed.ncbi.nlm.nih.gov/21821012" }, { "database": "PubMed", "id": "21837363", "url": "https://pubmed.ncbi.nlm.nih.gov/21837363" }, { "database": "PubMed", "id": "21840189", "url": "https://pubmed.ncbi.nlm.nih.gov/21840189" }, { "database": "PubMed", "id": "21864408", "url": "https://pubmed.ncbi.nlm.nih.gov/21864408" }, { "database": "PubMed", "id": "21867682", "url": "https://pubmed.ncbi.nlm.nih.gov/21867682" }, { "database": "PubMed", "id": "21871173", "url": "https://pubmed.ncbi.nlm.nih.gov/21871173" }, { "database": "PubMed", "id": "21871446", "url": "https://pubmed.ncbi.nlm.nih.gov/21871446" }, { "database": "PubMed", "id": "21874045", "url": "https://pubmed.ncbi.nlm.nih.gov/21874045" }, { "database": "PubMed", "id": "21887250", "url": "https://pubmed.ncbi.nlm.nih.gov/21887250" }, { "database": "PubMed", "id": "21898122", "url": "https://pubmed.ncbi.nlm.nih.gov/21898122" }, { "database": "PubMed", "id": "21900500", "url": "https://pubmed.ncbi.nlm.nih.gov/21900500" }, { "database": "PubMed", "id": "21901254", "url": "https://pubmed.ncbi.nlm.nih.gov/21901254" }, { "database": "PubMed", "id": "21904110", "url": "https://pubmed.ncbi.nlm.nih.gov/21904110" }, { "database": "PubMed", "id": "21908613", "url": "https://pubmed.ncbi.nlm.nih.gov/21908613" }, { "database": "PubMed", "id": "21943213", "url": "https://pubmed.ncbi.nlm.nih.gov/21943213" }, { "database": "PubMed", "id": "21952497", "url": "https://pubmed.ncbi.nlm.nih.gov/21952497" }, { "database": "PubMed", "id": "21956113", "url": "https://pubmed.ncbi.nlm.nih.gov/21956113" }, { "database": "PubMed", "id": "21984893", "url": "https://pubmed.ncbi.nlm.nih.gov/21984893" }, { "database": "PubMed", "id": "21991327", "url": "https://pubmed.ncbi.nlm.nih.gov/21991327" }, { "database": "PubMed", "id": "22012613", "url": "https://pubmed.ncbi.nlm.nih.gov/22012613" }, { "database": "PubMed", "id": "22016349", "url": "https://pubmed.ncbi.nlm.nih.gov/22016349" }, { "database": "PubMed", "id": "22025163", "url": "https://pubmed.ncbi.nlm.nih.gov/22025163" }, { "database": "PubMed", "id": "22029423", "url": "https://pubmed.ncbi.nlm.nih.gov/22029423" }, { "database": "PubMed", "id": "22039466", "url": "https://pubmed.ncbi.nlm.nih.gov/22039466" }, { "database": "PubMed", "id": "22046442", "url": "https://pubmed.ncbi.nlm.nih.gov/22046442" }, { "database": "PubMed", "id": "22060274", "url": "https://pubmed.ncbi.nlm.nih.gov/22060274" }, { "database": "PubMed", "id": "22071574", "url": "https://pubmed.ncbi.nlm.nih.gov/22071574" }, { "database": "PubMed", "id": "22073312", "url": "https://pubmed.ncbi.nlm.nih.gov/22073312" }, { "database": "PubMed", "id": "22084251", "url": "https://pubmed.ncbi.nlm.nih.gov/22084251" }, { "database": "PubMed", "id": "22107784", "url": "https://pubmed.ncbi.nlm.nih.gov/22107784" }, { "database": "PubMed", "id": "22110663", "url": "https://pubmed.ncbi.nlm.nih.gov/22110663" }, { "database": "PubMed", "id": "22116303", "url": "https://pubmed.ncbi.nlm.nih.gov/22116303" }, { "database": "PubMed", "id": "22131882", "url": "https://pubmed.ncbi.nlm.nih.gov/22131882" }, { "database": "PubMed", "id": "22139837", "url": "https://pubmed.ncbi.nlm.nih.gov/22139837" }, { "database": "PubMed", "id": "22142888", "url": "https://pubmed.ncbi.nlm.nih.gov/22142888" }, { "database": "PubMed", "id": "22155350", "url": "https://pubmed.ncbi.nlm.nih.gov/22155350" }, { "database": "PubMed", "id": "22173835", "url": "https://pubmed.ncbi.nlm.nih.gov/22173835" }, { "database": "PubMed", "id": "22184107", "url": "https://pubmed.ncbi.nlm.nih.gov/22184107" }, { "database": "PubMed", "id": "22184110", "url": "https://pubmed.ncbi.nlm.nih.gov/22184110" }, { "database": "PubMed", "id": "22185378", "url": "https://pubmed.ncbi.nlm.nih.gov/22185378" }, { "database": "PubMed", "id": "22194965", "url": "https://pubmed.ncbi.nlm.nih.gov/22194965" }, { "database": "PubMed", "id": "22204954", "url": "https://pubmed.ncbi.nlm.nih.gov/22204954" }, { "database": "PubMed", "id": "22207758", "url": "https://pubmed.ncbi.nlm.nih.gov/22207758" }, { "database": "PubMed", "id": "22211100", "url": "https://pubmed.ncbi.nlm.nih.gov/22211100" }, { "database": "PubMed", "id": "22235305", "url": "https://pubmed.ncbi.nlm.nih.gov/22235305" }, { "database": "PubMed", "id": "22245935", "url": "https://pubmed.ncbi.nlm.nih.gov/22245935" }, { "database": "PubMed", "id": "22248929", "url": "https://pubmed.ncbi.nlm.nih.gov/22248929" }, { "database": "PubMed", "id": "22253197", "url": "https://pubmed.ncbi.nlm.nih.gov/22253197" }, { "database": "PubMed", "id": "22253983", "url": "https://pubmed.ncbi.nlm.nih.gov/22253983" }, { "database": "PubMed", "id": "22259221", "url": "https://pubmed.ncbi.nlm.nih.gov/22259221" }, { "database": "PubMed", "id": "22262182", "url": "https://pubmed.ncbi.nlm.nih.gov/22262182" }, { "database": "PubMed", "id": "22280833", "url": "https://pubmed.ncbi.nlm.nih.gov/22280833" }, { "database": "PubMed", "id": "22289259", "url": "https://pubmed.ncbi.nlm.nih.gov/22289259" }, { "database": "PubMed", "id": "22293289", "url": "https://pubmed.ncbi.nlm.nih.gov/22293289" }, { "database": "PubMed", "id": "22305966", "url": "https://pubmed.ncbi.nlm.nih.gov/22305966" }, { "database": "PubMed", "id": "22322917", "url": "https://pubmed.ncbi.nlm.nih.gov/22322917" }, { "database": "PubMed", "id": "22337773", "url": "https://pubmed.ncbi.nlm.nih.gov/22337773" }, { "database": "PubMed", "id": "22347457", "url": "https://pubmed.ncbi.nlm.nih.gov/22347457" }, { "database": "PubMed", "id": "22363436", "url": "https://pubmed.ncbi.nlm.nih.gov/22363436" }, { "database": "PubMed", "id": "22363598", "url": "https://pubmed.ncbi.nlm.nih.gov/22363598" }, { "database": "PubMed", "id": "22374978", "url": "https://pubmed.ncbi.nlm.nih.gov/22374978" }, { "database": "PubMed", "id": "22384145", "url": "https://pubmed.ncbi.nlm.nih.gov/22384145" }, { "database": "PubMed", "id": "22388104", "url": "https://pubmed.ncbi.nlm.nih.gov/22388104" }, { "database": "PubMed", "id": "22391563", "url": "https://pubmed.ncbi.nlm.nih.gov/22391563" }, { "database": "PubMed", "id": "22415553", "url": "https://pubmed.ncbi.nlm.nih.gov/22415553" }, { "database": "PubMed", "id": "22422409", "url": "https://pubmed.ncbi.nlm.nih.gov/22422409" }, { "database": "PubMed", "id": "22431710", "url": "https://pubmed.ncbi.nlm.nih.gov/22431710" }, { "database": "PubMed", "id": "22458600", "url": "https://pubmed.ncbi.nlm.nih.gov/22458600" }, { "database": "PubMed", "id": "22460505", "url": "https://pubmed.ncbi.nlm.nih.gov/22460505" }, { "database": "PubMed", "id": "22473959", "url": "https://pubmed.ncbi.nlm.nih.gov/22473959" }, { "database": "PubMed", "id": "22476852", "url": "https://pubmed.ncbi.nlm.nih.gov/22476852" }, { "database": "PubMed", "id": "22487004", "url": "https://pubmed.ncbi.nlm.nih.gov/22487004" }, { "database": "PubMed", "id": "22492939", "url": "https://pubmed.ncbi.nlm.nih.gov/22492939" }, { "database": "PubMed", "id": "22493067", "url": "https://pubmed.ncbi.nlm.nih.gov/22493067" }, { "database": "PubMed", "id": "22509246", "url": "https://pubmed.ncbi.nlm.nih.gov/22509246" }, { "database": "PubMed", "id": "22510297", "url": "https://pubmed.ncbi.nlm.nih.gov/22510297" }, { "database": "PubMed", "id": "22511762", "url": "https://pubmed.ncbi.nlm.nih.gov/22511762" }, { "database": "PubMed", "id": "22523681", "url": "https://pubmed.ncbi.nlm.nih.gov/22523681" }, { "database": "PubMed", "id": "22530768", "url": "https://pubmed.ncbi.nlm.nih.gov/22530768" }, { "database": "PubMed", "id": "22532249", "url": "https://pubmed.ncbi.nlm.nih.gov/22532249" }, { "database": "PubMed", "id": "22536436", "url": "https://pubmed.ncbi.nlm.nih.gov/22536436" }, { "database": "PubMed", "id": "22550181", "url": "https://pubmed.ncbi.nlm.nih.gov/22550181" }, { "database": "PubMed", "id": "22569334", "url": "https://pubmed.ncbi.nlm.nih.gov/22569334" }, { "database": "PubMed", "id": "22570727", "url": "https://pubmed.ncbi.nlm.nih.gov/22570727" }, { "database": "PubMed", "id": "22590625", "url": "https://pubmed.ncbi.nlm.nih.gov/22590625" }, { "database": "PubMed", "id": "22590634", "url": "https://pubmed.ncbi.nlm.nih.gov/22590634" }, { "database": "PubMed", "id": "22614157", "url": "https://pubmed.ncbi.nlm.nih.gov/22614157" }, { "database": "PubMed", "id": "22623960", "url": "https://pubmed.ncbi.nlm.nih.gov/22623960" }, { "database": "PubMed", "id": "22629392", "url": "https://pubmed.ncbi.nlm.nih.gov/22629392" }, { "database": "PubMed", "id": "22634313", "url": "https://pubmed.ncbi.nlm.nih.gov/22634313" }, { "database": "PubMed", "id": "22657251", "url": "https://pubmed.ncbi.nlm.nih.gov/22657251" }, { "database": "PubMed", "id": "22673183", "url": "https://pubmed.ncbi.nlm.nih.gov/22673183" }, { "database": "PubMed", "id": "22675562", "url": "https://pubmed.ncbi.nlm.nih.gov/22675562" }, { "database": "PubMed", "id": "22685542", "url": "https://pubmed.ncbi.nlm.nih.gov/22685542" }, { "database": "PubMed", "id": "22690138", "url": "https://pubmed.ncbi.nlm.nih.gov/22690138" }, { "database": "PubMed", "id": "22709426", "url": "https://pubmed.ncbi.nlm.nih.gov/22709426" }, { "database": "PubMed", "id": "22710713", "url": "https://pubmed.ncbi.nlm.nih.gov/22710713" }, { "database": "PubMed", "id": "22728270", "url": "https://pubmed.ncbi.nlm.nih.gov/22728270" }, { "database": "PubMed", "id": "22728372", "url": "https://pubmed.ncbi.nlm.nih.gov/22728372" }, { "database": "PubMed", "id": "22730174", "url": "https://pubmed.ncbi.nlm.nih.gov/22730174" }, { "database": "PubMed", "id": "22733130", "url": "https://pubmed.ncbi.nlm.nih.gov/22733130" }, { "database": "PubMed", "id": "22739265", "url": "https://pubmed.ncbi.nlm.nih.gov/22739265" }, { "database": "PubMed", "id": "22739986", "url": "https://pubmed.ncbi.nlm.nih.gov/22739986" }, { "database": "PubMed", "id": "22739988", "url": "https://pubmed.ncbi.nlm.nih.gov/22739988" }, { "database": "PubMed", "id": "22745786", "url": "https://pubmed.ncbi.nlm.nih.gov/22745786" }, { "database": "PubMed", "id": "22767580", "url": "https://pubmed.ncbi.nlm.nih.gov/22767580" }, { "database": "PubMed", "id": "22771387", "url": "https://pubmed.ncbi.nlm.nih.gov/22771387" }, { "database": "PubMed", "id": "22781553", "url": "https://pubmed.ncbi.nlm.nih.gov/22781553" }, { "database": "PubMed", "id": "22785470", "url": "https://pubmed.ncbi.nlm.nih.gov/22785470" }, { "database": "PubMed", "id": "22789858", "url": "https://pubmed.ncbi.nlm.nih.gov/22789858" }, { "database": "PubMed", "id": "22799881", "url": "https://pubmed.ncbi.nlm.nih.gov/22799881" }, { "database": "PubMed", "id": "22809628", "url": "https://pubmed.ncbi.nlm.nih.gov/22809628" }, { "database": "PubMed", "id": "22824823", "url": "https://pubmed.ncbi.nlm.nih.gov/22824823" }, { "database": "PubMed", "id": "22830422", "url": "https://pubmed.ncbi.nlm.nih.gov/22830422" }, { "database": "PubMed", "id": "22839755", "url": "https://pubmed.ncbi.nlm.nih.gov/22839755" }, { "database": "PubMed", "id": "22864984", "url": "https://pubmed.ncbi.nlm.nih.gov/22864984" }, { "database": "PubMed", "id": "22869144", "url": "https://pubmed.ncbi.nlm.nih.gov/22869144" }, { "database": "PubMed", "id": "22872237", "url": "https://pubmed.ncbi.nlm.nih.gov/22872237" }, { "database": "PubMed", "id": "22879882", "url": "https://pubmed.ncbi.nlm.nih.gov/22879882" }, { "database": "PubMed", "id": "22880048", "url": "https://pubmed.ncbi.nlm.nih.gov/22880048" }, { "database": "PubMed", "id": "22902327", "url": "https://pubmed.ncbi.nlm.nih.gov/22902327" }, { "database": "PubMed", "id": "22902833", "url": "https://pubmed.ncbi.nlm.nih.gov/22902833" }, { "database": "PubMed", "id": "22905202", "url": "https://pubmed.ncbi.nlm.nih.gov/22905202" }, { "database": "PubMed", "id": "22909302", "url": "https://pubmed.ncbi.nlm.nih.gov/22909302" }, { "database": "PubMed", "id": "22911700", "url": "https://pubmed.ncbi.nlm.nih.gov/22911700" }, { "database": "PubMed", "id": "22911754", "url": "https://pubmed.ncbi.nlm.nih.gov/22911754" }, { "database": "PubMed", "id": "22911820", "url": "https://pubmed.ncbi.nlm.nih.gov/22911820" }, { "database": "PubMed", "id": "22912850", "url": "https://pubmed.ncbi.nlm.nih.gov/22912850" }, { "database": "PubMed", "id": "22927331", "url": "https://pubmed.ncbi.nlm.nih.gov/22927331" }, { "database": "PubMed", "id": "22928011", "url": "https://pubmed.ncbi.nlm.nih.gov/22928011" }, { "database": "PubMed", "id": "22952709", "url": "https://pubmed.ncbi.nlm.nih.gov/22952709" }, { "database": "PubMed", "id": "22956257", "url": "https://pubmed.ncbi.nlm.nih.gov/22956257" }, { "database": "PubMed", "id": "22957045", "url": "https://pubmed.ncbi.nlm.nih.gov/22957045" }, { "database": "PubMed", "id": "22975683", "url": "https://pubmed.ncbi.nlm.nih.gov/22975683" }, { "database": "PubMed", "id": "23007634", "url": "https://pubmed.ncbi.nlm.nih.gov/23007634" }, { "database": "PubMed", "id": "23011139", "url": "https://pubmed.ncbi.nlm.nih.gov/23011139" }, { "database": "PubMed", "id": "23045700", "url": "https://pubmed.ncbi.nlm.nih.gov/23045700" }, { "database": "PubMed", "id": "23049696", "url": "https://pubmed.ncbi.nlm.nih.gov/23049696" }, { "database": "PubMed", "id": "23071583", "url": "https://pubmed.ncbi.nlm.nih.gov/23071583" }, { "database": "PubMed", "id": "23072587", "url": "https://pubmed.ncbi.nlm.nih.gov/23072587" }, { "database": "PubMed", "id": "23077590", "url": "https://pubmed.ncbi.nlm.nih.gov/23077590" }, { "database": "PubMed", "id": "23082158", "url": "https://pubmed.ncbi.nlm.nih.gov/23082158" }, { "database": "PubMed", "id": "23086641", "url": "https://pubmed.ncbi.nlm.nih.gov/23086641" }, { "database": "PubMed", "id": "23091617", "url": "https://pubmed.ncbi.nlm.nih.gov/23091617" }, { "database": "PubMed", "id": "23094058", "url": "https://pubmed.ncbi.nlm.nih.gov/23094058" }, { "database": "PubMed", "id": "23100325", "url": "https://pubmed.ncbi.nlm.nih.gov/23100325" }, { "database": "PubMed", "id": "23119004", "url": "https://pubmed.ncbi.nlm.nih.gov/23119004" }, { "database": "PubMed", "id": "23127854", "url": "https://pubmed.ncbi.nlm.nih.gov/23127854" }, { "database": "PubMed", "id": "23142241", "url": "https://pubmed.ncbi.nlm.nih.gov/23142241" }, { "database": "PubMed", "id": "23142521", "url": "https://pubmed.ncbi.nlm.nih.gov/23142521" }, { "database": "PubMed", "id": "23147412", "url": "https://pubmed.ncbi.nlm.nih.gov/23147412" }, { "database": "PubMed", "id": "23151908", "url": "https://pubmed.ncbi.nlm.nih.gov/23151908" }, { "database": "PubMed", "id": "23152054", "url": "https://pubmed.ncbi.nlm.nih.gov/23152054" }, { "database": "PubMed", "id": "23155381", "url": "https://pubmed.ncbi.nlm.nih.gov/23155381" }, { "database": "PubMed", "id": "23165443", "url": "https://pubmed.ncbi.nlm.nih.gov/23165443" }, { "database": "PubMed", "id": "23167739", "url": "https://pubmed.ncbi.nlm.nih.gov/23167739" }, { "database": "PubMed", "id": "23176396", "url": "https://pubmed.ncbi.nlm.nih.gov/23176396" }, { "database": "PubMed", "id": "23182460", "url": "https://pubmed.ncbi.nlm.nih.gov/23182460" }, { "database": "PubMed", "id": "23183047", "url": "https://pubmed.ncbi.nlm.nih.gov/23183047" }, { "database": "PubMed", "id": "23208610", "url": "https://pubmed.ncbi.nlm.nih.gov/23208610" }, { "database": "PubMed", "id": "23209838", "url": "https://pubmed.ncbi.nlm.nih.gov/23209838" }, { "database": "PubMed", "id": "23220480", "url": "https://pubmed.ncbi.nlm.nih.gov/23220480" }, { "database": "PubMed", "id": "23226094", "url": "https://pubmed.ncbi.nlm.nih.gov/23226094" }, { "database": "PubMed", "id": "23237847", "url": "https://pubmed.ncbi.nlm.nih.gov/23237847" }, { "database": "PubMed", "id": "23242584", "url": "https://pubmed.ncbi.nlm.nih.gov/23242584" }, { "database": "PubMed", "id": "23243000", "url": "https://pubmed.ncbi.nlm.nih.gov/23243000" }, { "database": "PubMed", "id": "23245988", "url": "https://pubmed.ncbi.nlm.nih.gov/23245988" }, { "database": "PubMed", "id": "23250732", "url": "https://pubmed.ncbi.nlm.nih.gov/23250732" }, { "database": "PubMed", "id": "23255002", "url": "https://pubmed.ncbi.nlm.nih.gov/23255002" }, { "database": "PubMed", "id": "23259744", "url": "https://pubmed.ncbi.nlm.nih.gov/23259744" }, { "database": "PubMed", "id": "23263555", "url": "https://pubmed.ncbi.nlm.nih.gov/23263555" }, { "database": "PubMed", "id": "23272152", "url": "https://pubmed.ncbi.nlm.nih.gov/23272152" }, { "database": "PubMed", "id": "23274898", "url": "https://pubmed.ncbi.nlm.nih.gov/23274898" }, { "database": "PubMed", "id": "23284736", "url": "https://pubmed.ncbi.nlm.nih.gov/23284736" }, { "database": "PubMed", "id": "23285096", "url": "https://pubmed.ncbi.nlm.nih.gov/23285096" }, { "database": "PubMed", "id": "23291718", "url": "https://pubmed.ncbi.nlm.nih.gov/23291718" }, { "database": "PubMed", "id": "23300339", "url": "https://pubmed.ncbi.nlm.nih.gov/23300339" }, { "database": "PubMed", "id": "23300563", "url": "https://pubmed.ncbi.nlm.nih.gov/23300563" }, { "database": "PubMed", "id": "23300998", "url": "https://pubmed.ncbi.nlm.nih.gov/23300998" }, { "database": "PubMed", "id": "23303682", "url": "https://pubmed.ncbi.nlm.nih.gov/23303682" }, { "database": "PubMed", "id": "23311938", "url": "https://pubmed.ncbi.nlm.nih.gov/23311938" }, { "database": "PubMed", "id": "23319332", "url": "https://pubmed.ncbi.nlm.nih.gov/23319332" }, { "database": "PubMed", "id": "23326514", "url": "https://pubmed.ncbi.nlm.nih.gov/23326514" }, { "database": "PubMed", "id": "23343403", "url": "https://pubmed.ncbi.nlm.nih.gov/23343403" }, { "database": "PubMed", "id": "23349842", "url": "https://pubmed.ncbi.nlm.nih.gov/23349842" }, { "database": "PubMed", "id": "23349855", "url": "https://pubmed.ncbi.nlm.nih.gov/23349855" }, { "database": "PubMed", "id": "23349989", "url": "https://pubmed.ncbi.nlm.nih.gov/23349989" }, { "database": "PubMed", "id": "23380710", "url": "https://pubmed.ncbi.nlm.nih.gov/23380710" }, { "database": "PubMed", "id": "23381805", "url": "https://pubmed.ncbi.nlm.nih.gov/23381805" }, { "database": "PubMed", "id": "23383195", "url": "https://pubmed.ncbi.nlm.nih.gov/23383195" }, { "database": "PubMed", "id": "23383252", "url": "https://pubmed.ncbi.nlm.nih.gov/23383252" }, { "database": "PubMed", "id": "23383347", "url": "https://pubmed.ncbi.nlm.nih.gov/23383347" }, { "database": "PubMed", "id": "23389114", "url": "https://pubmed.ncbi.nlm.nih.gov/23389114" }, { "database": "PubMed", "id": "23396361", "url": "https://pubmed.ncbi.nlm.nih.gov/23396361" }, { "database": "PubMed", "id": "23402310", "url": "https://pubmed.ncbi.nlm.nih.gov/23402310" }, { "database": "PubMed", "id": "23408974", "url": "https://pubmed.ncbi.nlm.nih.gov/23408974" }, { "database": "PubMed", "id": "23409093", "url": "https://pubmed.ncbi.nlm.nih.gov/23409093" }, { "database": "PubMed", "id": "23415012", "url": "https://pubmed.ncbi.nlm.nih.gov/23415012" }, { "database": "PubMed", "id": "23419269", "url": "https://pubmed.ncbi.nlm.nih.gov/23419269" }, { "database": "PubMed", "id": "23420345", "url": "https://pubmed.ncbi.nlm.nih.gov/23420345" }, { "database": "PubMed", "id": "23420486", "url": "https://pubmed.ncbi.nlm.nih.gov/23420486" }, { "database": "PubMed", "id": "23426781", "url": "https://pubmed.ncbi.nlm.nih.gov/23426781" }, { "database": "PubMed", "id": "23427269", "url": "https://pubmed.ncbi.nlm.nih.gov/23427269" }, { "database": "PubMed", "id": "23437141", "url": "https://pubmed.ncbi.nlm.nih.gov/23437141" }, { "database": "PubMed", "id": "23437184", "url": "https://pubmed.ncbi.nlm.nih.gov/23437184" }, { "database": "PubMed", "id": "23437362", "url": "https://pubmed.ncbi.nlm.nih.gov/23437362" }, { "database": "PubMed", "id": "23440515", "url": "https://pubmed.ncbi.nlm.nih.gov/23440515" }, { "database": "PubMed", "id": "23440594", "url": "https://pubmed.ncbi.nlm.nih.gov/23440594" }, { "database": "PubMed", "id": "23442976", "url": "https://pubmed.ncbi.nlm.nih.gov/23442976" }, { "database": "PubMed", "id": "23443110", "url": "https://pubmed.ncbi.nlm.nih.gov/23443110" }, { "database": "PubMed", "id": "23460862", "url": "https://pubmed.ncbi.nlm.nih.gov/23460862" }, { "database": "PubMed", "id": "23466053", "url": "https://pubmed.ncbi.nlm.nih.gov/23466053" }, { "database": "PubMed", "id": "23468988", "url": "https://pubmed.ncbi.nlm.nih.gov/23468988" }, { "database": "PubMed", "id": "23469007", "url": "https://pubmed.ncbi.nlm.nih.gov/23469007" }, { "database": "PubMed", "id": "23497867", "url": "https://pubmed.ncbi.nlm.nih.gov/23497867" }, { "database": "PubMed", "id": "23506355", "url": "https://pubmed.ncbi.nlm.nih.gov/23506355" }, { "database": "PubMed", "id": "23509892", "url": "https://pubmed.ncbi.nlm.nih.gov/23509892" }, { "database": "PubMed", "id": "23517112", "url": "https://pubmed.ncbi.nlm.nih.gov/23517112" }, { "database": "PubMed", "id": "23520133", "url": "https://pubmed.ncbi.nlm.nih.gov/23520133" }, { "database": "PubMed", "id": "23529222", "url": "https://pubmed.ncbi.nlm.nih.gov/23529222" }, { "database": "PubMed", "id": "23552696", "url": "https://pubmed.ncbi.nlm.nih.gov/23552696" }, { "database": "PubMed", "id": "23554999", "url": "https://pubmed.ncbi.nlm.nih.gov/23554999" }, { "database": "PubMed", "id": "23555559", "url": "https://pubmed.ncbi.nlm.nih.gov/23555559" }, { "database": "PubMed", "id": "23566222", "url": "https://pubmed.ncbi.nlm.nih.gov/23566222" }, { "database": "PubMed", "id": "23570421", "url": "https://pubmed.ncbi.nlm.nih.gov/23570421" }, { "database": "PubMed", "id": "23573286", "url": "https://pubmed.ncbi.nlm.nih.gov/23573286" }, { "database": "PubMed", "id": "23580233", "url": "https://pubmed.ncbi.nlm.nih.gov/23580233" }, { "database": "PubMed", "id": "23590596", "url": "https://pubmed.ncbi.nlm.nih.gov/23590596" }, { "database": "PubMed", "id": "23596468", "url": "https://pubmed.ncbi.nlm.nih.gov/23596468" }, { "database": "PubMed", "id": "23596569", "url": "https://pubmed.ncbi.nlm.nih.gov/23596569" }, { "database": "PubMed", "id": "23598299", "url": "https://pubmed.ncbi.nlm.nih.gov/23598299" }, { "database": "PubMed", "id": "23618343", "url": "https://pubmed.ncbi.nlm.nih.gov/23618343" }, { "database": "PubMed", "id": "23623869", "url": "https://pubmed.ncbi.nlm.nih.gov/23623869" }, { "database": "PubMed", "id": "23623968", "url": "https://pubmed.ncbi.nlm.nih.gov/23623968" }, { "database": "PubMed", "id": "23632475", "url": "https://pubmed.ncbi.nlm.nih.gov/23632475" }, { "database": "PubMed", "id": "23644504", "url": "https://pubmed.ncbi.nlm.nih.gov/23644504" }, { "database": "PubMed", "id": "23650507", "url": "https://pubmed.ncbi.nlm.nih.gov/23650507" }, { "database": "PubMed", "id": "23652833", "url": "https://pubmed.ncbi.nlm.nih.gov/23652833" }, { "database": "PubMed", "id": "23668972", "url": "https://pubmed.ncbi.nlm.nih.gov/23668972" }, { "database": "PubMed", "id": "23671619", "url": "https://pubmed.ncbi.nlm.nih.gov/23671619" }, { "database": "PubMed", "id": "23673367", "url": "https://pubmed.ncbi.nlm.nih.gov/23673367" }, { "database": "PubMed", "id": "23676467", "url": "https://pubmed.ncbi.nlm.nih.gov/23676467" }, { "database": "PubMed", "id": "23680186", "url": "https://pubmed.ncbi.nlm.nih.gov/23680186" }, { "database": "PubMed", "id": "23681745", "url": "https://pubmed.ncbi.nlm.nih.gov/23681745" }, { "database": "PubMed", "id": "23682967", "url": "https://pubmed.ncbi.nlm.nih.gov/23682967" }, { "database": "PubMed", "id": "23684622", "url": "https://pubmed.ncbi.nlm.nih.gov/23684622" }, { "database": "PubMed", "id": "23686305", "url": "https://pubmed.ncbi.nlm.nih.gov/23686305" }, { "database": "PubMed", "id": "23693014", "url": "https://pubmed.ncbi.nlm.nih.gov/23693014" }, { "database": "PubMed", "id": "23696823", "url": "https://pubmed.ncbi.nlm.nih.gov/23696823" }, { "database": "PubMed", "id": "23705826", "url": "https://pubmed.ncbi.nlm.nih.gov/23705826" }, { "database": "PubMed", "id": "23707764", "url": "https://pubmed.ncbi.nlm.nih.gov/23707764" }, { "database": "PubMed", "id": "23725059", "url": "https://pubmed.ncbi.nlm.nih.gov/23725059" }, { "database": "PubMed", "id": "23727661", "url": "https://pubmed.ncbi.nlm.nih.gov/23727661" }, { "database": "PubMed", "id": "23732709", "url": "https://pubmed.ncbi.nlm.nih.gov/23732709" }, { "database": "PubMed", "id": "23748344", "url": "https://pubmed.ncbi.nlm.nih.gov/23748344" }, { "database": "PubMed", "id": "23760395", "url": "https://pubmed.ncbi.nlm.nih.gov/23760395" }, { "database": "PubMed", "id": "23762398", "url": "https://pubmed.ncbi.nlm.nih.gov/23762398" }, { "database": "PubMed", "id": "23764845", "url": "https://pubmed.ncbi.nlm.nih.gov/23764845" }, { "database": "PubMed", "id": "23773626", "url": "https://pubmed.ncbi.nlm.nih.gov/23773626" }, { "database": "PubMed", "id": "23776620", "url": "https://pubmed.ncbi.nlm.nih.gov/23776620" }, { "database": "PubMed", "id": "23785417", "url": "https://pubmed.ncbi.nlm.nih.gov/23785417" }, { "database": "PubMed", "id": "23792675", "url": "https://pubmed.ncbi.nlm.nih.gov/23792675" }, { "database": "PubMed", "id": "23796957", "url": "https://pubmed.ncbi.nlm.nih.gov/23796957" }, { "database": "PubMed", "id": "23799035", "url": "https://pubmed.ncbi.nlm.nih.gov/23799035" }, { "database": "PubMed", "id": "23799852", "url": "https://pubmed.ncbi.nlm.nih.gov/23799852" }, { "database": "PubMed", "id": "23802099", "url": "https://pubmed.ncbi.nlm.nih.gov/23802099" }, { "database": "PubMed", "id": "23803188", "url": "https://pubmed.ncbi.nlm.nih.gov/23803188" }, { "database": "PubMed", "id": "23803661", "url": "https://pubmed.ncbi.nlm.nih.gov/23803661" }, { "database": "PubMed", "id": "23824064", "url": "https://pubmed.ncbi.nlm.nih.gov/23824064" }, { "database": "PubMed", "id": "23824914", "url": "https://pubmed.ncbi.nlm.nih.gov/23824914" }, { "database": "PubMed", "id": "23840605", "url": "https://pubmed.ncbi.nlm.nih.gov/23840605" }, { "database": "PubMed", "id": "23844554", "url": "https://pubmed.ncbi.nlm.nih.gov/23844554" }, { "database": "PubMed", "id": "23845085", "url": "https://pubmed.ncbi.nlm.nih.gov/23845085" }, { "database": "PubMed", "id": "23867201", "url": "https://pubmed.ncbi.nlm.nih.gov/23867201" }, { "database": "PubMed", "id": "23872070", "url": "https://pubmed.ncbi.nlm.nih.gov/23872070" }, { "database": "PubMed", "id": "23872419", "url": "https://pubmed.ncbi.nlm.nih.gov/23872419" }, { "database": "PubMed", "id": "23874483", "url": "https://pubmed.ncbi.nlm.nih.gov/23874483" }, { "database": "PubMed", "id": "23874694", "url": "https://pubmed.ncbi.nlm.nih.gov/23874694" }, { "database": "PubMed", "id": "23874880", "url": "https://pubmed.ncbi.nlm.nih.gov/23874880" }, { "database": "PubMed", "id": "23880825", "url": "https://pubmed.ncbi.nlm.nih.gov/23880825" }, { "database": "PubMed", "id": "23895284", "url": "https://pubmed.ncbi.nlm.nih.gov/23895284" }, { "database": "PubMed", "id": "23900743", "url": "https://pubmed.ncbi.nlm.nih.gov/23900743" }, { "database": "PubMed", "id": "23902739", "url": "https://pubmed.ncbi.nlm.nih.gov/23902739" }, { "database": "PubMed", "id": "23904987", "url": "https://pubmed.ncbi.nlm.nih.gov/23904987" }, { "database": "PubMed", "id": "23912456", "url": "https://pubmed.ncbi.nlm.nih.gov/23912456" }, { "database": "PubMed", "id": "23922669", "url": "https://pubmed.ncbi.nlm.nih.gov/23922669" }, { "database": "PubMed", "id": "23922774", "url": "https://pubmed.ncbi.nlm.nih.gov/23922774" }, { "database": "PubMed", "id": "23928696", "url": "https://pubmed.ncbi.nlm.nih.gov/23928696" }, { "database": "PubMed", "id": "23933705", "url": "https://pubmed.ncbi.nlm.nih.gov/23933705" }, { "database": "PubMed", "id": "23935944", "url": "https://pubmed.ncbi.nlm.nih.gov/23935944" }, { "database": "PubMed", "id": "23938603", "url": "https://pubmed.ncbi.nlm.nih.gov/23938603" }, { "database": "PubMed", "id": "23940416", "url": "https://pubmed.ncbi.nlm.nih.gov/23940416" }, { "database": "PubMed", "id": "23940660", "url": "https://pubmed.ncbi.nlm.nih.gov/23940660" }, { "database": "PubMed", "id": "23940704", "url": "https://pubmed.ncbi.nlm.nih.gov/23940704" }, { "database": "PubMed", "id": "23946798", "url": "https://pubmed.ncbi.nlm.nih.gov/23946798" }, { "database": "PubMed", "id": "23950935", "url": "https://pubmed.ncbi.nlm.nih.gov/23950935" }, { "database": "PubMed", "id": "23951036", "url": "https://pubmed.ncbi.nlm.nih.gov/23951036" }, { "database": "PubMed", "id": "23951353", "url": "https://pubmed.ncbi.nlm.nih.gov/23951353" }, { "database": "PubMed", "id": "23958999", "url": "https://pubmed.ncbi.nlm.nih.gov/23958999" }, { "database": "PubMed", "id": "23977025", "url": "https://pubmed.ncbi.nlm.nih.gov/23977025" }, { "database": "PubMed", "id": "23979601", "url": "https://pubmed.ncbi.nlm.nih.gov/23979601" }, { "database": "PubMed", "id": "23984323", "url": "https://pubmed.ncbi.nlm.nih.gov/23984323" }, { "database": "PubMed", "id": "23989949", "url": "https://pubmed.ncbi.nlm.nih.gov/23989949" }, { "database": "PubMed", "id": "23990921", "url": "https://pubmed.ncbi.nlm.nih.gov/23990921" }, { "database": "PubMed", "id": "23995785", "url": "https://pubmed.ncbi.nlm.nih.gov/23995785" }, { "database": "PubMed", "id": "23996929", "url": "https://pubmed.ncbi.nlm.nih.gov/23996929" }, { "database": "PubMed", "id": "24006489", "url": "https://pubmed.ncbi.nlm.nih.gov/24006489" }, { "database": "PubMed", "id": "24023012", "url": "https://pubmed.ncbi.nlm.nih.gov/24023012" }, { "database": "PubMed", "id": "24023938", "url": "https://pubmed.ncbi.nlm.nih.gov/24023938" }, { "database": "PubMed", "id": "24024143", "url": "https://pubmed.ncbi.nlm.nih.gov/24024143" }, { "database": "PubMed", "id": "24036604", "url": "https://pubmed.ncbi.nlm.nih.gov/24036604" }, { "database": "PubMed", "id": "24040255", "url": "https://pubmed.ncbi.nlm.nih.gov/24040255" }, { "database": "PubMed", "id": "24042734", "url": "https://pubmed.ncbi.nlm.nih.gov/24042734" }, { "database": "PubMed", "id": "24053190", "url": "https://pubmed.ncbi.nlm.nih.gov/24053190" }, { "database": "PubMed", "id": "24053672", "url": "https://pubmed.ncbi.nlm.nih.gov/24053672" }, { "database": "PubMed", "id": "24058557", "url": "https://pubmed.ncbi.nlm.nih.gov/24058557" }, { "database": "PubMed", "id": "24070020", "url": "https://pubmed.ncbi.nlm.nih.gov/24070020" }, { "database": "PubMed", "id": "24073922", "url": "https://pubmed.ncbi.nlm.nih.gov/24073922" }, { "database": "PubMed", "id": "24079335", "url": "https://pubmed.ncbi.nlm.nih.gov/24079335" }, { "database": "PubMed", "id": "24086535", "url": "https://pubmed.ncbi.nlm.nih.gov/24086535" }, { "database": "PubMed", "id": "24086728", "url": "https://pubmed.ncbi.nlm.nih.gov/24086728" }, { "database": "PubMed", "id": "24091816", "url": "https://pubmed.ncbi.nlm.nih.gov/24091816" }, { "database": "PubMed", "id": "24094245", "url": "https://pubmed.ncbi.nlm.nih.gov/24094245" }, { "database": "PubMed", "id": "24098375", "url": "https://pubmed.ncbi.nlm.nih.gov/24098375" }, { "database": "PubMed", "id": "24098385", "url": "https://pubmed.ncbi.nlm.nih.gov/24098385" }, { "database": "PubMed", "id": "24107614", "url": "https://pubmed.ncbi.nlm.nih.gov/24107614" }, { "database": "PubMed", "id": "24113173", "url": "https://pubmed.ncbi.nlm.nih.gov/24113173" }, { "database": "PubMed", "id": "24115733", "url": "https://pubmed.ncbi.nlm.nih.gov/24115733" }, { "database": "PubMed", "id": "24117074", "url": "https://pubmed.ncbi.nlm.nih.gov/24117074" }, { "database": "PubMed", "id": "24126619", "url": "https://pubmed.ncbi.nlm.nih.gov/24126619" }, { "database": "PubMed", "id": "24131623", "url": "https://pubmed.ncbi.nlm.nih.gov/24131623" }, { "database": "PubMed", "id": "24157493", "url": "https://pubmed.ncbi.nlm.nih.gov/24157493" }, { "database": "PubMed", "id": "24159375", "url": "https://pubmed.ncbi.nlm.nih.gov/24159375" }, { "database": "PubMed", "id": "24161930", "url": "https://pubmed.ncbi.nlm.nih.gov/24161930" }, { "database": "PubMed", "id": "24169049", "url": "https://pubmed.ncbi.nlm.nih.gov/24169049" }, { "database": "PubMed", "id": "24175297", "url": "https://pubmed.ncbi.nlm.nih.gov/24175297" }, { "database": "PubMed", "id": "24176845", "url": "https://pubmed.ncbi.nlm.nih.gov/24176845" }, { "database": "PubMed", "id": "24178756", "url": "https://pubmed.ncbi.nlm.nih.gov/24178756" }, { "database": "PubMed", "id": "24179501", "url": "https://pubmed.ncbi.nlm.nih.gov/24179501" }, { "database": "PubMed", "id": "24179530", "url": "https://pubmed.ncbi.nlm.nih.gov/24179530" }, { "database": "PubMed", "id": "24188406", "url": "https://pubmed.ncbi.nlm.nih.gov/24188406" }, { "database": "PubMed", "id": "24201812", "url": "https://pubmed.ncbi.nlm.nih.gov/24201812" }, { "database": "PubMed", "id": "24217713", "url": "https://pubmed.ncbi.nlm.nih.gov/24217713" }, { "database": "PubMed", "id": "24232099", "url": "https://pubmed.ncbi.nlm.nih.gov/24232099" }, { "database": "PubMed", "id": "24236150", "url": "https://pubmed.ncbi.nlm.nih.gov/24236150" }, { "database": "PubMed", "id": "24244481", "url": "https://pubmed.ncbi.nlm.nih.gov/24244481" }, { "database": "PubMed", "id": "24244612", "url": "https://pubmed.ncbi.nlm.nih.gov/24244612" }, { "database": "PubMed", "id": "24247980", "url": "https://pubmed.ncbi.nlm.nih.gov/24247980" }, { "database": "PubMed", "id": "24260371", "url": "https://pubmed.ncbi.nlm.nih.gov/24260371" }, { "database": "PubMed", "id": "24273605", "url": "https://pubmed.ncbi.nlm.nih.gov/24273605" }, { "database": "PubMed", "id": "24280348", "url": "https://pubmed.ncbi.nlm.nih.gov/24280348" }, { "database": "PubMed", "id": "24280901", "url": "https://pubmed.ncbi.nlm.nih.gov/24280901" }, { "database": "PubMed", "id": "24282571", "url": "https://pubmed.ncbi.nlm.nih.gov/24282571" }, { "database": "PubMed", "id": "24284390", "url": "https://pubmed.ncbi.nlm.nih.gov/24284390" }, { "database": "PubMed", "id": "24302564", "url": "https://pubmed.ncbi.nlm.nih.gov/24302564" }, { "database": "PubMed", "id": "24312263", "url": "https://pubmed.ncbi.nlm.nih.gov/24312263" }, { "database": "PubMed", "id": "24316235", "url": "https://pubmed.ncbi.nlm.nih.gov/24316235" }, { "database": "PubMed", "id": "24317467", "url": "https://pubmed.ncbi.nlm.nih.gov/24317467" }, { "database": "PubMed", "id": "24325618", "url": "https://pubmed.ncbi.nlm.nih.gov/24325618" }, { "database": "PubMed", "id": "24336406", "url": "https://pubmed.ncbi.nlm.nih.gov/24336406" }, { "database": "PubMed", "id": "24337632", "url": "https://pubmed.ncbi.nlm.nih.gov/24337632" }, { "database": "PubMed", "id": "24338765", "url": "https://pubmed.ncbi.nlm.nih.gov/24338765" }, { "database": "PubMed", "id": "24349321", "url": "https://pubmed.ncbi.nlm.nih.gov/24349321" }, { "database": "PubMed", "id": "24352480", "url": "https://pubmed.ncbi.nlm.nih.gov/24352480" }, { "database": "PubMed", "id": "24354797", "url": "https://pubmed.ncbi.nlm.nih.gov/24354797" }, { "database": "PubMed", "id": "24356956", "url": "https://pubmed.ncbi.nlm.nih.gov/24356956" }, { "database": "PubMed", "id": "24358196", "url": "https://pubmed.ncbi.nlm.nih.gov/24358196" }, { "database": "PubMed", "id": "24365180", "url": "https://pubmed.ncbi.nlm.nih.gov/24365180" }, { "database": "PubMed", "id": "24372645", "url": "https://pubmed.ncbi.nlm.nih.gov/24372645" }, { "database": "PubMed", "id": "24374242", "url": "https://pubmed.ncbi.nlm.nih.gov/24374242" }, { "database": "PubMed", "id": "24377058", "url": "https://pubmed.ncbi.nlm.nih.gov/24377058" }, { "database": "PubMed", "id": "24378649", "url": "https://pubmed.ncbi.nlm.nih.gov/24378649" }, { "database": "PubMed", "id": "24379655", "url": "https://pubmed.ncbi.nlm.nih.gov/24379655" }, { "database": "PubMed", "id": "24384983", "url": "https://pubmed.ncbi.nlm.nih.gov/24384983" }, { "database": "PubMed", "id": "24392034", "url": "https://pubmed.ncbi.nlm.nih.gov/24392034" }, { "database": "PubMed", "id": "24396487", "url": "https://pubmed.ncbi.nlm.nih.gov/24396487" }, { "database": "PubMed", "id": "24402647", "url": "https://pubmed.ncbi.nlm.nih.gov/24402647" }, { "database": "PubMed", "id": "24413065", "url": "https://pubmed.ncbi.nlm.nih.gov/24413065" }, { "database": "PubMed", "id": "24416349", "url": "https://pubmed.ncbi.nlm.nih.gov/24416349" }, { "database": "PubMed", "id": "24416418", "url": "https://pubmed.ncbi.nlm.nih.gov/24416418" }, { "database": "PubMed", "id": "24428908", "url": "https://pubmed.ncbi.nlm.nih.gov/24428908" }, { "database": "PubMed", "id": "24435307", "url": "https://pubmed.ncbi.nlm.nih.gov/24435307" }, { "database": "PubMed", "id": "24446434", "url": "https://pubmed.ncbi.nlm.nih.gov/24446434" }, { "database": "PubMed", "id": "24448243", "url": "https://pubmed.ncbi.nlm.nih.gov/24448243" }, { "database": "PubMed", "id": "24448490", "url": "https://pubmed.ncbi.nlm.nih.gov/24448490" }, { "database": "PubMed", "id": "24451322", "url": "https://pubmed.ncbi.nlm.nih.gov/24451322" }, { "database": "PubMed", "id": "24452601", "url": "https://pubmed.ncbi.nlm.nih.gov/24452601" }, { "database": "PubMed", "id": "24454800", "url": "https://pubmed.ncbi.nlm.nih.gov/24454800" }, { "database": "PubMed", "id": "24462769", "url": "https://pubmed.ncbi.nlm.nih.gov/24462769" }, { "database": "PubMed", "id": "24467442", "url": "https://pubmed.ncbi.nlm.nih.gov/24467442" }, { "database": "PubMed", "id": "24479521", "url": "https://pubmed.ncbi.nlm.nih.gov/24479521" }, { "database": "PubMed", "id": "24496460", "url": "https://pubmed.ncbi.nlm.nih.gov/24496460" }, { "database": "PubMed", "id": "24521094", "url": "https://pubmed.ncbi.nlm.nih.gov/24521094" }, { "database": "PubMed", "id": "24521217", "url": "https://pubmed.ncbi.nlm.nih.gov/24521217" }, { "database": "PubMed", "id": "24523415", "url": "https://pubmed.ncbi.nlm.nih.gov/24523415" }, { "database": "PubMed", "id": "24523904", "url": "https://pubmed.ncbi.nlm.nih.gov/24523904" }, { "database": "PubMed", "id": "24525337", "url": "https://pubmed.ncbi.nlm.nih.gov/24525337" }, { "database": "PubMed", "id": "24526702", "url": "https://pubmed.ncbi.nlm.nih.gov/24526702" }, { "database": "PubMed", "id": "24535192", "url": "https://pubmed.ncbi.nlm.nih.gov/24535192" }, { "database": "PubMed", "id": "24558442", "url": "https://pubmed.ncbi.nlm.nih.gov/24558442" }, { "database": "PubMed", "id": "24561239", "url": "https://pubmed.ncbi.nlm.nih.gov/24561239" }, { "database": "PubMed", "id": "24562770", "url": "https://pubmed.ncbi.nlm.nih.gov/24562770" }, { "database": "PubMed", "id": "24571487", "url": "https://pubmed.ncbi.nlm.nih.gov/24571487" }, { "database": "PubMed", "id": "24581231", "url": "https://pubmed.ncbi.nlm.nih.gov/24581231" }, { "database": "PubMed", "id": "24585214", "url": "https://pubmed.ncbi.nlm.nih.gov/24585214" }, { "database": "PubMed", "id": "24605828", "url": "https://pubmed.ncbi.nlm.nih.gov/24605828" }, { "database": "PubMed", "id": "24611062", "url": "https://pubmed.ncbi.nlm.nih.gov/24611062" }, { "database": "PubMed", "id": "24612393", "url": "https://pubmed.ncbi.nlm.nih.gov/24612393" }, { "database": "PubMed", "id": "24613353", "url": "https://pubmed.ncbi.nlm.nih.gov/24613353" }, { "database": "PubMed", "id": "24615340", "url": "https://pubmed.ncbi.nlm.nih.gov/24615340" }, { "database": "PubMed", "id": "24618420", "url": "https://pubmed.ncbi.nlm.nih.gov/24618420" }, { "database": "PubMed", "id": "24625973", "url": "https://pubmed.ncbi.nlm.nih.gov/24625973" }, { "database": "PubMed", "id": "24627641", "url": "https://pubmed.ncbi.nlm.nih.gov/24627641" }, { "database": "PubMed", "id": "24628780", "url": "https://pubmed.ncbi.nlm.nih.gov/24628780" }, { "database": "PubMed", "id": "24650522", "url": "https://pubmed.ncbi.nlm.nih.gov/24650522" }, { "database": "PubMed", "id": "24654606", "url": "https://pubmed.ncbi.nlm.nih.gov/24654606" }, { "database": "PubMed", "id": "24662831", "url": "https://pubmed.ncbi.nlm.nih.gov/24662831" }, { "database": "PubMed", "id": "24669186", "url": "https://pubmed.ncbi.nlm.nih.gov/24669186" }, { "database": "PubMed", "id": "24670043", "url": "https://pubmed.ncbi.nlm.nih.gov/24670043" }, { "database": "PubMed", "id": "24675668", "url": "https://pubmed.ncbi.nlm.nih.gov/24675668" }, { "database": "PubMed", "id": "24676635", "url": "https://pubmed.ncbi.nlm.nih.gov/24676635" }, { "database": "PubMed", "id": "24699303", "url": "https://pubmed.ncbi.nlm.nih.gov/24699303" }, { "database": "PubMed", "id": "24705275", "url": "https://pubmed.ncbi.nlm.nih.gov/24705275" }, { "database": "PubMed", "id": "24727660", "url": "https://pubmed.ncbi.nlm.nih.gov/24727660" }, { "database": "PubMed", "id": "24729100", "url": "https://pubmed.ncbi.nlm.nih.gov/24729100" }, { "database": "PubMed", "id": "24743054", "url": "https://pubmed.ncbi.nlm.nih.gov/24743054" }, { "database": "PubMed", "id": "24759784", "url": "https://pubmed.ncbi.nlm.nih.gov/24759784" }, { "database": "PubMed", "id": "24797310", "url": "https://pubmed.ncbi.nlm.nih.gov/24797310" }, { "database": "PubMed", "id": "24797432", "url": "https://pubmed.ncbi.nlm.nih.gov/24797432" }, { "database": "PubMed", "id": "24797434", "url": "https://pubmed.ncbi.nlm.nih.gov/24797434" }, { "database": "PubMed", "id": "24804226", "url": "https://pubmed.ncbi.nlm.nih.gov/24804226" }, { "database": "PubMed", "id": "24804268", "url": "https://pubmed.ncbi.nlm.nih.gov/24804268" }, { "database": "PubMed", "id": "24810113", "url": "https://pubmed.ncbi.nlm.nih.gov/24810113" }, { "database": "PubMed", "id": "24810758", "url": "https://pubmed.ncbi.nlm.nih.gov/24810758" }, { "database": "PubMed", "id": "24812621", "url": "https://pubmed.ncbi.nlm.nih.gov/24812621" }, { "database": "PubMed", "id": "24844349", "url": "https://pubmed.ncbi.nlm.nih.gov/24844349" }, { "database": "PubMed", "id": "24868319", "url": "https://pubmed.ncbi.nlm.nih.gov/24868319" }, { "database": "PubMed", "id": "24878056", "url": "https://pubmed.ncbi.nlm.nih.gov/24878056" }, { "database": "PubMed", "id": "24899686", "url": "https://pubmed.ncbi.nlm.nih.gov/24899686" }, { "database": "PubMed", "id": "24900620", "url": "https://pubmed.ncbi.nlm.nih.gov/24900620" }, { "database": "PubMed", "id": "24905095", "url": "https://pubmed.ncbi.nlm.nih.gov/24905095" }, { "database": "PubMed", "id": "24905466", "url": "https://pubmed.ncbi.nlm.nih.gov/24905466" }, { "database": "PubMed", "id": "24918199", "url": "https://pubmed.ncbi.nlm.nih.gov/24918199" }, { "database": "PubMed", "id": "24927123", "url": "https://pubmed.ncbi.nlm.nih.gov/24927123" }, { "database": "PubMed", "id": "24933731", "url": "https://pubmed.ncbi.nlm.nih.gov/24933731" }, { "database": "PubMed", "id": "24941119", "url": "https://pubmed.ncbi.nlm.nih.gov/24941119" }, { "database": "PubMed", "id": "24944883", "url": "https://pubmed.ncbi.nlm.nih.gov/24944883" }, { "database": "PubMed", "id": "24952732", "url": "https://pubmed.ncbi.nlm.nih.gov/24952732" }, { "database": "PubMed", "id": "24955034", "url": "https://pubmed.ncbi.nlm.nih.gov/24955034" }, { "database": "PubMed", "id": "24977346", "url": "https://pubmed.ncbi.nlm.nih.gov/24977346" }, { "database": "PubMed", "id": "24979261", "url": "https://pubmed.ncbi.nlm.nih.gov/24979261" }, { "database": "PubMed", "id": "24979463", "url": "https://pubmed.ncbi.nlm.nih.gov/24979463" }, { "database": "PubMed", "id": "24984001", "url": "https://pubmed.ncbi.nlm.nih.gov/24984001" }, { "database": "PubMed", "id": "24992302", "url": "https://pubmed.ncbi.nlm.nih.gov/24992302" }, { "database": "PubMed", "id": "24996256", "url": "https://pubmed.ncbi.nlm.nih.gov/24996256" }, { "database": "PubMed", "id": "25003810", "url": "https://pubmed.ncbi.nlm.nih.gov/25003810" }, { "database": "PubMed", "id": "25026292", "url": "https://pubmed.ncbi.nlm.nih.gov/25026292" }, { "database": "PubMed", "id": "25035961", "url": "https://pubmed.ncbi.nlm.nih.gov/25035961" }, { "database": "PubMed", "id": "25040157", "url": "https://pubmed.ncbi.nlm.nih.gov/25040157" }, { "database": "PubMed", "id": "25058613", "url": "https://pubmed.ncbi.nlm.nih.gov/25058613" }, { "database": "PubMed", "id": "25063029", "url": "https://pubmed.ncbi.nlm.nih.gov/25063029" }, { "database": "PubMed", "id": "25071759", "url": "https://pubmed.ncbi.nlm.nih.gov/25071759" }, { "database": "PubMed", "id": "25085593", "url": "https://pubmed.ncbi.nlm.nih.gov/25085593" }, { "database": "PubMed", "id": "25088800", "url": "https://pubmed.ncbi.nlm.nih.gov/25088800" }, { "database": "PubMed", "id": "25096023", "url": "https://pubmed.ncbi.nlm.nih.gov/25096023" }, { "database": "PubMed", "id": "25098276", "url": "https://pubmed.ncbi.nlm.nih.gov/25098276" }, { "database": "PubMed", "id": "25109354", "url": "https://pubmed.ncbi.nlm.nih.gov/25109354" }, { "database": "PubMed", "id": "25110549", "url": "https://pubmed.ncbi.nlm.nih.gov/25110549" }, { "database": "PubMed", "id": "25111376", "url": "https://pubmed.ncbi.nlm.nih.gov/25111376" }, { "database": "PubMed", "id": "25122478", "url": "https://pubmed.ncbi.nlm.nih.gov/25122478" }, { "database": "PubMed", "id": "25136826", "url": "https://pubmed.ncbi.nlm.nih.gov/25136826" }, { "database": "PubMed", "id": "25152245", "url": "https://pubmed.ncbi.nlm.nih.gov/25152245" }, { "database": "PubMed", "id": "25153728", "url": "https://pubmed.ncbi.nlm.nih.gov/25153728" }, { "database": "PubMed", "id": "25168062", "url": "https://pubmed.ncbi.nlm.nih.gov/25168062" }, { "database": "PubMed", "id": "25177796", "url": "https://pubmed.ncbi.nlm.nih.gov/25177796" }, { "database": "PubMed", "id": "25179402", "url": "https://pubmed.ncbi.nlm.nih.gov/25179402" }, { "database": "PubMed", "id": "25190803", "url": "https://pubmed.ncbi.nlm.nih.gov/25190803" }, { "database": "PubMed", "id": "25191523", "url": "https://pubmed.ncbi.nlm.nih.gov/25191523" }, { "database": "PubMed", "id": "25196260", "url": "https://pubmed.ncbi.nlm.nih.gov/25196260" }, { "database": "PubMed", "id": "25212826", "url": "https://pubmed.ncbi.nlm.nih.gov/25212826" }, { "database": "PubMed", "id": "25221952", "url": "https://pubmed.ncbi.nlm.nih.gov/25221952" }, { "database": "PubMed", "id": "25228590", "url": "https://pubmed.ncbi.nlm.nih.gov/25228590" }, { "database": "PubMed", "id": "25231347", "url": "https://pubmed.ncbi.nlm.nih.gov/25231347" }, { "database": "PubMed", "id": "25231727", "url": "https://pubmed.ncbi.nlm.nih.gov/25231727" }, { "database": "PubMed", "id": "25243120", "url": "https://pubmed.ncbi.nlm.nih.gov/25243120" }, { "database": "PubMed", "id": "25243186", "url": "https://pubmed.ncbi.nlm.nih.gov/25243186" }, { "database": "PubMed", "id": "25245332", "url": "https://pubmed.ncbi.nlm.nih.gov/25245332" }, { "database": "PubMed", "id": "25248616", "url": "https://pubmed.ncbi.nlm.nih.gov/25248616" }, { "database": "PubMed", "id": "25257523", "url": "https://pubmed.ncbi.nlm.nih.gov/25257523" }, { "database": "PubMed", "id": "25273559", "url": "https://pubmed.ncbi.nlm.nih.gov/25273559" }, { "database": "PubMed", "id": "25277204", "url": "https://pubmed.ncbi.nlm.nih.gov/25277204" }, { "database": "PubMed", "id": "25283550", "url": "https://pubmed.ncbi.nlm.nih.gov/25283550" }, { "database": "PubMed", "id": "25288334", "url": "https://pubmed.ncbi.nlm.nih.gov/25288334" }, { "database": "PubMed", "id": "25295093", "url": "https://pubmed.ncbi.nlm.nih.gov/25295093" }, { "database": "PubMed", "id": "25296973", "url": "https://pubmed.ncbi.nlm.nih.gov/25296973" }, { "database": "PubMed", "id": "25296981", "url": "https://pubmed.ncbi.nlm.nih.gov/25296981" }, { "database": "PubMed", "id": "25302072", "url": "https://pubmed.ncbi.nlm.nih.gov/25302072" }, { "database": "PubMed", "id": "25306901", "url": "https://pubmed.ncbi.nlm.nih.gov/25306901" }, { "database": "PubMed", "id": "25311506", "url": "https://pubmed.ncbi.nlm.nih.gov/25311506" }, { "database": "PubMed", "id": "25311616", "url": "https://pubmed.ncbi.nlm.nih.gov/25311616" }, { "database": "PubMed", "id": "25313141", "url": "https://pubmed.ncbi.nlm.nih.gov/25313141" }, { "database": "PubMed", "id": "25329617", "url": "https://pubmed.ncbi.nlm.nih.gov/25329617" }, { "database": "PubMed", "id": "25339152", "url": "https://pubmed.ncbi.nlm.nih.gov/25339152" }, { "database": "PubMed", "id": "25344208", "url": "https://pubmed.ncbi.nlm.nih.gov/25344208" }, { "database": "PubMed", "id": "25352995", "url": "https://pubmed.ncbi.nlm.nih.gov/25352995" }, { "database": "PubMed", "id": "25360740", "url": "https://pubmed.ncbi.nlm.nih.gov/25360740" }, { "database": "PubMed", "id": "25365190", "url": "https://pubmed.ncbi.nlm.nih.gov/25365190" }, { "database": "PubMed", "id": "25365322", "url": "https://pubmed.ncbi.nlm.nih.gov/25365322" }, { "database": "PubMed", "id": "25370471", "url": "https://pubmed.ncbi.nlm.nih.gov/25370471" }, { "database": "PubMed", "id": "25373319", "url": "https://pubmed.ncbi.nlm.nih.gov/25373319" }, { "database": "PubMed", "id": "25375133", "url": "https://pubmed.ncbi.nlm.nih.gov/25375133" }, { "database": "PubMed", "id": "25376904", "url": "https://pubmed.ncbi.nlm.nih.gov/25376904" }, { "database": "PubMed", "id": "25385184", "url": "https://pubmed.ncbi.nlm.nih.gov/25385184" }, { "database": "PubMed", "id": "25388642", "url": "https://pubmed.ncbi.nlm.nih.gov/25388642" }, { "database": "PubMed", "id": "25392303", "url": "https://pubmed.ncbi.nlm.nih.gov/25392303" }, { "database": "PubMed", "id": "25398131", "url": "https://pubmed.ncbi.nlm.nih.gov/25398131" }, { "database": "PubMed", "id": "25400915", "url": "https://pubmed.ncbi.nlm.nih.gov/25400915" }, { "database": "PubMed", "id": "25409876", "url": "https://pubmed.ncbi.nlm.nih.gov/25409876" }, { "database": "PubMed", "id": "25412313", "url": "https://pubmed.ncbi.nlm.nih.gov/25412313" }, { "database": "PubMed", "id": "25424429", "url": "https://pubmed.ncbi.nlm.nih.gov/25424429" }, { "database": "PubMed", "id": "25432075", "url": "https://pubmed.ncbi.nlm.nih.gov/25432075" }, { "database": "PubMed", "id": "25454348", "url": "https://pubmed.ncbi.nlm.nih.gov/25454348" }, { "database": "PubMed", "id": "25456951", "url": "https://pubmed.ncbi.nlm.nih.gov/25456951" }, { "database": "PubMed", "id": "25466244", "url": "https://pubmed.ncbi.nlm.nih.gov/25466244" }, { "database": "PubMed", "id": "25483727", "url": "https://pubmed.ncbi.nlm.nih.gov/25483727" }, { "database": "PubMed", "id": "25486524", "url": "https://pubmed.ncbi.nlm.nih.gov/25486524" }, { "database": "PubMed", "id": "25490861", "url": "https://pubmed.ncbi.nlm.nih.gov/25490861" }, { "database": "PubMed", "id": "25494980", "url": "https://pubmed.ncbi.nlm.nih.gov/25494980" }, { "database": "PubMed", "id": "25495560", "url": "https://pubmed.ncbi.nlm.nih.gov/25495560" }, { "database": "PubMed", "id": "25499217", "url": "https://pubmed.ncbi.nlm.nih.gov/25499217" }, { "database": "PubMed", "id": "25502934", "url": "https://pubmed.ncbi.nlm.nih.gov/25502934" }, { "database": "PubMed", "id": "25504433", "url": "https://pubmed.ncbi.nlm.nih.gov/25504433" }, { "database": "PubMed", "id": "25521510", "url": "https://pubmed.ncbi.nlm.nih.gov/25521510" }, { "database": "PubMed", "id": "25527452", "url": "https://pubmed.ncbi.nlm.nih.gov/25527452" }, { "database": "PubMed", "id": "25528216", "url": "https://pubmed.ncbi.nlm.nih.gov/25528216" }, { "database": "PubMed", "id": "25530715", "url": "https://pubmed.ncbi.nlm.nih.gov/25530715" }, { "database": "PubMed", "id": "25531880", "url": "https://pubmed.ncbi.nlm.nih.gov/25531880" }, { "database": "PubMed", "id": "25538040", "url": "https://pubmed.ncbi.nlm.nih.gov/25538040" }, { "database": "PubMed", "id": "25543088", "url": "https://pubmed.ncbi.nlm.nih.gov/25543088" }, { "database": "PubMed", "id": "25544763", "url": "https://pubmed.ncbi.nlm.nih.gov/25544763" }, { "database": "PubMed", "id": "25551293", "url": "https://pubmed.ncbi.nlm.nih.gov/25551293" }, { "database": "PubMed", "id": "25559258", "url": "https://pubmed.ncbi.nlm.nih.gov/25559258" }, { "database": "PubMed", "id": "25564612", "url": "https://pubmed.ncbi.nlm.nih.gov/25564612" }, { "database": "PubMed", "id": "25569743", "url": "https://pubmed.ncbi.nlm.nih.gov/25569743" }, { "database": "PubMed", "id": "25575302", "url": "https://pubmed.ncbi.nlm.nih.gov/25575302" }, { "database": "PubMed", "id": "25575882", "url": "https://pubmed.ncbi.nlm.nih.gov/25575882" }, { "database": "PubMed", "id": "25590801", "url": "https://pubmed.ncbi.nlm.nih.gov/25590801" }, { "database": "PubMed", "id": "25596738", "url": "https://pubmed.ncbi.nlm.nih.gov/25596738" }, { "database": "PubMed", "id": "25596739", "url": "https://pubmed.ncbi.nlm.nih.gov/25596739" }, { "database": "PubMed", "id": "25596747", "url": "https://pubmed.ncbi.nlm.nih.gov/25596747" }, { "database": "PubMed", "id": "25603236", "url": "https://pubmed.ncbi.nlm.nih.gov/25603236" }, { "database": "PubMed", "id": "25603341", "url": "https://pubmed.ncbi.nlm.nih.gov/25603341" }, { "database": "PubMed", "id": "25622969", "url": "https://pubmed.ncbi.nlm.nih.gov/25622969" }, { "database": "PubMed", "id": "25623055", "url": "https://pubmed.ncbi.nlm.nih.gov/25623055" }, { "database": "PubMed", "id": "25624750", "url": "https://pubmed.ncbi.nlm.nih.gov/25624750" }, { "database": "PubMed", "id": "25639875", "url": "https://pubmed.ncbi.nlm.nih.gov/25639875" }, { "database": "PubMed", "id": "25640278", "url": "https://pubmed.ncbi.nlm.nih.gov/25640278" }, { "database": "PubMed", "id": "25649767", "url": "https://pubmed.ncbi.nlm.nih.gov/25649767" }, { "database": "PubMed", "id": "25654224", "url": "https://pubmed.ncbi.nlm.nih.gov/25654224" }, { "database": "PubMed", "id": "25658447", "url": "https://pubmed.ncbi.nlm.nih.gov/25658447" }, { "database": "PubMed", "id": "25663935", "url": "https://pubmed.ncbi.nlm.nih.gov/25663935" }, { "database": "PubMed", "id": "25673820", "url": "https://pubmed.ncbi.nlm.nih.gov/25673820" }, { "database": "PubMed", "id": "25674039", "url": "https://pubmed.ncbi.nlm.nih.gov/25674039" }, { "database": "PubMed", "id": "25678401", "url": "https://pubmed.ncbi.nlm.nih.gov/25678401" }, { "database": "PubMed", "id": "25686830", "url": "https://pubmed.ncbi.nlm.nih.gov/25686830" }, { "database": "PubMed", "id": "25687330", "url": "https://pubmed.ncbi.nlm.nih.gov/25687330" }, { "database": "PubMed", "id": "25687876", "url": "https://pubmed.ncbi.nlm.nih.gov/25687876" }, { "database": "PubMed", "id": "25691053", "url": "https://pubmed.ncbi.nlm.nih.gov/25691053" }, { "database": "PubMed", "id": "25701004", "url": "https://pubmed.ncbi.nlm.nih.gov/25701004" }, { "database": "PubMed", "id": "25706943", "url": "https://pubmed.ncbi.nlm.nih.gov/25706943" }, { "database": "PubMed", "id": "25714596", "url": "https://pubmed.ncbi.nlm.nih.gov/25714596" }, { "database": "PubMed", "id": "25717186", "url": "https://pubmed.ncbi.nlm.nih.gov/25717186" }, { "database": "PubMed", "id": "25719244", "url": "https://pubmed.ncbi.nlm.nih.gov/25719244" }, { "database": "PubMed", "id": "25722288", "url": "https://pubmed.ncbi.nlm.nih.gov/25722288" }, { "database": "PubMed", "id": "25738366", "url": "https://pubmed.ncbi.nlm.nih.gov/25738366" }, { "database": "PubMed", "id": "25744065", "url": "https://pubmed.ncbi.nlm.nih.gov/25744065" }, { "database": "PubMed", "id": "25749514", "url": "https://pubmed.ncbi.nlm.nih.gov/25749514" }, { "database": "PubMed", "id": "25749517", "url": "https://pubmed.ncbi.nlm.nih.gov/25749517" }, { "database": "PubMed", "id": "25758096", "url": "https://pubmed.ncbi.nlm.nih.gov/25758096" }, { "database": "PubMed", "id": "25760103", "url": "https://pubmed.ncbi.nlm.nih.gov/25760103" }, { "database": "PubMed", "id": "25761241", "url": "https://pubmed.ncbi.nlm.nih.gov/25761241" }, { "database": "PubMed", "id": "25762619", "url": "https://pubmed.ncbi.nlm.nih.gov/25762619" }, { "database": "PubMed", "id": "25766325", "url": "https://pubmed.ncbi.nlm.nih.gov/25766325" }, { "database": "PubMed", "id": "25767601", "url": "https://pubmed.ncbi.nlm.nih.gov/25767601" }, { "database": "PubMed", "id": "25784113", "url": "https://pubmed.ncbi.nlm.nih.gov/25784113" }, { "database": "PubMed", "id": "25792811", "url": "https://pubmed.ncbi.nlm.nih.gov/25792811" }, { "database": "PubMed", "id": "25793261", "url": "https://pubmed.ncbi.nlm.nih.gov/25793261" }, { "database": "PubMed", "id": "25793983", "url": "https://pubmed.ncbi.nlm.nih.gov/25793983" }, { "database": "PubMed", "id": "25797048", "url": "https://pubmed.ncbi.nlm.nih.gov/25797048" }, { "database": "PubMed", "id": "25797258", "url": "https://pubmed.ncbi.nlm.nih.gov/25797258" }, { "database": "PubMed", "id": "25805567", "url": "https://pubmed.ncbi.nlm.nih.gov/25805567" }, { "database": "PubMed", "id": "25807261", "url": "https://pubmed.ncbi.nlm.nih.gov/25807261" }, { "database": "PubMed", "id": "25812014", "url": "https://pubmed.ncbi.nlm.nih.gov/25812014" }, { "database": "PubMed", "id": "25815363", "url": "https://pubmed.ncbi.nlm.nih.gov/25815363" }, { "database": "PubMed", "id": "25823655", "url": "https://pubmed.ncbi.nlm.nih.gov/25823655" }, { "database": "PubMed", "id": "25838434", "url": "https://pubmed.ncbi.nlm.nih.gov/25838434" }, { "database": "PubMed", "id": "25841779", "url": "https://pubmed.ncbi.nlm.nih.gov/25841779" }, { "database": "PubMed", "id": "25849580", "url": "https://pubmed.ncbi.nlm.nih.gov/25849580" }, { "database": "PubMed", "id": "25851605", "url": "https://pubmed.ncbi.nlm.nih.gov/25851605" }, { "database": "PubMed", "id": "25869208", "url": "https://pubmed.ncbi.nlm.nih.gov/25869208" }, { "database": "PubMed", "id": "25876175", "url": "https://pubmed.ncbi.nlm.nih.gov/25876175" }, { "database": "PubMed", "id": "25888955", "url": "https://pubmed.ncbi.nlm.nih.gov/25888955" }, { "database": "PubMed", "id": "25889839", "url": "https://pubmed.ncbi.nlm.nih.gov/25889839" }, { "database": "PubMed", "id": "25894595", "url": "https://pubmed.ncbi.nlm.nih.gov/25894595" }, { "database": "PubMed", "id": "25898313", "url": "https://pubmed.ncbi.nlm.nih.gov/25898313" }, { "database": "PubMed", "id": "25902785", "url": "https://pubmed.ncbi.nlm.nih.gov/25902785" }, { "database": "PubMed", "id": "25910265", "url": "https://pubmed.ncbi.nlm.nih.gov/25910265" }, { "database": "PubMed", "id": "25912234", "url": "https://pubmed.ncbi.nlm.nih.gov/25912234" }, { "database": "PubMed", "id": "25915159", "url": "https://pubmed.ncbi.nlm.nih.gov/25915159" }, { "database": "PubMed", "id": "25915946", "url": "https://pubmed.ncbi.nlm.nih.gov/25915946" }, { "database": "PubMed", "id": "25925728", "url": "https://pubmed.ncbi.nlm.nih.gov/25925728" }, { "database": "PubMed", "id": "25926716", "url": "https://pubmed.ncbi.nlm.nih.gov/25926716" }, { "database": "PubMed", "id": "25933112", "url": "https://pubmed.ncbi.nlm.nih.gov/25933112" }, { "database": "PubMed", "id": "25935150", "url": "https://pubmed.ncbi.nlm.nih.gov/25935150" }, { "database": "PubMed", "id": "25940338", "url": "https://pubmed.ncbi.nlm.nih.gov/25940338" }, { "database": "PubMed", "id": "25943101", "url": "https://pubmed.ncbi.nlm.nih.gov/25943101" }, { "database": "PubMed", "id": "25961827", "url": "https://pubmed.ncbi.nlm.nih.gov/25961827" }, { "database": "PubMed", "id": "25962159", "url": "https://pubmed.ncbi.nlm.nih.gov/25962159" }, { "database": "PubMed", "id": "25963408", "url": "https://pubmed.ncbi.nlm.nih.gov/25963408" }, { "database": "PubMed", "id": "25965345", "url": "https://pubmed.ncbi.nlm.nih.gov/25965345" }, { "database": "PubMed", "id": "25965823", "url": "https://pubmed.ncbi.nlm.nih.gov/25965823" }, { "database": "PubMed", "id": "25965829", "url": "https://pubmed.ncbi.nlm.nih.gov/25965829" }, { "database": "PubMed", "id": "25966642", "url": "https://pubmed.ncbi.nlm.nih.gov/25966642" }, { "database": "PubMed", "id": "25969668", "url": "https://pubmed.ncbi.nlm.nih.gov/25969668" }, { "database": "PubMed", "id": "25970784", "url": "https://pubmed.ncbi.nlm.nih.gov/25970784" }, { "database": "PubMed", "id": "25974307", "url": "https://pubmed.ncbi.nlm.nih.gov/25974307" }, { "database": "PubMed", "id": "25978653", "url": "https://pubmed.ncbi.nlm.nih.gov/25978653" }, { "database": "PubMed", "id": "25980493", "url": "https://pubmed.ncbi.nlm.nih.gov/25980493" }, { "database": "PubMed", "id": "25997619", "url": "https://pubmed.ncbi.nlm.nih.gov/25997619" }, { "database": "PubMed", "id": "25997832", "url": "https://pubmed.ncbi.nlm.nih.gov/25997832" }, { "database": "PubMed", "id": "25999352", "url": "https://pubmed.ncbi.nlm.nih.gov/25999352" }, { "database": "PubMed", "id": "26014912", "url": "https://pubmed.ncbi.nlm.nih.gov/26014912" }, { "database": "PubMed", "id": "26023079", "url": "https://pubmed.ncbi.nlm.nih.gov/26023079" }, { "database": "PubMed", "id": "26023089", "url": "https://pubmed.ncbi.nlm.nih.gov/26023089" }, { "database": "PubMed", "id": "26025205", "url": "https://pubmed.ncbi.nlm.nih.gov/26025205" }, { "database": "PubMed", "id": "26033966", "url": "https://pubmed.ncbi.nlm.nih.gov/26033966" }, { "database": "PubMed", "id": "26039541", "url": "https://pubmed.ncbi.nlm.nih.gov/26039541" }, { "database": "PubMed", "id": "26043921", "url": "https://pubmed.ncbi.nlm.nih.gov/26043921" }, { "database": "PubMed", "id": "26046303", "url": "https://pubmed.ncbi.nlm.nih.gov/26046303" }, { "database": "PubMed", "id": "26053093", "url": "https://pubmed.ncbi.nlm.nih.gov/26053093" }, { "database": "PubMed", "id": "26053620", "url": "https://pubmed.ncbi.nlm.nih.gov/26053620" }, { "database": "PubMed", "id": "26061531", "url": "https://pubmed.ncbi.nlm.nih.gov/26061531" }, { "database": "PubMed", "id": "26065894", "url": "https://pubmed.ncbi.nlm.nih.gov/26065894" }, { "database": "PubMed", "id": "26068789", "url": "https://pubmed.ncbi.nlm.nih.gov/26068789" }, { "database": "PubMed", "id": "26071201", "url": "https://pubmed.ncbi.nlm.nih.gov/26071201" }, { "database": "PubMed", "id": "26073086", "url": "https://pubmed.ncbi.nlm.nih.gov/26073086" }, { "database": "PubMed", "id": "26076587", "url": "https://pubmed.ncbi.nlm.nih.gov/26076587" }, { "database": "PubMed", "id": "26078792", "url": "https://pubmed.ncbi.nlm.nih.gov/26078792" }, { "database": "PubMed", "id": "26093985", "url": "https://pubmed.ncbi.nlm.nih.gov/26093985" }, { "database": "PubMed", "id": "26104298", "url": "https://pubmed.ncbi.nlm.nih.gov/26104298" }, { "database": "PubMed", "id": "26104664", "url": "https://pubmed.ncbi.nlm.nih.gov/26104664" }, { "database": "PubMed", "id": "26110874", "url": "https://pubmed.ncbi.nlm.nih.gov/26110874" }, { "database": "PubMed", "id": "26111001", "url": "https://pubmed.ncbi.nlm.nih.gov/26111001" }, { "database": "PubMed", "id": "26111057", "url": "https://pubmed.ncbi.nlm.nih.gov/26111057" }, { "database": "PubMed", "id": "26115086", "url": "https://pubmed.ncbi.nlm.nih.gov/26115086" }, { "database": "PubMed", "id": "26121251", "url": "https://pubmed.ncbi.nlm.nih.gov/26121251" }, { "database": "PubMed", "id": "26121643", "url": "https://pubmed.ncbi.nlm.nih.gov/26121643" }, { "database": "PubMed", "id": "26124328", "url": "https://pubmed.ncbi.nlm.nih.gov/26124328" }, { "database": "PubMed", "id": "26125228", "url": "https://pubmed.ncbi.nlm.nih.gov/26125228" }, { "database": "PubMed", "id": "26126266", "url": "https://pubmed.ncbi.nlm.nih.gov/26126266" }, { "database": "PubMed", "id": "26130968", "url": "https://pubmed.ncbi.nlm.nih.gov/26130968" }, { "database": "PubMed", "id": "26134617", "url": "https://pubmed.ncbi.nlm.nih.gov/26134617" }, { "database": "PubMed", "id": "26137449", "url": "https://pubmed.ncbi.nlm.nih.gov/26137449" }, { "database": "PubMed", "id": "26137586", "url": "https://pubmed.ncbi.nlm.nih.gov/26137586" }, { "database": "PubMed", "id": "26146988", "url": "https://pubmed.ncbi.nlm.nih.gov/26146988" }, { "database": "PubMed", "id": "26151347", "url": "https://pubmed.ncbi.nlm.nih.gov/26151347" }, { "database": "PubMed", "id": "26174628", "url": "https://pubmed.ncbi.nlm.nih.gov/26174628" }, { "database": "PubMed", "id": "26178819", "url": "https://pubmed.ncbi.nlm.nih.gov/26178819" }, { "database": "PubMed", "id": "26193288", "url": "https://pubmed.ncbi.nlm.nih.gov/26193288" }, { "database": "PubMed", "id": "26198194", "url": "https://pubmed.ncbi.nlm.nih.gov/26198194" }, { "database": "PubMed", "id": "26199094", "url": "https://pubmed.ncbi.nlm.nih.gov/26199094" }, { "database": "PubMed", "id": "26204252", "url": "https://pubmed.ncbi.nlm.nih.gov/26204252" }, { "database": "PubMed", "id": "26208478", "url": "https://pubmed.ncbi.nlm.nih.gov/26208478" }, { "database": "PubMed", "id": "26212441", "url": "https://pubmed.ncbi.nlm.nih.gov/26212441" }, { "database": "PubMed", "id": "26217307", "url": "https://pubmed.ncbi.nlm.nih.gov/26217307" }, { "database": "PubMed", "id": "26222278", "url": "https://pubmed.ncbi.nlm.nih.gov/26222278" }, { "database": "PubMed", "id": "26235620", "url": "https://pubmed.ncbi.nlm.nih.gov/26235620" }, { "database": "PubMed", "id": "26242183", "url": "https://pubmed.ncbi.nlm.nih.gov/26242183" }, { "database": "PubMed", "id": "26243309", "url": "https://pubmed.ncbi.nlm.nih.gov/26243309" }, { "database": "PubMed", "id": "26244501", "url": "https://pubmed.ncbi.nlm.nih.gov/26244501" }, { "database": "PubMed", "id": "26245346", "url": "https://pubmed.ncbi.nlm.nih.gov/26245346" }, { "database": "PubMed", "id": "26246284", "url": "https://pubmed.ncbi.nlm.nih.gov/26246284" }, { "database": "PubMed", "id": "26246598", "url": "https://pubmed.ncbi.nlm.nih.gov/26246598" }, { "database": "PubMed", "id": "26247730", "url": "https://pubmed.ncbi.nlm.nih.gov/26247730" }, { "database": "PubMed", "id": "26248315", "url": "https://pubmed.ncbi.nlm.nih.gov/26248315" }, { "database": "PubMed", "id": "26252009", "url": "https://pubmed.ncbi.nlm.nih.gov/26252009" }, { "database": "PubMed", "id": "26260992", "url": "https://pubmed.ncbi.nlm.nih.gov/26260992" }, { "database": "PubMed", "id": "26263002", "url": "https://pubmed.ncbi.nlm.nih.gov/26263002" }, { "database": "PubMed", "id": "26269411", "url": "https://pubmed.ncbi.nlm.nih.gov/26269411" }, { "database": "PubMed", "id": "26290457", "url": "https://pubmed.ncbi.nlm.nih.gov/26290457" }, { "database": "PubMed", "id": "26295469", "url": "https://pubmed.ncbi.nlm.nih.gov/26295469" }, { "database": "PubMed", "id": "26295809", "url": "https://pubmed.ncbi.nlm.nih.gov/26295809" }, { "database": "PubMed", "id": "26297026", "url": "https://pubmed.ncbi.nlm.nih.gov/26297026" }, { "database": "PubMed", "id": "26297582", "url": "https://pubmed.ncbi.nlm.nih.gov/26297582" }, { "database": "PubMed", "id": "26300786", "url": "https://pubmed.ncbi.nlm.nih.gov/26300786" }, { "database": "PubMed", "id": "26304753", "url": "https://pubmed.ncbi.nlm.nih.gov/26304753" }, { "database": "PubMed", "id": "26311050", "url": "https://pubmed.ncbi.nlm.nih.gov/26311050" }, { "database": "PubMed", "id": "26313911", "url": "https://pubmed.ncbi.nlm.nih.gov/26313911" }, { "database": "PubMed", "id": "26317515", "url": "https://pubmed.ncbi.nlm.nih.gov/26317515" }, { "database": "PubMed", "id": "26323834", "url": "https://pubmed.ncbi.nlm.nih.gov/26323834" }, { "database": "PubMed", "id": "26325371", "url": "https://pubmed.ncbi.nlm.nih.gov/26325371" }, { "database": "PubMed", "id": "26333304", "url": "https://pubmed.ncbi.nlm.nih.gov/26333304" }, { "database": "PubMed", "id": "26345302", "url": "https://pubmed.ncbi.nlm.nih.gov/26345302" }, { "database": "PubMed", "id": "26345416", "url": "https://pubmed.ncbi.nlm.nih.gov/26345416" }, { "database": "PubMed", "id": "26345496", "url": "https://pubmed.ncbi.nlm.nih.gov/26345496" }, { "database": "PubMed", "id": "26354606", "url": "https://pubmed.ncbi.nlm.nih.gov/26354606" }, { "database": "PubMed", "id": "26356562", "url": "https://pubmed.ncbi.nlm.nih.gov/26356562" }, { "database": "PubMed", "id": "26359868", "url": "https://pubmed.ncbi.nlm.nih.gov/26359868" }, { "database": "PubMed", "id": "26377961", "url": "https://pubmed.ncbi.nlm.nih.gov/26377961" }, { "database": "PubMed", "id": "26378810", "url": "https://pubmed.ncbi.nlm.nih.gov/26378810" }, { "database": "PubMed", "id": "26379195", "url": "https://pubmed.ncbi.nlm.nih.gov/26379195" }, { "database": "PubMed", "id": "26388843", "url": "https://pubmed.ncbi.nlm.nih.gov/26388843" }, { "database": "PubMed", "id": "26402468", "url": "https://pubmed.ncbi.nlm.nih.gov/26402468" }, { "database": "PubMed", "id": "26402673", "url": "https://pubmed.ncbi.nlm.nih.gov/26402673" }, { "database": "PubMed", "id": "26408176", "url": "https://pubmed.ncbi.nlm.nih.gov/26408176" }, { "database": "PubMed", "id": "26415504", "url": "https://pubmed.ncbi.nlm.nih.gov/26415504" }, { "database": "PubMed", "id": "26418879", "url": "https://pubmed.ncbi.nlm.nih.gov/26418879" }, { "database": "PubMed", "id": "26436418", "url": "https://pubmed.ncbi.nlm.nih.gov/26436418" }, { "database": "PubMed", "id": "26437242", "url": "https://pubmed.ncbi.nlm.nih.gov/26437242" }, { "database": "PubMed", "id": "26440416", "url": "https://pubmed.ncbi.nlm.nih.gov/26440416" }, { "database": "PubMed", "id": "26446840", "url": "https://pubmed.ncbi.nlm.nih.gov/26446840" }, { "database": "PubMed", "id": "26452025", "url": "https://pubmed.ncbi.nlm.nih.gov/26452025" }, { "database": "PubMed", "id": "26465605", "url": "https://pubmed.ncbi.nlm.nih.gov/26465605" }, { "database": "PubMed", "id": "26475209", "url": "https://pubmed.ncbi.nlm.nih.gov/26475209" }, { "database": "PubMed", "id": "26483070", "url": "https://pubmed.ncbi.nlm.nih.gov/26483070" }, { "database": "PubMed", "id": "26485768", "url": "https://pubmed.ncbi.nlm.nih.gov/26485768" }, { "database": "PubMed", "id": "26489763", "url": "https://pubmed.ncbi.nlm.nih.gov/26489763" }, { "database": "PubMed", "id": "26496029", "url": "https://pubmed.ncbi.nlm.nih.gov/26496029" }, { "database": "PubMed", "id": "26496360", "url": "https://pubmed.ncbi.nlm.nih.gov/26496360" }, { "database": "PubMed", "id": "26497580", "url": "https://pubmed.ncbi.nlm.nih.gov/26497580" }, { "database": "PubMed", "id": "26497682", "url": "https://pubmed.ncbi.nlm.nih.gov/26497682" }, { "database": "PubMed", "id": "26500282", "url": "https://pubmed.ncbi.nlm.nih.gov/26500282" }, { "database": "PubMed", "id": "26503469", "url": "https://pubmed.ncbi.nlm.nih.gov/26503469" }, { "database": "PubMed", "id": "26506516", "url": "https://pubmed.ncbi.nlm.nih.gov/26506516" }, { "database": "PubMed", "id": "26515499", "url": "https://pubmed.ncbi.nlm.nih.gov/26515499" }, { "database": "PubMed", "id": "26517508", "url": "https://pubmed.ncbi.nlm.nih.gov/26517508" }, { "database": "PubMed", "id": "26528819", "url": "https://pubmed.ncbi.nlm.nih.gov/26528819" }, { "database": "PubMed", "id": "26535060", "url": "https://pubmed.ncbi.nlm.nih.gov/26535060" }, { "database": "PubMed", "id": "26547929", "url": "https://pubmed.ncbi.nlm.nih.gov/26547929" }, { "database": "PubMed", "id": "26551880", "url": "https://pubmed.ncbi.nlm.nih.gov/26551880" }, { "database": "PubMed", "id": "26557719", "url": "https://pubmed.ncbi.nlm.nih.gov/26557719" }, { "database": "PubMed", "id": "26563429", "url": "https://pubmed.ncbi.nlm.nih.gov/26563429" }, { "database": "PubMed", "id": "26565813", "url": "https://pubmed.ncbi.nlm.nih.gov/26565813" }, { "database": "PubMed", "id": "26573229", "url": "https://pubmed.ncbi.nlm.nih.gov/26573229" }, { "database": "PubMed", "id": "26580610", "url": "https://pubmed.ncbi.nlm.nih.gov/26580610" }, { "database": "PubMed", "id": "26582390", "url": "https://pubmed.ncbi.nlm.nih.gov/26582390" }, { "database": "PubMed", "id": "26600389", "url": "https://pubmed.ncbi.nlm.nih.gov/26600389" }, { "database": "PubMed", "id": "26613407", "url": "https://pubmed.ncbi.nlm.nih.gov/26613407" }, { "database": "PubMed", "id": "26619345", "url": "https://pubmed.ncbi.nlm.nih.gov/26619345" }, { "database": "PubMed", "id": "26622940", "url": "https://pubmed.ncbi.nlm.nih.gov/26622940" }, { "database": "PubMed", "id": "26635480", "url": "https://pubmed.ncbi.nlm.nih.gov/26635480" }, { "database": "PubMed", "id": "26646023", "url": "https://pubmed.ncbi.nlm.nih.gov/26646023" }, { "database": "PubMed", "id": "26657290", "url": "https://pubmed.ncbi.nlm.nih.gov/26657290" }, { "database": "PubMed", "id": "26657292", "url": "https://pubmed.ncbi.nlm.nih.gov/26657292" }, { "database": "PubMed", "id": "26657992", "url": "https://pubmed.ncbi.nlm.nih.gov/26657992" }, { "database": "PubMed", "id": "26674329", "url": "https://pubmed.ncbi.nlm.nih.gov/26674329" }, { "database": "PubMed", "id": "26682007", "url": "https://pubmed.ncbi.nlm.nih.gov/26682007" }, { "database": "PubMed", "id": "26686089", "url": "https://pubmed.ncbi.nlm.nih.gov/26686089" }, { "database": "PubMed", "id": "26700664", "url": "https://pubmed.ncbi.nlm.nih.gov/26700664" }, { "database": "PubMed", "id": "26708293", "url": "https://pubmed.ncbi.nlm.nih.gov/26708293" }, { "database": "PubMed", "id": "26713606", "url": "https://pubmed.ncbi.nlm.nih.gov/26713606" }, { "database": "PubMed", "id": "26714756", "url": "https://pubmed.ncbi.nlm.nih.gov/26714756" }, { "database": "PubMed", "id": "26716408", "url": "https://pubmed.ncbi.nlm.nih.gov/26716408" }, { "database": "PubMed", "id": "26716652", "url": "https://pubmed.ncbi.nlm.nih.gov/26716652" }, { "database": "PubMed", "id": "26741489", "url": "https://pubmed.ncbi.nlm.nih.gov/26741489" }, { "database": "PubMed", "id": "26746999", "url": "https://pubmed.ncbi.nlm.nih.gov/26746999" }, { "database": "PubMed", "id": "26751215", "url": "https://pubmed.ncbi.nlm.nih.gov/26751215" }, { "database": "PubMed", "id": "26756219", "url": "https://pubmed.ncbi.nlm.nih.gov/26756219" }, { "database": "PubMed", "id": "26761017", "url": "https://pubmed.ncbi.nlm.nih.gov/26761017" }, { "database": "PubMed", "id": "26762111", "url": "https://pubmed.ncbi.nlm.nih.gov/26762111" }, { "database": "PubMed", "id": "26784926", "url": "https://pubmed.ncbi.nlm.nih.gov/26784926" }, { "database": "PubMed", "id": "26801096", "url": "https://pubmed.ncbi.nlm.nih.gov/26801096" }, { "database": "PubMed", "id": "26821070", "url": "https://pubmed.ncbi.nlm.nih.gov/26821070" }, { "database": "PubMed", "id": "26821351", "url": "https://pubmed.ncbi.nlm.nih.gov/26821351" }, { "database": "PubMed", "id": "26825989", "url": "https://pubmed.ncbi.nlm.nih.gov/26825989" }, { "database": "PubMed", "id": "26832662", "url": "https://pubmed.ncbi.nlm.nih.gov/26832662" }, { "database": "PubMed", "id": "26839558", "url": "https://pubmed.ncbi.nlm.nih.gov/26839558" }, { "database": "PubMed", "id": "26840085", "url": "https://pubmed.ncbi.nlm.nih.gov/26840085" }, { "database": "PubMed", "id": "26840401", "url": "https://pubmed.ncbi.nlm.nih.gov/26840401" }, { "database": "PubMed", "id": "26848618", "url": "https://pubmed.ncbi.nlm.nih.gov/26848618" }, { "database": "PubMed", "id": "26857837", "url": "https://pubmed.ncbi.nlm.nih.gov/26857837" }, { "database": "PubMed", "id": "26859575", "url": "https://pubmed.ncbi.nlm.nih.gov/26859575" }, { "database": "PubMed", "id": "26868304", "url": "https://pubmed.ncbi.nlm.nih.gov/26868304" }, { "database": "PubMed", "id": "26876672", "url": "https://pubmed.ncbi.nlm.nih.gov/26876672" }, { "database": "PubMed", "id": "26877709", "url": "https://pubmed.ncbi.nlm.nih.gov/26877709" }, { "database": "PubMed", "id": "26879559", "url": "https://pubmed.ncbi.nlm.nih.gov/26879559" }, { "database": "PubMed", "id": "26879868", "url": "https://pubmed.ncbi.nlm.nih.gov/26879868" }, { "database": "PubMed", "id": "26883103", "url": "https://pubmed.ncbi.nlm.nih.gov/26883103" }, { "database": "PubMed", "id": "26891914", "url": "https://pubmed.ncbi.nlm.nih.gov/26891914" }, { "database": "PubMed", "id": "26901182", "url": "https://pubmed.ncbi.nlm.nih.gov/26901182" }, { "database": "PubMed", "id": "26903300", "url": "https://pubmed.ncbi.nlm.nih.gov/26903300" }, { "database": "PubMed", "id": "26909320", "url": "https://pubmed.ncbi.nlm.nih.gov/26909320" }, { "database": "PubMed", "id": "26912358", "url": "https://pubmed.ncbi.nlm.nih.gov/26912358" }, { "database": "PubMed", "id": "26913805", "url": "https://pubmed.ncbi.nlm.nih.gov/26913805" }, { "database": "PubMed", "id": "26919095", "url": "https://pubmed.ncbi.nlm.nih.gov/26919095" }, { "database": "PubMed", "id": "26919097", "url": "https://pubmed.ncbi.nlm.nih.gov/26919097" }, { "database": "PubMed", "id": "26919102", "url": "https://pubmed.ncbi.nlm.nih.gov/26919102" }, { "database": "PubMed", "id": "26919105", "url": "https://pubmed.ncbi.nlm.nih.gov/26919105" }, { "database": "PubMed", "id": "26931119", "url": "https://pubmed.ncbi.nlm.nih.gov/26931119" }, { "database": "PubMed", "id": "26937641", "url": "https://pubmed.ncbi.nlm.nih.gov/26937641" }, { "database": "PubMed", "id": "26940018", "url": "https://pubmed.ncbi.nlm.nih.gov/26940018" }, { "database": "PubMed", "id": "26942872", "url": "https://pubmed.ncbi.nlm.nih.gov/26942872" }, { "database": "PubMed", "id": "26945062", "url": "https://pubmed.ncbi.nlm.nih.gov/26945062" }, { "database": "PubMed", "id": "26958085", "url": "https://pubmed.ncbi.nlm.nih.gov/26958085" }, { "database": "PubMed", "id": "26959555", "url": "https://pubmed.ncbi.nlm.nih.gov/26959555" }, { "database": "PubMed", "id": "26959890", "url": "https://pubmed.ncbi.nlm.nih.gov/26959890" }, { "database": "PubMed", "id": "26974310", "url": "https://pubmed.ncbi.nlm.nih.gov/26974310" }, { "database": "PubMed", "id": "26974342", "url": "https://pubmed.ncbi.nlm.nih.gov/26974342" }, { "database": "PubMed", "id": "26988603", "url": "https://pubmed.ncbi.nlm.nih.gov/26988603" }, { "database": "PubMed", "id": "26988652", "url": "https://pubmed.ncbi.nlm.nih.gov/26988652" }, { "database": "PubMed", "id": "26992218", "url": "https://pubmed.ncbi.nlm.nih.gov/26992218" }, { "database": "PubMed", "id": "26992219", "url": "https://pubmed.ncbi.nlm.nih.gov/26992219" }, { "database": "PubMed", "id": "26993775", "url": "https://pubmed.ncbi.nlm.nih.gov/26993775" }, { "database": "PubMed", "id": "26994872", "url": "https://pubmed.ncbi.nlm.nih.gov/26994872" }, { "database": "PubMed", "id": "26998277", "url": "https://pubmed.ncbi.nlm.nih.gov/26998277" }, { "database": "PubMed", "id": "27000941", "url": "https://pubmed.ncbi.nlm.nih.gov/27000941" }, { "database": "PubMed", "id": "27002278", "url": "https://pubmed.ncbi.nlm.nih.gov/27002278" }, { "database": "PubMed", "id": "27004402", "url": "https://pubmed.ncbi.nlm.nih.gov/27004402" }, { "database": "PubMed", "id": "27004406", "url": "https://pubmed.ncbi.nlm.nih.gov/27004406" }, { "database": "PubMed", "id": "27004407", "url": "https://pubmed.ncbi.nlm.nih.gov/27004407" }, { "database": "PubMed", "id": "27009203", "url": "https://pubmed.ncbi.nlm.nih.gov/27009203" }, { "database": "PubMed", "id": "27012197", "url": "https://pubmed.ncbi.nlm.nih.gov/27012197" }, { "database": "PubMed", "id": "27014421", "url": "https://pubmed.ncbi.nlm.nih.gov/27014421" }, { "database": "PubMed", "id": "27015122", "url": "https://pubmed.ncbi.nlm.nih.gov/27015122" }, { "database": "PubMed", "id": "27015152", "url": "https://pubmed.ncbi.nlm.nih.gov/27015152" }, { "database": "PubMed", "id": "27020593", "url": "https://pubmed.ncbi.nlm.nih.gov/27020593" }, { "database": "PubMed", "id": "27026523", "url": "https://pubmed.ncbi.nlm.nih.gov/27026523" }, { "database": "PubMed", "id": "27027448", "url": "https://pubmed.ncbi.nlm.nih.gov/27027448" }, { "database": "PubMed", "id": "27031247", "url": "https://pubmed.ncbi.nlm.nih.gov/27031247" }, { "database": "PubMed", "id": "27047993", "url": "https://pubmed.ncbi.nlm.nih.gov/27047993" }, { "database": "PubMed", "id": "27048245", "url": "https://pubmed.ncbi.nlm.nih.gov/27048245" }, { "database": "PubMed", "id": "27053161", "url": "https://pubmed.ncbi.nlm.nih.gov/27053161" }, { "database": "PubMed", "id": "27054717", "url": "https://pubmed.ncbi.nlm.nih.gov/27054717" }, { "database": "PubMed", "id": "27074558", "url": "https://pubmed.ncbi.nlm.nih.gov/27074558" }, { "database": "PubMed", "id": "27076174", "url": "https://pubmed.ncbi.nlm.nih.gov/27076174" }, { "database": "PubMed", "id": "27078847", "url": "https://pubmed.ncbi.nlm.nih.gov/27078847" }, { "database": "PubMed", "id": "27084428", "url": "https://pubmed.ncbi.nlm.nih.gov/27084428" }, { "database": "PubMed", "id": "27091625", "url": "https://pubmed.ncbi.nlm.nih.gov/27091625" }, { "database": "PubMed", "id": "27099352", "url": "https://pubmed.ncbi.nlm.nih.gov/27099352" }, { "database": "PubMed", "id": "27102434", "url": "https://pubmed.ncbi.nlm.nih.gov/27102434" }, { "database": "PubMed", "id": "27119232", "url": "https://pubmed.ncbi.nlm.nih.gov/27119232" }, { "database": "PubMed", "id": "27121055", "url": "https://pubmed.ncbi.nlm.nih.gov/27121055" }, { "database": "PubMed", "id": "27121065", "url": "https://pubmed.ncbi.nlm.nih.gov/27121065" }, { "database": "PubMed", "id": "27137757", "url": "https://pubmed.ncbi.nlm.nih.gov/27137757" }, { "database": "PubMed", "id": "27138223", "url": "https://pubmed.ncbi.nlm.nih.gov/27138223" }, { "database": "PubMed", "id": "27152946", "url": "https://pubmed.ncbi.nlm.nih.gov/27152946" }, { "database": "PubMed", "id": "27163678", "url": "https://pubmed.ncbi.nlm.nih.gov/27163678" }, { "database": "PubMed", "id": "27176505", "url": "https://pubmed.ncbi.nlm.nih.gov/27176505" }, { "database": "PubMed", "id": "27180807", "url": "https://pubmed.ncbi.nlm.nih.gov/27180807" }, { "database": "PubMed", "id": "27187380", "url": "https://pubmed.ncbi.nlm.nih.gov/27187380" }, { "database": "PubMed", "id": "27191994", "url": "https://pubmed.ncbi.nlm.nih.gov/27191994" }, { "database": "PubMed", "id": "27192118", "url": "https://pubmed.ncbi.nlm.nih.gov/27192118" }, { "database": "PubMed", "id": "27200496", "url": "https://pubmed.ncbi.nlm.nih.gov/27200496" }, { "database": "PubMed", "id": "27211495", "url": "https://pubmed.ncbi.nlm.nih.gov/27211495" }, { "database": "PubMed", "id": "27220846", "url": "https://pubmed.ncbi.nlm.nih.gov/27220846" }, { "database": "PubMed", "id": "27223432", "url": "https://pubmed.ncbi.nlm.nih.gov/27223432" }, { "database": "PubMed", "id": "27239959", "url": "https://pubmed.ncbi.nlm.nih.gov/27239959" }, { "database": "PubMed", "id": "27262235", "url": "https://pubmed.ncbi.nlm.nih.gov/27262235" }, { "database": "PubMed", "id": "27274989", "url": "https://pubmed.ncbi.nlm.nih.gov/27274989" }, { "database": "PubMed", "id": "27283899", "url": "https://pubmed.ncbi.nlm.nih.gov/27283899" }, { "database": "PubMed", "id": "27285760", "url": "https://pubmed.ncbi.nlm.nih.gov/27285760" }, { "database": "PubMed", "id": "27285995", "url": "https://pubmed.ncbi.nlm.nih.gov/27285995" }, { "database": "PubMed", "id": "27290989", "url": "https://pubmed.ncbi.nlm.nih.gov/27290989" }, { "database": "PubMed", "id": "27294151", "url": "https://pubmed.ncbi.nlm.nih.gov/27294151" }, { "database": "PubMed", "id": "27294206", "url": "https://pubmed.ncbi.nlm.nih.gov/27294206" }, { "database": "PubMed", "id": "27302366", "url": "https://pubmed.ncbi.nlm.nih.gov/27302366" }, { "database": "PubMed", "id": "27304189", "url": "https://pubmed.ncbi.nlm.nih.gov/27304189" }, { "database": "PubMed", "id": "27304216", "url": "https://pubmed.ncbi.nlm.nih.gov/27304216" }, { "database": "PubMed", "id": "27308350", "url": "https://pubmed.ncbi.nlm.nih.gov/27308350" }, { "database": "PubMed", "id": "27323778", "url": "https://pubmed.ncbi.nlm.nih.gov/27323778" }, { "database": "PubMed", "id": "27323822", "url": "https://pubmed.ncbi.nlm.nih.gov/27323822" }, { "database": "PubMed", "id": "27324222", "url": "https://pubmed.ncbi.nlm.nih.gov/27324222" }, { "database": "PubMed", "id": "27328758", "url": "https://pubmed.ncbi.nlm.nih.gov/27328758" }, { "database": "PubMed", "id": "27346647", "url": "https://pubmed.ncbi.nlm.nih.gov/27346647" }, { "database": "PubMed", "id": "27374081", "url": "https://pubmed.ncbi.nlm.nih.gov/27374081" }, { "database": "PubMed", "id": "27379204", "url": "https://pubmed.ncbi.nlm.nih.gov/27379204" }, { "database": "PubMed", "id": "27385333", "url": "https://pubmed.ncbi.nlm.nih.gov/27385333" }, { "database": "PubMed", "id": "27387559", "url": "https://pubmed.ncbi.nlm.nih.gov/27387559" }, { "database": "PubMed", "id": "27390173", "url": "https://pubmed.ncbi.nlm.nih.gov/27390173" }, { "database": "PubMed", "id": "27391151", "url": "https://pubmed.ncbi.nlm.nih.gov/27391151" }, { "database": "PubMed", "id": "27391443", "url": "https://pubmed.ncbi.nlm.nih.gov/27391443" }, { "database": "PubMed", "id": "27412013", "url": "https://pubmed.ncbi.nlm.nih.gov/27412013" }, { "database": "PubMed", "id": "27422524", "url": "https://pubmed.ncbi.nlm.nih.gov/27422524" }, { "database": "PubMed", "id": "27447863", "url": "https://pubmed.ncbi.nlm.nih.gov/27447863" }, { "database": "PubMed", "id": "27449083", "url": "https://pubmed.ncbi.nlm.nih.gov/27449083" }, { "database": "PubMed", "id": "27451907", "url": "https://pubmed.ncbi.nlm.nih.gov/27451907" }, { "database": "PubMed", "id": "27465688", "url": "https://pubmed.ncbi.nlm.nih.gov/27465688" }, { "database": "PubMed", "id": "27467927", "url": "https://pubmed.ncbi.nlm.nih.gov/27467927" }, { "database": "PubMed", "id": "27481183", "url": "https://pubmed.ncbi.nlm.nih.gov/27481183" }, { "database": "PubMed", "id": "27481935", "url": "https://pubmed.ncbi.nlm.nih.gov/27481935" }, { "database": "PubMed", "id": "27484721", "url": "https://pubmed.ncbi.nlm.nih.gov/27484721" }, { "database": "PubMed", "id": "27486771", "url": "https://pubmed.ncbi.nlm.nih.gov/27486771" }, { "database": "PubMed", "id": "27487122", "url": "https://pubmed.ncbi.nlm.nih.gov/27487122" }, { "database": "PubMed", "id": "27487130", "url": "https://pubmed.ncbi.nlm.nih.gov/27487130" }, { "database": "PubMed", "id": "27487157", "url": "https://pubmed.ncbi.nlm.nih.gov/27487157" }, { "database": "PubMed", "id": "27489350", "url": "https://pubmed.ncbi.nlm.nih.gov/27489350" }, { "database": "PubMed", "id": "27494022", "url": "https://pubmed.ncbi.nlm.nih.gov/27494022" }, { "database": "PubMed", "id": "27494849", "url": "https://pubmed.ncbi.nlm.nih.gov/27494849" }, { "database": "PubMed", "id": "27494886", "url": "https://pubmed.ncbi.nlm.nih.gov/27494886" }, { "database": "PubMed", "id": "27494895", "url": "https://pubmed.ncbi.nlm.nih.gov/27494895" }, { "database": "PubMed", "id": "27499633", "url": "https://pubmed.ncbi.nlm.nih.gov/27499633" }, { "database": "PubMed", "id": "27506466", "url": "https://pubmed.ncbi.nlm.nih.gov/27506466" }, { "database": "PubMed", "id": "27533087", "url": "https://pubmed.ncbi.nlm.nih.gov/27533087" }, { "database": "PubMed", "id": "27543462", "url": "https://pubmed.ncbi.nlm.nih.gov/27543462" }, { "database": "PubMed", "id": "27548722", "url": "https://pubmed.ncbi.nlm.nih.gov/27548722" }, { "database": "PubMed", "id": "27551486", "url": "https://pubmed.ncbi.nlm.nih.gov/27551486" }, { "database": "PubMed", "id": "27561791", "url": "https://pubmed.ncbi.nlm.nih.gov/27561791" }, { "database": "PubMed", "id": "27566939", "url": "https://pubmed.ncbi.nlm.nih.gov/27566939" }, { "database": "PubMed", "id": "27601656", "url": "https://pubmed.ncbi.nlm.nih.gov/27601656" }, { "database": "PubMed", "id": "27602585", "url": "https://pubmed.ncbi.nlm.nih.gov/27602585" }, { "database": "PubMed", "id": "27602766", "url": "https://pubmed.ncbi.nlm.nih.gov/27602766" }, { "database": "PubMed", "id": "27611696", "url": "https://pubmed.ncbi.nlm.nih.gov/27611696" }, { "database": "PubMed", "id": "27613837", "url": "https://pubmed.ncbi.nlm.nih.gov/27613837" }, { "database": "PubMed", "id": "27622707", "url": "https://pubmed.ncbi.nlm.nih.gov/27622707" }, { "database": "PubMed", "id": "27627109", "url": "https://pubmed.ncbi.nlm.nih.gov/27627109" }, { "database": "PubMed", "id": "27627761", "url": "https://pubmed.ncbi.nlm.nih.gov/27627761" }, { "database": "PubMed", "id": "27634878", "url": "https://pubmed.ncbi.nlm.nih.gov/27634878" }, { "database": "PubMed", "id": "27636107", "url": "https://pubmed.ncbi.nlm.nih.gov/27636107" }, { "database": "PubMed", "id": "27642646", "url": "https://pubmed.ncbi.nlm.nih.gov/27642646" }, { "database": "PubMed", "id": "27650895", "url": "https://pubmed.ncbi.nlm.nih.gov/27650895" }, { "database": "PubMed", "id": "27652381", "url": "https://pubmed.ncbi.nlm.nih.gov/27652381" }, { "database": "PubMed", "id": "27654866", "url": "https://pubmed.ncbi.nlm.nih.gov/27654866" }, { "database": "PubMed", "id": "27656263", "url": "https://pubmed.ncbi.nlm.nih.gov/27656263" }, { "database": "PubMed", "id": "27659207", "url": "https://pubmed.ncbi.nlm.nih.gov/27659207" }, { "database": "PubMed", "id": "27659528", "url": "https://pubmed.ncbi.nlm.nih.gov/27659528" }, { "database": "PubMed", "id": "27661108", "url": "https://pubmed.ncbi.nlm.nih.gov/27661108" }, { "database": "PubMed", "id": "27680387", "url": "https://pubmed.ncbi.nlm.nih.gov/27680387" }, { "database": "PubMed", "id": "27688096", "url": "https://pubmed.ncbi.nlm.nih.gov/27688096" }, { "database": "PubMed", "id": "27694961", "url": "https://pubmed.ncbi.nlm.nih.gov/27694961" }, { "database": "PubMed", "id": "27694970", "url": "https://pubmed.ncbi.nlm.nih.gov/27694970" }, { "database": "PubMed", "id": "27697523", "url": "https://pubmed.ncbi.nlm.nih.gov/27697523" }, { "database": "PubMed", "id": "27698389", "url": "https://pubmed.ncbi.nlm.nih.gov/27698389" }, { "database": "PubMed", "id": "27698667", "url": "https://pubmed.ncbi.nlm.nih.gov/27698667" }, { "database": "PubMed", "id": "27757122", "url": "https://pubmed.ncbi.nlm.nih.gov/27757122" }, { "database": "PubMed", "id": "27762303", "url": "https://pubmed.ncbi.nlm.nih.gov/27762303" }, { "database": "PubMed", "id": "27764189", "url": "https://pubmed.ncbi.nlm.nih.gov/27764189" }, { "database": "PubMed", "id": "27768588", "url": "https://pubmed.ncbi.nlm.nih.gov/27768588" }, { "database": "PubMed", "id": "27769069", "url": "https://pubmed.ncbi.nlm.nih.gov/27769069" }, { "database": "PubMed", "id": "27776559", "url": "https://pubmed.ncbi.nlm.nih.gov/27776559" }, { "database": "PubMed", "id": "27784766", "url": "https://pubmed.ncbi.nlm.nih.gov/27784766" }, { "database": "PubMed", "id": "27800505", "url": "https://pubmed.ncbi.nlm.nih.gov/27800505" }, { "database": "PubMed", "id": "27807598", "url": "https://pubmed.ncbi.nlm.nih.gov/27807598" }, { "database": "PubMed", "id": "27809307", "url": "https://pubmed.ncbi.nlm.nih.gov/27809307" }, { "database": "PubMed", "id": "27811362", "url": "https://pubmed.ncbi.nlm.nih.gov/27811362" }, { "database": "PubMed", "id": "27829222", "url": "https://pubmed.ncbi.nlm.nih.gov/27829222" }, { "database": "PubMed", "id": "27846451", "url": "https://pubmed.ncbi.nlm.nih.gov/27846451" }, { "database": "PubMed", "id": "27849011", "url": "https://pubmed.ncbi.nlm.nih.gov/27849011" }, { "database": "PubMed", "id": "27853260", "url": "https://pubmed.ncbi.nlm.nih.gov/27853260" }, { "database": "PubMed", "id": "27863406", "url": "https://pubmed.ncbi.nlm.nih.gov/27863406" }, { "database": "PubMed", "id": "27866093", "url": "https://pubmed.ncbi.nlm.nih.gov/27866093" }, { "database": "PubMed", "id": "27888634", "url": "https://pubmed.ncbi.nlm.nih.gov/27888634" }, { "database": "PubMed", "id": "27894090", "url": "https://pubmed.ncbi.nlm.nih.gov/27894090" }, { "database": "PubMed", "id": "27896950", "url": "https://pubmed.ncbi.nlm.nih.gov/27896950" }, { "database": "PubMed", "id": "27900025", "url": "https://pubmed.ncbi.nlm.nih.gov/27900025" }, { "database": "PubMed", "id": "27901111", "url": "https://pubmed.ncbi.nlm.nih.gov/27901111" }, { "database": "PubMed", "id": "27919290", "url": "https://pubmed.ncbi.nlm.nih.gov/27919290" }, { "database": "PubMed", "id": "27922982", "url": "https://pubmed.ncbi.nlm.nih.gov/27922982" }, { "database": "PubMed", "id": "27966531", "url": "https://pubmed.ncbi.nlm.nih.gov/27966531" }, { "database": "PubMed", "id": "27974696", "url": "https://pubmed.ncbi.nlm.nih.gov/27974696" }, { "database": "PubMed", "id": "27988337", "url": "https://pubmed.ncbi.nlm.nih.gov/27988337" }, { "database": "PubMed", "id": "27992958", "url": "https://pubmed.ncbi.nlm.nih.gov/27992958" }, { "database": "PubMed", "id": "28002802", "url": "https://pubmed.ncbi.nlm.nih.gov/28002802" }, { "database": "PubMed", "id": "28003335", "url": "https://pubmed.ncbi.nlm.nih.gov/28003335" }, { "database": "PubMed", "id": "28008153", "url": "https://pubmed.ncbi.nlm.nih.gov/28008153" }, { "database": "PubMed", "id": "28008155", "url": "https://pubmed.ncbi.nlm.nih.gov/28008155" }, { "database": "PubMed", "id": "28025104", "url": "https://pubmed.ncbi.nlm.nih.gov/28025104" }, { "database": "PubMed", "id": "28035062", "url": "https://pubmed.ncbi.nlm.nih.gov/28035062" }, { "database": "PubMed", "id": "28035333", "url": "https://pubmed.ncbi.nlm.nih.gov/28035333" }, { "database": "PubMed", "id": "28052020", "url": "https://pubmed.ncbi.nlm.nih.gov/28052020" }, { "database": "PubMed", "id": "28056899", "url": "https://pubmed.ncbi.nlm.nih.gov/28056899" }, { "database": "PubMed", "id": "28061880", "url": "https://pubmed.ncbi.nlm.nih.gov/28061880" }, { "database": "PubMed", "id": "28067284", "url": "https://pubmed.ncbi.nlm.nih.gov/28067284" }, { "database": "PubMed", "id": "28072855", "url": "https://pubmed.ncbi.nlm.nih.gov/28072855" }, { "database": "PubMed", "id": "28075016", "url": "https://pubmed.ncbi.nlm.nih.gov/28075016" }, { "database": "PubMed", "id": "28076324", "url": "https://pubmed.ncbi.nlm.nih.gov/28076324" }, { "database": "PubMed", "id": "28096970", "url": "https://pubmed.ncbi.nlm.nih.gov/28096970" }, { "database": "PubMed", "id": "28107519", "url": "https://pubmed.ncbi.nlm.nih.gov/28107519" }, { "database": "PubMed", "id": "28123351", "url": "https://pubmed.ncbi.nlm.nih.gov/28123351" }, { "database": "PubMed", "id": "28139498", "url": "https://pubmed.ncbi.nlm.nih.gov/28139498" }, { "database": "PubMed", "id": "28143890", "url": "https://pubmed.ncbi.nlm.nih.gov/28143890" }, { "database": "PubMed", "id": "28151479", "url": "https://pubmed.ncbi.nlm.nih.gov/28151479" }, { "database": "PubMed", "id": "28152500", "url": "https://pubmed.ncbi.nlm.nih.gov/28152500" }, { "database": "PubMed", "id": "28176801", "url": "https://pubmed.ncbi.nlm.nih.gov/28176801" }, { "database": "PubMed", "id": "28179017", "url": "https://pubmed.ncbi.nlm.nih.gov/28179017" }, { "database": "PubMed", "id": "28188308", "url": "https://pubmed.ncbi.nlm.nih.gov/28188308" }, { "database": "PubMed", "id": "28190771", "url": "https://pubmed.ncbi.nlm.nih.gov/28190771" }, { "database": "PubMed", "id": "28208754", "url": "https://pubmed.ncbi.nlm.nih.gov/28208754" }, { "database": "PubMed", "id": "28209617", "url": "https://pubmed.ncbi.nlm.nih.gov/28209617" }, { "database": "PubMed", "id": "28209923", "url": "https://pubmed.ncbi.nlm.nih.gov/28209923" }, { "database": "PubMed", "id": "28213783", "url": "https://pubmed.ncbi.nlm.nih.gov/28213783" }, { "database": "PubMed", "id": "28217097", "url": "https://pubmed.ncbi.nlm.nih.gov/28217097" }, { "database": "PubMed", "id": "28218907", "url": "https://pubmed.ncbi.nlm.nih.gov/28218907" }, { "database": "PubMed", "id": "28231291", "url": "https://pubmed.ncbi.nlm.nih.gov/28231291" }, { "database": "PubMed", "id": "28231796", "url": "https://pubmed.ncbi.nlm.nih.gov/28231796" }, { "database": "PubMed", "id": "28232663", "url": "https://pubmed.ncbi.nlm.nih.gov/28232663" }, { "database": "PubMed", "id": "28240737", "url": "https://pubmed.ncbi.nlm.nih.gov/28240737" }, { "database": "PubMed", "id": "28246389", "url": "https://pubmed.ncbi.nlm.nih.gov/28246389" }, { "database": "PubMed", "id": "28247844", "url": "https://pubmed.ncbi.nlm.nih.gov/28247844" }, { "database": "PubMed", "id": "28249041", "url": "https://pubmed.ncbi.nlm.nih.gov/28249041" }, { "database": "PubMed", "id": "28262546", "url": "https://pubmed.ncbi.nlm.nih.gov/28262546" }, { "database": "PubMed", "id": "28276427", "url": "https://pubmed.ncbi.nlm.nih.gov/28276427" }, { "database": "PubMed", "id": "28285136", "url": "https://pubmed.ncbi.nlm.nih.gov/28285136" }, { "database": "PubMed", "id": "28289332", "url": "https://pubmed.ncbi.nlm.nih.gov/28289332" }, { "database": "PubMed", "id": "28294973", "url": "https://pubmed.ncbi.nlm.nih.gov/28294973" }, { "database": "PubMed", "id": "28296156", "url": "https://pubmed.ncbi.nlm.nih.gov/28296156" }, { "database": "PubMed", "id": "28303961", "url": "https://pubmed.ncbi.nlm.nih.gov/28303961" }, { "database": "PubMed", "id": "28316325", "url": "https://pubmed.ncbi.nlm.nih.gov/28316325" }, { "database": "PubMed", "id": "28320338", "url": "https://pubmed.ncbi.nlm.nih.gov/28320338" }, { "database": "PubMed", "id": "28332309", "url": "https://pubmed.ncbi.nlm.nih.gov/28332309" }, { "database": "PubMed", "id": "28332553", "url": "https://pubmed.ncbi.nlm.nih.gov/28332553" }, { "database": "PubMed", "id": "28332584", "url": "https://pubmed.ncbi.nlm.nih.gov/28332584" }, { "database": "PubMed", "id": "28337019", "url": "https://pubmed.ncbi.nlm.nih.gov/28337019" }, { "database": "PubMed", "id": "28345588", "url": "https://pubmed.ncbi.nlm.nih.gov/28345588" }, { "database": "PubMed", "id": "28345638", "url": "https://pubmed.ncbi.nlm.nih.gov/28345638" }, { "database": "PubMed", "id": "28348404", "url": "https://pubmed.ncbi.nlm.nih.gov/28348404" }, { "database": "PubMed", "id": "28349073", "url": "https://pubmed.ncbi.nlm.nih.gov/28349073" }, { "database": "PubMed", "id": "28352764", "url": "https://pubmed.ncbi.nlm.nih.gov/28352764" }, { "database": "PubMed", "id": "28356941", "url": "https://pubmed.ncbi.nlm.nih.gov/28356941" }, { "database": "PubMed", "id": "28359316", "url": "https://pubmed.ncbi.nlm.nih.gov/28359316" }, { "database": "PubMed", "id": "28360087", "url": "https://pubmed.ncbi.nlm.nih.gov/28360087" }, { "database": "PubMed", "id": "28367274", "url": "https://pubmed.ncbi.nlm.nih.gov/28367274" }, { "database": "PubMed", "id": "28370702", "url": "https://pubmed.ncbi.nlm.nih.gov/28370702" }, { "database": "PubMed", "id": "28380428", "url": "https://pubmed.ncbi.nlm.nih.gov/28380428" }, { "database": "PubMed", "id": "28380463", "url": "https://pubmed.ncbi.nlm.nih.gov/28380463" }, { "database": "PubMed", "id": "28382169", "url": "https://pubmed.ncbi.nlm.nih.gov/28382169" }, { "database": "PubMed", "id": "28402933", "url": "https://pubmed.ncbi.nlm.nih.gov/28402933" }, { "database": "PubMed", "id": "28410531", "url": "https://pubmed.ncbi.nlm.nih.gov/28410531" }, { "database": "PubMed", "id": "28415790", "url": "https://pubmed.ncbi.nlm.nih.gov/28415790" }, { "database": "PubMed", "id": "28427860", "url": "https://pubmed.ncbi.nlm.nih.gov/28427860" }, { "database": "PubMed", "id": "28431901", "url": "https://pubmed.ncbi.nlm.nih.gov/28431901" }, { "database": "PubMed", "id": "28432984", "url": "https://pubmed.ncbi.nlm.nih.gov/28432984" }, { "database": "PubMed", "id": "28440394", "url": "https://pubmed.ncbi.nlm.nih.gov/28440394" }, { "database": "PubMed", "id": "28442995", "url": "https://pubmed.ncbi.nlm.nih.gov/28442995" }, { "database": "PubMed", "id": "28445151", "url": "https://pubmed.ncbi.nlm.nih.gov/28445151" }, { "database": "PubMed", "id": "28448438", "url": "https://pubmed.ncbi.nlm.nih.gov/28448438" }, { "database": "PubMed", "id": "28460455", "url": "https://pubmed.ncbi.nlm.nih.gov/28460455" }, { "database": "PubMed", "id": "28464039", "url": "https://pubmed.ncbi.nlm.nih.gov/28464039" }, { "database": "PubMed", "id": "28465354", "url": "https://pubmed.ncbi.nlm.nih.gov/28465354" }, { "database": "PubMed", "id": "28468326", "url": "https://pubmed.ncbi.nlm.nih.gov/28468326" }, { "database": "PubMed", "id": "28470144", "url": "https://pubmed.ncbi.nlm.nih.gov/28470144" }, { "database": "PubMed", "id": "28475412", "url": "https://pubmed.ncbi.nlm.nih.gov/28475412" }, { "database": "PubMed", "id": "28476032", "url": "https://pubmed.ncbi.nlm.nih.gov/28476032" }, { "database": "PubMed", "id": "28481292", "url": "https://pubmed.ncbi.nlm.nih.gov/28481292" }, { "database": "PubMed", "id": "28484273", "url": "https://pubmed.ncbi.nlm.nih.gov/28484273" }, { "database": "PubMed", "id": "28489572", "url": "https://pubmed.ncbi.nlm.nih.gov/28489572" }, { "database": "PubMed", "id": "28518144", "url": "https://pubmed.ncbi.nlm.nih.gov/28518144" }, { "database": "PubMed", "id": "28525374", "url": "https://pubmed.ncbi.nlm.nih.gov/28525374" }, { "database": "PubMed", "id": "28529765", "url": "https://pubmed.ncbi.nlm.nih.gov/28529765" }, { "database": "PubMed", "id": "28534510", "url": "https://pubmed.ncbi.nlm.nih.gov/28534510" }, { "database": "PubMed", "id": "28542590", "url": "https://pubmed.ncbi.nlm.nih.gov/28542590" }, { "database": "PubMed", "id": "28545581", "url": "https://pubmed.ncbi.nlm.nih.gov/28545581" }, { "database": "PubMed", "id": "28548645", "url": "https://pubmed.ncbi.nlm.nih.gov/28548645" }, { "database": "PubMed", "id": "28558072", "url": "https://pubmed.ncbi.nlm.nih.gov/28558072" }, { "database": "PubMed", "id": "28573133", "url": "https://pubmed.ncbi.nlm.nih.gov/28573133" }, { "database": "PubMed", "id": "28579808", "url": "https://pubmed.ncbi.nlm.nih.gov/28579808" }, { "database": "PubMed", "id": "28588706", "url": "https://pubmed.ncbi.nlm.nih.gov/28588706" }, { "database": "PubMed", "id": "28591580", "url": "https://pubmed.ncbi.nlm.nih.gov/28591580" }, { "database": "PubMed", "id": "28614631", "url": "https://pubmed.ncbi.nlm.nih.gov/28614631" }, { "database": "PubMed", "id": "28614911", "url": "https://pubmed.ncbi.nlm.nih.gov/28614911" }, { "database": "PubMed", "id": "28632179", "url": "https://pubmed.ncbi.nlm.nih.gov/28632179" }, { "database": "PubMed", "id": "28632938", "url": "https://pubmed.ncbi.nlm.nih.gov/28632938" }, { "database": "PubMed", "id": "28634229", "url": "https://pubmed.ncbi.nlm.nih.gov/28634229" }, { "database": "PubMed", "id": "28650797", "url": "https://pubmed.ncbi.nlm.nih.gov/28650797" }, { "database": "PubMed", "id": "28659580", "url": "https://pubmed.ncbi.nlm.nih.gov/28659580" }, { "database": "PubMed", "id": "28663750", "url": "https://pubmed.ncbi.nlm.nih.gov/28663750" }, { "database": "PubMed", "id": "28664914", "url": "https://pubmed.ncbi.nlm.nih.gov/28664914" }, { "database": "PubMed", "id": "28666462", "url": "https://pubmed.ncbi.nlm.nih.gov/28666462" }, { "database": "PubMed", "id": "28669988", "url": "https://pubmed.ncbi.nlm.nih.gov/28669988" }, { "database": "PubMed", "id": "28673204", "url": "https://pubmed.ncbi.nlm.nih.gov/28673204" }, { "database": "PubMed", "id": "28675026", "url": "https://pubmed.ncbi.nlm.nih.gov/28675026" }, { "database": "PubMed", "id": "28691020", "url": "https://pubmed.ncbi.nlm.nih.gov/28691020" }, { "database": "PubMed", "id": "28691365", "url": "https://pubmed.ncbi.nlm.nih.gov/28691365" }, { "database": "PubMed", "id": "28694518", "url": "https://pubmed.ncbi.nlm.nih.gov/28694518" }, { "database": "PubMed", "id": "28698260", "url": "https://pubmed.ncbi.nlm.nih.gov/28698260" }, { "database": "PubMed", "id": "28699701", "url": "https://pubmed.ncbi.nlm.nih.gov/28699701" }, { "database": "PubMed", "id": "28700668", "url": "https://pubmed.ncbi.nlm.nih.gov/28700668" }, { "database": "PubMed", "id": "28701722", "url": "https://pubmed.ncbi.nlm.nih.gov/28701722" }, { "database": "PubMed", "id": "28701787", "url": "https://pubmed.ncbi.nlm.nih.gov/28701787" }, { "database": "PubMed", "id": "28762556", "url": "https://pubmed.ncbi.nlm.nih.gov/28762556" }, { "database": "PubMed", "id": "28765579", "url": "https://pubmed.ncbi.nlm.nih.gov/28765579" }, { "database": "PubMed", "id": "28765641", "url": "https://pubmed.ncbi.nlm.nih.gov/28765641" }, { "database": "PubMed", "id": "28771224", "url": "https://pubmed.ncbi.nlm.nih.gov/28771224" }, { "database": "PubMed", "id": "28790888", "url": "https://pubmed.ncbi.nlm.nih.gov/28790888" }, { "database": "PubMed", "id": "28794469", "url": "https://pubmed.ncbi.nlm.nih.gov/28794469" }, { "database": "PubMed", "id": "28794477", "url": "https://pubmed.ncbi.nlm.nih.gov/28794477" }, { "database": "PubMed", "id": "28796787", "url": "https://pubmed.ncbi.nlm.nih.gov/28796787" }, { "database": "PubMed", "id": "28801576", "url": "https://pubmed.ncbi.nlm.nih.gov/28801576" }, { "database": "PubMed", "id": "28806945", "url": "https://pubmed.ncbi.nlm.nih.gov/28806945" }, { "database": "PubMed", "id": "28808297", "url": "https://pubmed.ncbi.nlm.nih.gov/28808297" }, { "database": "PubMed", "id": "28814745", "url": "https://pubmed.ncbi.nlm.nih.gov/28814745" }, { "database": "PubMed", "id": "28825630", "url": "https://pubmed.ncbi.nlm.nih.gov/28825630" }, { "database": "PubMed", "id": "28833338", "url": "https://pubmed.ncbi.nlm.nih.gov/28833338" }, { "database": "PubMed", "id": "28857517", "url": "https://pubmed.ncbi.nlm.nih.gov/28857517" }, { "database": "PubMed", "id": "28871105", "url": "https://pubmed.ncbi.nlm.nih.gov/28871105" }, { "database": "PubMed", "id": "28881576", "url": "https://pubmed.ncbi.nlm.nih.gov/28881576" }, { "database": "PubMed", "id": "28881794", "url": "https://pubmed.ncbi.nlm.nih.gov/28881794" }, { "database": "PubMed", "id": "28881811", "url": "https://pubmed.ncbi.nlm.nih.gov/28881811" }, { "database": "PubMed", "id": "28883547", "url": "https://pubmed.ncbi.nlm.nih.gov/28883547" }, { "database": "PubMed", "id": "28903364", "url": "https://pubmed.ncbi.nlm.nih.gov/28903364" }, { "database": "PubMed", "id": "28903425", "url": "https://pubmed.ncbi.nlm.nih.gov/28903425" }, { "database": "PubMed", "id": "28914370", "url": "https://pubmed.ncbi.nlm.nih.gov/28914370" }, { "database": "PubMed", "id": "28915595", "url": "https://pubmed.ncbi.nlm.nih.gov/28915595" }, { "database": "PubMed", "id": "28915623", "url": "https://pubmed.ncbi.nlm.nih.gov/28915623" }, { "database": "PubMed", "id": "28916818", "url": "https://pubmed.ncbi.nlm.nih.gov/28916818" }, { "database": "PubMed", "id": "28938574", "url": "https://pubmed.ncbi.nlm.nih.gov/28938574" }, { "database": "PubMed", "id": "28943275", "url": "https://pubmed.ncbi.nlm.nih.gov/28943275" }, { "database": "PubMed", "id": "28955927", "url": "https://pubmed.ncbi.nlm.nih.gov/28955927" }, { "database": "PubMed", "id": "28960945", "url": "https://pubmed.ncbi.nlm.nih.gov/28960945" }, { "database": "PubMed", "id": "28962326", "url": "https://pubmed.ncbi.nlm.nih.gov/28962326" }, { "database": "PubMed", "id": "28967905", "url": "https://pubmed.ncbi.nlm.nih.gov/28967905" }, { "database": "PubMed", "id": "28968999", "url": "https://pubmed.ncbi.nlm.nih.gov/28968999" }, { "database": "PubMed", "id": "28969041", "url": "https://pubmed.ncbi.nlm.nih.gov/28969041" }, { "database": "PubMed", "id": "28972559", "url": "https://pubmed.ncbi.nlm.nih.gov/28972559" }, { "database": "PubMed", "id": "28976590", "url": "https://pubmed.ncbi.nlm.nih.gov/28976590" }, { "database": "PubMed", "id": "28977846", "url": "https://pubmed.ncbi.nlm.nih.gov/28977846" }, { "database": "PubMed", "id": "28978070", "url": "https://pubmed.ncbi.nlm.nih.gov/28978070" }, { "database": "PubMed", "id": "28982149", "url": "https://pubmed.ncbi.nlm.nih.gov/28982149" }, { "database": "PubMed", "id": "28986255", "url": "https://pubmed.ncbi.nlm.nih.gov/28986255" }, { "database": "PubMed", "id": "28987868", "url": "https://pubmed.ncbi.nlm.nih.gov/28987868" }, { "database": "PubMed", "id": "28993697", "url": "https://pubmed.ncbi.nlm.nih.gov/28993697" }, { "database": "PubMed", "id": "29017516", "url": "https://pubmed.ncbi.nlm.nih.gov/29017516" }, { "database": "PubMed", "id": "29017592", "url": "https://pubmed.ncbi.nlm.nih.gov/29017592" }, { "database": "PubMed", "id": "29038421", "url": "https://pubmed.ncbi.nlm.nih.gov/29038421" }, { "database": "PubMed", "id": "29039440", "url": "https://pubmed.ncbi.nlm.nih.gov/29039440" }, { "database": "PubMed", "id": "29044520", "url": "https://pubmed.ncbi.nlm.nih.gov/29044520" }, { "database": "PubMed", "id": "29050229", "url": "https://pubmed.ncbi.nlm.nih.gov/29050229" }, { "database": "PubMed", "id": "29071793", "url": "https://pubmed.ncbi.nlm.nih.gov/29071793" }, { "database": "PubMed", "id": "29077243", "url": "https://pubmed.ncbi.nlm.nih.gov/29077243" }, { "database": "PubMed", "id": "29078297", "url": "https://pubmed.ncbi.nlm.nih.gov/29078297" }, { "database": "PubMed", "id": "29085455", "url": "https://pubmed.ncbi.nlm.nih.gov/29085455" }, { "database": "PubMed", "id": "29088844", "url": "https://pubmed.ncbi.nlm.nih.gov/29088844" }, { "database": "PubMed", "id": "29088849", "url": "https://pubmed.ncbi.nlm.nih.gov/29088849" }, { "database": "PubMed", "id": "29090098", "url": "https://pubmed.ncbi.nlm.nih.gov/29090098" }, { "database": "PubMed", "id": "29097657", "url": "https://pubmed.ncbi.nlm.nih.gov/29097657" }, { "database": "PubMed", "id": "29099866", "url": "https://pubmed.ncbi.nlm.nih.gov/29099866" }, { "database": "PubMed", "id": "29104511", "url": "https://pubmed.ncbi.nlm.nih.gov/29104511" }, { "database": "PubMed", "id": "29113242", "url": "https://pubmed.ncbi.nlm.nih.gov/29113242" }, { "database": "PubMed", "id": "29113312", "url": "https://pubmed.ncbi.nlm.nih.gov/29113312" }, { "database": "PubMed", "id": "29114068", "url": "https://pubmed.ncbi.nlm.nih.gov/29114068" }, { "database": "PubMed", "id": "29116180", "url": "https://pubmed.ncbi.nlm.nih.gov/29116180" }, { "database": "PubMed", "id": "29134198", "url": "https://pubmed.ncbi.nlm.nih.gov/29134198" }, { "database": "PubMed", "id": "29137265", "url": "https://pubmed.ncbi.nlm.nih.gov/29137265" }, { "database": "PubMed", "id": "29137317", "url": "https://pubmed.ncbi.nlm.nih.gov/29137317" }, { "database": "PubMed", "id": "29147235", "url": "https://pubmed.ncbi.nlm.nih.gov/29147235" }, { "database": "PubMed", "id": "29150437", "url": "https://pubmed.ncbi.nlm.nih.gov/29150437" }, { "database": "PubMed", "id": "29152059", "url": "https://pubmed.ncbi.nlm.nih.gov/29152059" }, { "database": "PubMed", "id": "29152112", "url": "https://pubmed.ncbi.nlm.nih.gov/29152112" }, { "database": "PubMed", "id": "29152142", "url": "https://pubmed.ncbi.nlm.nih.gov/29152142" }, { "database": "PubMed", "id": "29156676", "url": "https://pubmed.ncbi.nlm.nih.gov/29156676" }, { "database": "PubMed", "id": "29156708", "url": "https://pubmed.ncbi.nlm.nih.gov/29156708" }, { "database": "PubMed", "id": "29158883", "url": "https://pubmed.ncbi.nlm.nih.gov/29158883" }, { "database": "PubMed", "id": "29161765", "url": "https://pubmed.ncbi.nlm.nih.gov/29161765" }, { "database": "PubMed", "id": "29186909", "url": "https://pubmed.ncbi.nlm.nih.gov/29186909" }, { "database": "PubMed", "id": "29190895", "url": "https://pubmed.ncbi.nlm.nih.gov/29190895" }, { "database": "PubMed", "id": "29190940", "url": "https://pubmed.ncbi.nlm.nih.gov/29190940" }, { "database": "PubMed", "id": "29193093", "url": "https://pubmed.ncbi.nlm.nih.gov/29193093" }, { "database": "PubMed", "id": "29193730", "url": "https://pubmed.ncbi.nlm.nih.gov/29193730" }, { "database": "PubMed", "id": "29193784", "url": "https://pubmed.ncbi.nlm.nih.gov/29193784" }, { "database": "PubMed", "id": "29212252", "url": "https://pubmed.ncbi.nlm.nih.gov/29212252" }, { "database": "PubMed", "id": "29213214", "url": "https://pubmed.ncbi.nlm.nih.gov/29213214" }, { "database": "PubMed", "id": "29221131", "url": "https://pubmed.ncbi.nlm.nih.gov/29221131" }, { "database": "PubMed", "id": "29221176", "url": "https://pubmed.ncbi.nlm.nih.gov/29221176" }, { "database": "PubMed", "id": "29228673", "url": "https://pubmed.ncbi.nlm.nih.gov/29228673" }, { "database": "PubMed", "id": "29228741", "url": "https://pubmed.ncbi.nlm.nih.gov/29228741" }, { "database": "PubMed", "id": "29251327", "url": "https://pubmed.ncbi.nlm.nih.gov/29251327" }, { "database": "PubMed", "id": "29254199", "url": "https://pubmed.ncbi.nlm.nih.gov/29254199" }, { "database": "PubMed", "id": "29254208", "url": "https://pubmed.ncbi.nlm.nih.gov/29254208" }, { "database": "PubMed", "id": "29257275", "url": "https://pubmed.ncbi.nlm.nih.gov/29257275" }, { "database": "PubMed", "id": "29257319", "url": "https://pubmed.ncbi.nlm.nih.gov/29257319" }, { "database": "PubMed", "id": "29262536", "url": "https://pubmed.ncbi.nlm.nih.gov/29262536" }, { "database": "PubMed", "id": "29262576", "url": "https://pubmed.ncbi.nlm.nih.gov/29262576" }, { "database": "PubMed", "id": "29266303", "url": "https://pubmed.ncbi.nlm.nih.gov/29266303" }, { "database": "PubMed", "id": "29269867", "url": "https://pubmed.ncbi.nlm.nih.gov/29269867" }, { "database": "PubMed", "id": "29278364", "url": "https://pubmed.ncbi.nlm.nih.gov/29278364" }, { "database": "PubMed", "id": "29282077", "url": "https://pubmed.ncbi.nlm.nih.gov/29282077" }, { "database": "PubMed", "id": "29285315", "url": "https://pubmed.ncbi.nlm.nih.gov/29285315" }, { "database": "PubMed", "id": "29286216", "url": "https://pubmed.ncbi.nlm.nih.gov/29286216" }, { "database": "PubMed", "id": "29292863", "url": "https://pubmed.ncbi.nlm.nih.gov/29292863" }, { "database": "PubMed", "id": "29296215", "url": "https://pubmed.ncbi.nlm.nih.gov/29296215" }, { "database": "PubMed", "id": "29310608", "url": "https://pubmed.ncbi.nlm.nih.gov/29310608" }, { "database": "PubMed", "id": "29311919", "url": "https://pubmed.ncbi.nlm.nih.gov/29311919" }, { "database": "PubMed", "id": "29314656", "url": "https://pubmed.ncbi.nlm.nih.gov/29314656" }, { "database": "PubMed", "id": "29331082", "url": "https://pubmed.ncbi.nlm.nih.gov/29331082" }, { "database": "PubMed", "id": "29335246", "url": "https://pubmed.ncbi.nlm.nih.gov/29335246" }, { "database": "PubMed", "id": "29341150", "url": "https://pubmed.ncbi.nlm.nih.gov/29341150" }, { "database": "PubMed", "id": "29348846", "url": "https://pubmed.ncbi.nlm.nih.gov/29348846" }, { "database": "PubMed", "id": "29354058", "url": "https://pubmed.ncbi.nlm.nih.gov/29354058" }, { "database": "PubMed", "id": "29355935", "url": "https://pubmed.ncbi.nlm.nih.gov/29355935" }, { "database": "PubMed", "id": "29357370", "url": "https://pubmed.ncbi.nlm.nih.gov/29357370" }, { "database": "PubMed", "id": "29361539", "url": "https://pubmed.ncbi.nlm.nih.gov/29361539" }, { "database": "PubMed", "id": "29363568", "url": "https://pubmed.ncbi.nlm.nih.gov/29363568" }, { "database": "PubMed", "id": "29374705", "url": "https://pubmed.ncbi.nlm.nih.gov/29374705" }, { "database": "PubMed", "id": "29375377", "url": "https://pubmed.ncbi.nlm.nih.gov/29375377" }, { "database": "PubMed", "id": "29377936", "url": "https://pubmed.ncbi.nlm.nih.gov/29377936" }, { "database": "PubMed", "id": "29386091", "url": "https://pubmed.ncbi.nlm.nih.gov/29386091" }, { "database": "PubMed", "id": "29386585", "url": "https://pubmed.ncbi.nlm.nih.gov/29386585" }, { "database": "PubMed", "id": "29393871", "url": "https://pubmed.ncbi.nlm.nih.gov/29393871" }, { "database": "PubMed", "id": "29396506", "url": "https://pubmed.ncbi.nlm.nih.gov/29396506" }, { "database": "PubMed", "id": "29419736", "url": "https://pubmed.ncbi.nlm.nih.gov/29419736" }, { "database": "PubMed", "id": "29423104", "url": "https://pubmed.ncbi.nlm.nih.gov/29423104" }, { "database": "PubMed", "id": "29423114", "url": "https://pubmed.ncbi.nlm.nih.gov/29423114" }, { "database": "PubMed", "id": "29423932", "url": "https://pubmed.ncbi.nlm.nih.gov/29423932" }, { "database": "PubMed", "id": "29426295", "url": "https://pubmed.ncbi.nlm.nih.gov/29426295" }, { "database": "PubMed", "id": "29426928", "url": "https://pubmed.ncbi.nlm.nih.gov/29426928" }, { "database": "PubMed", "id": "29434218", "url": "https://pubmed.ncbi.nlm.nih.gov/29434218" }, { "database": "PubMed", "id": "29434241", "url": "https://pubmed.ncbi.nlm.nih.gov/29434241" }, { "database": "PubMed", "id": "29434604", "url": "https://pubmed.ncbi.nlm.nih.gov/29434604" }, { "database": "PubMed", "id": "29434714", "url": "https://pubmed.ncbi.nlm.nih.gov/29434714" }, { "database": "PubMed", "id": "29434840", "url": "https://pubmed.ncbi.nlm.nih.gov/29434840" }, { "database": "PubMed", "id": "29435164", "url": "https://pubmed.ncbi.nlm.nih.gov/29435164" }, { "database": "PubMed", "id": "29440989", "url": "https://pubmed.ncbi.nlm.nih.gov/29440989" }, { "database": "PubMed", "id": "29459737", "url": "https://pubmed.ncbi.nlm.nih.gov/29459737" }, { "database": "PubMed", "id": "29462183", "url": "https://pubmed.ncbi.nlm.nih.gov/29462183" }, { "database": "PubMed", "id": "29463565", "url": "https://pubmed.ncbi.nlm.nih.gov/29463565" }, { "database": "PubMed", "id": "29463831", "url": "https://pubmed.ncbi.nlm.nih.gov/29463831" }, { "database": "PubMed", "id": "29470540", "url": "https://pubmed.ncbi.nlm.nih.gov/29470540" }, { "database": "PubMed", "id": "29471001", "url": "https://pubmed.ncbi.nlm.nih.gov/29471001" }, { "database": "PubMed", "id": "29475988", "url": "https://pubmed.ncbi.nlm.nih.gov/29475988" }, { "database": "PubMed", "id": "29476223", "url": "https://pubmed.ncbi.nlm.nih.gov/29476223" }, { "database": "PubMed", "id": "29482651", "url": "https://pubmed.ncbi.nlm.nih.gov/29482651" }, { "database": "PubMed", "id": "29484131", "url": "https://pubmed.ncbi.nlm.nih.gov/29484131" }, { "database": "PubMed", "id": "29497056", "url": "https://pubmed.ncbi.nlm.nih.gov/29497056" }, { "database": "PubMed", "id": "29502044", "url": "https://pubmed.ncbi.nlm.nih.gov/29502044" }, { "database": "PubMed", "id": "29506489", "url": "https://pubmed.ncbi.nlm.nih.gov/29506489" }, { "database": "PubMed", "id": "29507656", "url": "https://pubmed.ncbi.nlm.nih.gov/29507656" }, { "database": "PubMed", "id": "29507660", "url": "https://pubmed.ncbi.nlm.nih.gov/29507660" }, { "database": "PubMed", "id": "29510720", "url": "https://pubmed.ncbi.nlm.nih.gov/29510720" }, { "database": "PubMed", "id": "29514603", "url": "https://pubmed.ncbi.nlm.nih.gov/29514603" }, { "database": "PubMed", "id": "29515111", "url": "https://pubmed.ncbi.nlm.nih.gov/29515111" }, { "database": "PubMed", "id": "29523594", "url": "https://pubmed.ncbi.nlm.nih.gov/29523594" }, { "database": "PubMed", "id": "29523748", "url": "https://pubmed.ncbi.nlm.nih.gov/29523748" }, { "database": "PubMed", "id": "29524195", "url": "https://pubmed.ncbi.nlm.nih.gov/29524195" }, { "database": "PubMed", "id": "29524296", "url": "https://pubmed.ncbi.nlm.nih.gov/29524296" }, { "database": "PubMed", "id": "29533017", "url": "https://pubmed.ncbi.nlm.nih.gov/29533017" }, { "database": "PubMed", "id": "29535821", "url": "https://pubmed.ncbi.nlm.nih.gov/29535821" }, { "database": "PubMed", "id": "29540196", "url": "https://pubmed.ncbi.nlm.nih.gov/29540196" }, { "database": "PubMed", "id": "29540539", "url": "https://pubmed.ncbi.nlm.nih.gov/29540539" }, { "database": "PubMed", "id": "29549527", "url": "https://pubmed.ncbi.nlm.nih.gov/29549527" }, { "database": "PubMed", "id": "29552308", "url": "https://pubmed.ncbi.nlm.nih.gov/29552308" }, { "database": "PubMed", "id": "29560097", "url": "https://pubmed.ncbi.nlm.nih.gov/29560097" }, { "database": "PubMed", "id": "29563926", "url": "https://pubmed.ncbi.nlm.nih.gov/29563926" }, { "database": "PubMed", "id": "29569795", "url": "https://pubmed.ncbi.nlm.nih.gov/29569795" }, { "database": "PubMed", "id": "29570671", "url": "https://pubmed.ncbi.nlm.nih.gov/29570671" }, { "database": "PubMed", "id": "29572181", "url": "https://pubmed.ncbi.nlm.nih.gov/29572181" }, { "database": "PubMed", "id": "29581766", "url": "https://pubmed.ncbi.nlm.nih.gov/29581766" }, { "database": "PubMed", "id": "29628889", "url": "https://pubmed.ncbi.nlm.nih.gov/29628889" }, { "database": "PubMed", "id": "29632185", "url": "https://pubmed.ncbi.nlm.nih.gov/29632185" }, { "database": "PubMed", "id": "29642855", "url": "https://pubmed.ncbi.nlm.nih.gov/29642855" }, { "database": "PubMed", "id": "29652795", "url": "https://pubmed.ncbi.nlm.nih.gov/29652795" }, { "database": "PubMed", "id": "29658179", "url": "https://pubmed.ncbi.nlm.nih.gov/29658179" }, { "database": "PubMed", "id": "29662626", "url": "https://pubmed.ncbi.nlm.nih.gov/29662626" }, { "database": "PubMed", "id": "29667783", "url": "https://pubmed.ncbi.nlm.nih.gov/29667783" }, { "database": "PubMed", "id": "29670684", "url": "https://pubmed.ncbi.nlm.nih.gov/29670684" }, { "database": "PubMed", "id": "29674727", "url": "https://pubmed.ncbi.nlm.nih.gov/29674727" }, { "database": "PubMed", "id": "29692710", "url": "https://pubmed.ncbi.nlm.nih.gov/29692710" }, { "database": "PubMed", "id": "29695704", "url": "https://pubmed.ncbi.nlm.nih.gov/29695704" }, { "database": "PubMed", "id": "29703716", "url": "https://pubmed.ncbi.nlm.nih.gov/29703716" }, { "database": "PubMed", "id": "29706631", "url": "https://pubmed.ncbi.nlm.nih.gov/29706631" }, { "database": "PubMed", "id": "29707142", "url": "https://pubmed.ncbi.nlm.nih.gov/29707142" }, { "database": "PubMed", "id": "29716528", "url": "https://pubmed.ncbi.nlm.nih.gov/29716528" }, { "database": "PubMed", "id": "29722156", "url": "https://pubmed.ncbi.nlm.nih.gov/29722156" }, { "database": "PubMed", "id": "29723154", "url": "https://pubmed.ncbi.nlm.nih.gov/29723154" }, { "database": "PubMed", "id": "29725263", "url": "https://pubmed.ncbi.nlm.nih.gov/29725263" }, { "database": "PubMed", "id": "29728125", "url": "https://pubmed.ncbi.nlm.nih.gov/29728125" }, { "database": "PubMed", "id": "29728594", "url": "https://pubmed.ncbi.nlm.nih.gov/29728594" }, { "database": "PubMed", "id": "29737572", "url": "https://pubmed.ncbi.nlm.nih.gov/29737572" }, { "database": "PubMed", "id": "29743977", "url": "https://pubmed.ncbi.nlm.nih.gov/29743977" }, { "database": "PubMed", "id": "29749377", "url": "https://pubmed.ncbi.nlm.nih.gov/29749377" }, { "database": "PubMed", "id": "29749659", "url": "https://pubmed.ncbi.nlm.nih.gov/29749659" }, { "database": "PubMed", "id": "29754406", "url": "https://pubmed.ncbi.nlm.nih.gov/29754406" }, { "database": "PubMed", "id": "29755672", "url": "https://pubmed.ncbi.nlm.nih.gov/29755672" }, { "database": "PubMed", "id": "29783631", "url": "https://pubmed.ncbi.nlm.nih.gov/29783631" }, { "database": "PubMed", "id": "29783666", "url": "https://pubmed.ncbi.nlm.nih.gov/29783666" }, { "database": "PubMed", "id": "29786107", "url": "https://pubmed.ncbi.nlm.nih.gov/29786107" }, { "database": "PubMed", "id": "29786666", "url": "https://pubmed.ncbi.nlm.nih.gov/29786666" }, { "database": "PubMed", "id": "29795279", "url": "https://pubmed.ncbi.nlm.nih.gov/29795279" }, { "database": "PubMed", "id": "29796120", "url": "https://pubmed.ncbi.nlm.nih.gov/29796120" }, { "database": "PubMed", "id": "29799481", "url": "https://pubmed.ncbi.nlm.nih.gov/29799481" }, { "database": "PubMed", "id": "29799846", "url": "https://pubmed.ncbi.nlm.nih.gov/29799846" }, { "database": "PubMed", "id": "29805559", "url": "https://pubmed.ncbi.nlm.nih.gov/29805559" }, { "database": "PubMed", "id": "29808317", "url": "https://pubmed.ncbi.nlm.nih.gov/29808317" }, { "database": "PubMed", "id": "29843216", "url": "https://pubmed.ncbi.nlm.nih.gov/29843216" }, { "database": "PubMed", "id": "29845225", "url": "https://pubmed.ncbi.nlm.nih.gov/29845225" }, { "database": "PubMed", "id": "29845289", "url": "https://pubmed.ncbi.nlm.nih.gov/29845289" }, { "database": "PubMed", "id": "29851245", "url": "https://pubmed.ncbi.nlm.nih.gov/29851245" }, { "database": "PubMed", "id": "29861842", "url": "https://pubmed.ncbi.nlm.nih.gov/29861842" }, { "database": "PubMed", "id": "29867200", "url": "https://pubmed.ncbi.nlm.nih.gov/29867200" }, { "database": "PubMed", "id": "29872222", "url": "https://pubmed.ncbi.nlm.nih.gov/29872222" }, { "database": "PubMed", "id": "29882124", "url": "https://pubmed.ncbi.nlm.nih.gov/29882124" }, { "database": "PubMed", "id": "29883748", "url": "https://pubmed.ncbi.nlm.nih.gov/29883748" }, { "database": "PubMed", "id": "29899706", "url": "https://pubmed.ncbi.nlm.nih.gov/29899706" }, { "database": "PubMed", "id": "29908183", "url": "https://pubmed.ncbi.nlm.nih.gov/29908183" }, { "database": "PubMed", "id": "29921293", "url": "https://pubmed.ncbi.nlm.nih.gov/29921293" }, { "database": "PubMed", "id": "29922071", "url": "https://pubmed.ncbi.nlm.nih.gov/29922071" }, { "database": "PubMed", "id": "29928344", "url": "https://pubmed.ncbi.nlm.nih.gov/29928344" }, { "database": "PubMed", "id": "29930759", "url": "https://pubmed.ncbi.nlm.nih.gov/29930759" }, { "database": "PubMed", "id": "29930760", "url": "https://pubmed.ncbi.nlm.nih.gov/29930760" }, { "database": "PubMed", "id": "29932504", "url": "https://pubmed.ncbi.nlm.nih.gov/29932504" }, { "database": "PubMed", "id": "29934505", "url": "https://pubmed.ncbi.nlm.nih.gov/29934505" }, { "database": "PubMed", "id": "29937924", "url": "https://pubmed.ncbi.nlm.nih.gov/29937924" }, { "database": "PubMed", "id": "29941886", "url": "https://pubmed.ncbi.nlm.nih.gov/29941886" }, { "database": "PubMed", "id": "29947926", "url": "https://pubmed.ncbi.nlm.nih.gov/29947926" }, { "database": "PubMed", "id": "29955247", "url": "https://pubmed.ncbi.nlm.nih.gov/29955247" }, { "database": "PubMed", "id": "29956797", "url": "https://pubmed.ncbi.nlm.nih.gov/29956797" }, { "database": "PubMed", "id": "29956803", "url": "https://pubmed.ncbi.nlm.nih.gov/29956803" }, { "database": "PubMed", "id": "29970878", "url": "https://pubmed.ncbi.nlm.nih.gov/29970878" }, { "database": "PubMed", "id": "29973325", "url": "https://pubmed.ncbi.nlm.nih.gov/29973325" }, { "database": "PubMed", "id": "29973512", "url": "https://pubmed.ncbi.nlm.nih.gov/29973512" }, { "database": "PubMed", "id": "29973668", "url": "https://pubmed.ncbi.nlm.nih.gov/29973668" }, { "database": "PubMed", "id": "29980193", "url": "https://pubmed.ncbi.nlm.nih.gov/29980193" }, { "database": "PubMed", "id": "29985963", "url": "https://pubmed.ncbi.nlm.nih.gov/29985963" }, { "database": "PubMed", "id": "29988358", "url": "https://pubmed.ncbi.nlm.nih.gov/29988358" }, { "database": "PubMed", "id": "29992318", "url": "https://pubmed.ncbi.nlm.nih.gov/29992318" }, { "database": "PubMed", "id": "29992949", "url": "https://pubmed.ncbi.nlm.nih.gov/29992949" }, { "database": "PubMed", "id": "30003065", "url": "https://pubmed.ncbi.nlm.nih.gov/30003065" }, { "database": "PubMed", "id": "30012111", "url": "https://pubmed.ncbi.nlm.nih.gov/30012111" }, { "database": "PubMed", "id": "30015159", "url": "https://pubmed.ncbi.nlm.nih.gov/30015159" }, { "database": "PubMed", "id": "30021163", "url": "https://pubmed.ncbi.nlm.nih.gov/30021163" }, { "database": "PubMed", "id": "30021848", "url": "https://pubmed.ncbi.nlm.nih.gov/30021848" }, { "database": "PubMed", "id": "30034631", "url": "https://pubmed.ncbi.nlm.nih.gov/30034631" }, { "database": "PubMed", "id": "30048489", "url": "https://pubmed.ncbi.nlm.nih.gov/30048489" }, { "database": "PubMed", "id": "30053873", "url": "https://pubmed.ncbi.nlm.nih.gov/30053873" }, { "database": "PubMed", "id": "30057674", "url": "https://pubmed.ncbi.nlm.nih.gov/30057674" }, { "database": "PubMed", "id": "30063851", "url": "https://pubmed.ncbi.nlm.nih.gov/30063851" }, { "database": "PubMed", "id": "30089483", "url": "https://pubmed.ncbi.nlm.nih.gov/30089483" }, { "database": "PubMed", "id": "30092222", "url": "https://pubmed.ncbi.nlm.nih.gov/30092222" }, { "database": "PubMed", "id": "30097593", "url": "https://pubmed.ncbi.nlm.nih.gov/30097593" }, { "database": "PubMed", "id": "30098579", "url": "https://pubmed.ncbi.nlm.nih.gov/30098579" }, { "database": "PubMed", "id": "30106121", "url": "https://pubmed.ncbi.nlm.nih.gov/30106121" }, { "database": "PubMed", "id": "30107094", "url": "https://pubmed.ncbi.nlm.nih.gov/30107094" }, { "database": "PubMed", "id": "30112032", "url": "https://pubmed.ncbi.nlm.nih.gov/30112032" }, { "database": "PubMed", "id": "30117681", "url": "https://pubmed.ncbi.nlm.nih.gov/30117681" }, { "database": "PubMed", "id": "30118842", "url": "https://pubmed.ncbi.nlm.nih.gov/30118842" }, { "database": "PubMed", "id": "30123074", "url": "https://pubmed.ncbi.nlm.nih.gov/30123074" }, { "database": "PubMed", "id": "30128000", "url": "https://pubmed.ncbi.nlm.nih.gov/30128000" }, { "database": "PubMed", "id": "30131483", "url": "https://pubmed.ncbi.nlm.nih.gov/30131483" }, { "database": "PubMed", "id": "30138337", "url": "https://pubmed.ncbi.nlm.nih.gov/30138337" }, { "database": "PubMed", "id": "30148873", "url": "https://pubmed.ncbi.nlm.nih.gov/30148873" }, { "database": "PubMed", "id": "30148884", "url": "https://pubmed.ncbi.nlm.nih.gov/30148884" }, { "database": "PubMed", "id": "30154433", "url": "https://pubmed.ncbi.nlm.nih.gov/30154433" }, { "database": "PubMed", "id": "30154548", "url": "https://pubmed.ncbi.nlm.nih.gov/30154548" }, { "database": "PubMed", "id": "30181250", "url": "https://pubmed.ncbi.nlm.nih.gov/30181250" }, { "database": "PubMed", "id": "30195794", "url": "https://pubmed.ncbi.nlm.nih.gov/30195794" }, { "database": "PubMed", "id": "30205513", "url": "https://pubmed.ncbi.nlm.nih.gov/30205513" }, { "database": "PubMed", "id": "30206294", "url": "https://pubmed.ncbi.nlm.nih.gov/30206294" }, { "database": "PubMed", "id": "30208604", "url": "https://pubmed.ncbi.nlm.nih.gov/30208604" }, { "database": "PubMed", "id": "30213826", "url": "https://pubmed.ncbi.nlm.nih.gov/30213826" }, { "database": "PubMed", "id": "30226594", "url": "https://pubmed.ncbi.nlm.nih.gov/30226594" }, { "database": "PubMed", "id": "30230030", "url": "https://pubmed.ncbi.nlm.nih.gov/30230030" }, { "database": "PubMed", "id": "30242159", "url": "https://pubmed.ncbi.nlm.nih.gov/30242159" }, { "database": "PubMed", "id": "30245957", "url": "https://pubmed.ncbi.nlm.nih.gov/30245957" }, { "database": "PubMed", "id": "30249058", "url": "https://pubmed.ncbi.nlm.nih.gov/30249058" }, { "database": "PubMed", "id": "30250490", "url": "https://pubmed.ncbi.nlm.nih.gov/30250490" }, { "database": "PubMed", "id": "30258898", "url": "https://pubmed.ncbi.nlm.nih.gov/30258898" }, { "database": "PubMed", "id": "30258945", "url": "https://pubmed.ncbi.nlm.nih.gov/30258945" }, { "database": "PubMed", "id": "30266989", "url": "https://pubmed.ncbi.nlm.nih.gov/30266989" }, { "database": "PubMed", "id": "30268125", "url": "https://pubmed.ncbi.nlm.nih.gov/30268125" }, { "database": "PubMed", "id": "30271951", "url": "https://pubmed.ncbi.nlm.nih.gov/30271951" }, { "database": "PubMed", "id": "30272389", "url": "https://pubmed.ncbi.nlm.nih.gov/30272389" }, { "database": "PubMed", "id": "30274346", "url": "https://pubmed.ncbi.nlm.nih.gov/30274346" }, { "database": "PubMed", "id": "30282964", "url": "https://pubmed.ncbi.nlm.nih.gov/30282964" }, { "database": "PubMed", "id": "30285764", "url": "https://pubmed.ncbi.nlm.nih.gov/30285764" }, { "database": "PubMed", "id": "30305055", "url": "https://pubmed.ncbi.nlm.nih.gov/30305055" }, { "database": "PubMed", "id": "30316146", "url": "https://pubmed.ncbi.nlm.nih.gov/30316146" }, { "database": "PubMed", "id": "30318853", "url": "https://pubmed.ncbi.nlm.nih.gov/30318853" }, { "database": "PubMed", "id": "30337563", "url": "https://pubmed.ncbi.nlm.nih.gov/30337563" }, { "database": "PubMed", "id": "30337688", "url": "https://pubmed.ncbi.nlm.nih.gov/30337688" }, { "database": "PubMed", "id": "30343126", "url": "https://pubmed.ncbi.nlm.nih.gov/30343126" }, { "database": "PubMed", "id": "30353642", "url": "https://pubmed.ncbi.nlm.nih.gov/30353642" }, { "database": "PubMed", "id": "30353649", "url": "https://pubmed.ncbi.nlm.nih.gov/30353649" }, { "database": "PubMed", "id": "30357520", "url": "https://pubmed.ncbi.nlm.nih.gov/30357520" }, { "database": "PubMed", "id": "30359321", "url": "https://pubmed.ncbi.nlm.nih.gov/30359321" }, { "database": "PubMed", "id": "30363990", "url": "https://pubmed.ncbi.nlm.nih.gov/30363990" }, { "database": "PubMed", "id": "30367624", "url": "https://pubmed.ncbi.nlm.nih.gov/30367624" }, { "database": "PubMed", "id": "30374127", "url": "https://pubmed.ncbi.nlm.nih.gov/30374127" }, { "database": "PubMed", "id": "30377337", "url": "https://pubmed.ncbi.nlm.nih.gov/30377337" }, { "database": "PubMed", "id": "30385871", "url": "https://pubmed.ncbi.nlm.nih.gov/30385871" }, { "database": "PubMed", "id": "30397120", "url": "https://pubmed.ncbi.nlm.nih.gov/30397120" }, { "database": "PubMed", "id": "30405592", "url": "https://pubmed.ncbi.nlm.nih.gov/30405592" }, { "database": "PubMed", "id": "30410328", "url": "https://pubmed.ncbi.nlm.nih.gov/30410328" }, { "database": "PubMed", "id": "30413706", "url": "https://pubmed.ncbi.nlm.nih.gov/30413706" }, { "database": "PubMed", "id": "30413753", "url": "https://pubmed.ncbi.nlm.nih.gov/30413753" }, { "database": "PubMed", "id": "30428057", "url": "https://pubmed.ncbi.nlm.nih.gov/30428057" }, { "database": "PubMed", "id": "30429793", "url": "https://pubmed.ncbi.nlm.nih.gov/30429793" }, { "database": "PubMed", "id": "30455992", "url": "https://pubmed.ncbi.nlm.nih.gov/30455992" }, { "database": "PubMed", "id": "30456390", "url": "https://pubmed.ncbi.nlm.nih.gov/30456390" }, { "database": "PubMed", "id": "30461193", "url": "https://pubmed.ncbi.nlm.nih.gov/30461193" }, { "database": "PubMed", "id": "30464511", "url": "https://pubmed.ncbi.nlm.nih.gov/30464511" }, { "database": "PubMed", "id": "30470263", "url": "https://pubmed.ncbi.nlm.nih.gov/30470263" }, { "database": "PubMed", "id": "30478302", "url": "https://pubmed.ncbi.nlm.nih.gov/30478302" }, { "database": "PubMed", "id": "30488766", "url": "https://pubmed.ncbi.nlm.nih.gov/30488766" }, { "database": "PubMed", "id": "30500680", "url": "https://pubmed.ncbi.nlm.nih.gov/30500680" }, { "database": "PubMed", "id": "30510622", "url": "https://pubmed.ncbi.nlm.nih.gov/30510622" }, { "database": "PubMed", "id": "30510777", "url": "https://pubmed.ncbi.nlm.nih.gov/30510777" }, { "database": "PubMed", "id": "30513611", "url": "https://pubmed.ncbi.nlm.nih.gov/30513611" }, { "database": "PubMed", "id": "30534418", "url": "https://pubmed.ncbi.nlm.nih.gov/30534418" }, { "database": "PubMed", "id": "30545129", "url": "https://pubmed.ncbi.nlm.nih.gov/30545129" }, { "database": "PubMed", "id": "30546425", "url": "https://pubmed.ncbi.nlm.nih.gov/30546425" }, { "database": "PubMed", "id": "30563079", "url": "https://pubmed.ncbi.nlm.nih.gov/30563079" }, { "database": "PubMed", "id": "30564555", "url": "https://pubmed.ncbi.nlm.nih.gov/30564555" }, { "database": "PubMed", "id": "30571167", "url": "https://pubmed.ncbi.nlm.nih.gov/30571167" }, { "database": "PubMed", "id": "30575721", "url": "https://pubmed.ncbi.nlm.nih.gov/30575721" }, { "database": "PubMed", "id": "30584254", "url": "https://pubmed.ncbi.nlm.nih.gov/30584254" }, { "database": "PubMed", "id": "30602778", "url": "https://pubmed.ncbi.nlm.nih.gov/30602778" }, { "database": "PubMed", "id": "30618098", "url": "https://pubmed.ncbi.nlm.nih.gov/30618098" }, { "database": "PubMed", "id": "30619121", "url": "https://pubmed.ncbi.nlm.nih.gov/30619121" }, { "database": "PubMed", "id": "30621146", "url": "https://pubmed.ncbi.nlm.nih.gov/30621146" }, { "database": "PubMed", "id": "30622543", "url": "https://pubmed.ncbi.nlm.nih.gov/30622543" }, { "database": "PubMed", "id": "30622697", "url": "https://pubmed.ncbi.nlm.nih.gov/30622697" }, { "database": "PubMed", "id": "30643008", "url": "https://pubmed.ncbi.nlm.nih.gov/30643008" }, { "database": "PubMed", "id": "30654190", "url": "https://pubmed.ncbi.nlm.nih.gov/30654190" }, { "database": "PubMed", "id": "30666838", "url": "https://pubmed.ncbi.nlm.nih.gov/30666838" }, { "database": "PubMed", "id": "30669455", "url": "https://pubmed.ncbi.nlm.nih.gov/30669455" }, { "database": "PubMed", "id": "30683932", "url": "https://pubmed.ncbi.nlm.nih.gov/30683932" }, { "database": "PubMed", "id": "30692626", "url": "https://pubmed.ncbi.nlm.nih.gov/30692626" }, { "database": "PubMed", "id": "30693913", "url": "https://pubmed.ncbi.nlm.nih.gov/30693913" }, { "database": "PubMed", "id": "30695053", "url": "https://pubmed.ncbi.nlm.nih.gov/30695053" }, { "database": "PubMed", "id": "30700111", "url": "https://pubmed.ncbi.nlm.nih.gov/30700111" }, { "database": "PubMed", "id": "30700740", "url": "https://pubmed.ncbi.nlm.nih.gov/30700740" }, { "database": "PubMed", "id": "30709770", "url": "https://pubmed.ncbi.nlm.nih.gov/30709770" }, { "database": "PubMed", "id": "30733856", "url": "https://pubmed.ncbi.nlm.nih.gov/30733856" }, { "database": "PubMed", "id": "30737086", "url": "https://pubmed.ncbi.nlm.nih.gov/30737086" }, { "database": "PubMed", "id": "30745576", "url": "https://pubmed.ncbi.nlm.nih.gov/30745576" }, { "database": "PubMed", "id": "30754629", "url": "https://pubmed.ncbi.nlm.nih.gov/30754629" }, { "database": "PubMed", "id": "30755508", "url": "https://pubmed.ncbi.nlm.nih.gov/30755508" }, { "database": "PubMed", "id": "30770562", "url": "https://pubmed.ncbi.nlm.nih.gov/30770562" }, { "database": "PubMed", "id": "30770776", "url": "https://pubmed.ncbi.nlm.nih.gov/30770776" }, { "database": "PubMed", "id": "30774778", "url": "https://pubmed.ncbi.nlm.nih.gov/30774778" }, { "database": "PubMed", "id": "30796242", "url": "https://pubmed.ncbi.nlm.nih.gov/30796242" }, { "database": "PubMed", "id": "30804434", "url": "https://pubmed.ncbi.nlm.nih.gov/30804434" }, { "database": "PubMed", "id": "30804795", "url": "https://pubmed.ncbi.nlm.nih.gov/30804795" }, { "database": "PubMed", "id": "30805303", "url": "https://pubmed.ncbi.nlm.nih.gov/30805303" }, { "database": "PubMed", "id": "30813295", "url": "https://pubmed.ncbi.nlm.nih.gov/30813295" }, { "database": "PubMed", "id": "30813597", "url": "https://pubmed.ncbi.nlm.nih.gov/30813597" }, { "database": "PubMed", "id": "30816192", "url": "https://pubmed.ncbi.nlm.nih.gov/30816192" }, { "database": "PubMed", "id": "30816208", "url": "https://pubmed.ncbi.nlm.nih.gov/30816208" }, { "database": "PubMed", "id": "30824683", "url": "https://pubmed.ncbi.nlm.nih.gov/30824683" }, { "database": "PubMed", "id": "30839155", "url": "https://pubmed.ncbi.nlm.nih.gov/30839155" }, { "database": "PubMed", "id": "30841855", "url": "https://pubmed.ncbi.nlm.nih.gov/30841855" }, { "database": "PubMed", "id": "30845764", "url": "https://pubmed.ncbi.nlm.nih.gov/30845764" }, { "database": "PubMed", "id": "30845932", "url": "https://pubmed.ncbi.nlm.nih.gov/30845932" }, { "database": "PubMed", "id": "30850948", "url": "https://pubmed.ncbi.nlm.nih.gov/30850948" }, { "database": "PubMed", "id": "30860936", "url": "https://pubmed.ncbi.nlm.nih.gov/30860936" }, { "database": "PubMed", "id": "30862883", "url": "https://pubmed.ncbi.nlm.nih.gov/30862883" }, { "database": "PubMed", "id": "30872638", "url": "https://pubmed.ncbi.nlm.nih.gov/30872638" }, { "database": "PubMed", "id": "30887599", "url": "https://pubmed.ncbi.nlm.nih.gov/30887599" }, { "database": "PubMed", "id": "30897948", "url": "https://pubmed.ncbi.nlm.nih.gov/30897948" }, { "database": "PubMed", "id": "30902093", "url": "https://pubmed.ncbi.nlm.nih.gov/30902093" }, { "database": "PubMed", "id": "30906373", "url": "https://pubmed.ncbi.nlm.nih.gov/30906373" }, { "database": "PubMed", "id": "30909453", "url": "https://pubmed.ncbi.nlm.nih.gov/30909453" }, { "database": "PubMed", "id": "30944027", "url": "https://pubmed.ncbi.nlm.nih.gov/30944027" }, { "database": "PubMed", "id": "30944303", "url": "https://pubmed.ncbi.nlm.nih.gov/30944303" }, { "database": "PubMed", "id": "30947381", "url": "https://pubmed.ncbi.nlm.nih.gov/30947381" }, { "database": "PubMed", "id": "30952838", "url": "https://pubmed.ncbi.nlm.nih.gov/30952838" }, { "database": "PubMed", "id": "30952843", "url": "https://pubmed.ncbi.nlm.nih.gov/30952843" }, { "database": "PubMed", "id": "30959964", "url": "https://pubmed.ncbi.nlm.nih.gov/30959964" }, { "database": "PubMed", "id": "30962488", "url": "https://pubmed.ncbi.nlm.nih.gov/30962488" }, { "database": "PubMed", "id": "30969964", "url": "https://pubmed.ncbi.nlm.nih.gov/30969964" }, { "database": "PubMed", "id": "30971932", "url": "https://pubmed.ncbi.nlm.nih.gov/30971932" }, { "database": "PubMed", "id": "30975543", "url": "https://pubmed.ncbi.nlm.nih.gov/30975543" }, { "database": "PubMed", "id": "30979953", "url": "https://pubmed.ncbi.nlm.nih.gov/30979953" }, { "database": "PubMed", "id": "30986276", "url": "https://pubmed.ncbi.nlm.nih.gov/30986276" }, { "database": "PubMed", "id": "30987128", "url": "https://pubmed.ncbi.nlm.nih.gov/30987128" }, { "database": "PubMed", "id": "30987380", "url": "https://pubmed.ncbi.nlm.nih.gov/30987380" }, { "database": "PubMed", "id": "30992506", "url": "https://pubmed.ncbi.nlm.nih.gov/30992506" }, { "database": "PubMed", "id": "31010234", "url": "https://pubmed.ncbi.nlm.nih.gov/31010234" }, { "database": "PubMed", "id": "31030489", "url": "https://pubmed.ncbi.nlm.nih.gov/31030489" }, { "database": "PubMed", "id": "31032225", "url": "https://pubmed.ncbi.nlm.nih.gov/31032225" }, { "database": "PubMed", "id": "31032363", "url": "https://pubmed.ncbi.nlm.nih.gov/31032363" }, { "database": "PubMed", "id": "31035633", "url": "https://pubmed.ncbi.nlm.nih.gov/31035633" }, { "database": "PubMed", "id": "31035650", "url": "https://pubmed.ncbi.nlm.nih.gov/31035650" }, { "database": "PubMed", "id": "31037139", "url": "https://pubmed.ncbi.nlm.nih.gov/31037139" }, { "database": "PubMed", "id": "31042473", "url": "https://pubmed.ncbi.nlm.nih.gov/31042473" }, { "database": "PubMed", "id": "31053703", "url": "https://pubmed.ncbi.nlm.nih.gov/31053703" }, { "database": "PubMed", "id": "31057403", "url": "https://pubmed.ncbi.nlm.nih.gov/31057403" }, { "database": "PubMed", "id": "31058093", "url": "https://pubmed.ncbi.nlm.nih.gov/31058093" }, { "database": "PubMed", "id": "31065010", "url": "https://pubmed.ncbi.nlm.nih.gov/31065010" }, { "database": "PubMed", "id": "31069012", "url": "https://pubmed.ncbi.nlm.nih.gov/31069012" }, { "database": "PubMed", "id": "31092879", "url": "https://pubmed.ncbi.nlm.nih.gov/31092879" }, { "database": "PubMed", "id": "31106005", "url": "https://pubmed.ncbi.nlm.nih.gov/31106005" }, { "database": "PubMed", "id": "31114228", "url": "https://pubmed.ncbi.nlm.nih.gov/31114228" }, { "database": "PubMed", "id": "31118667", "url": "https://pubmed.ncbi.nlm.nih.gov/31118667" }, { "database": "PubMed", "id": "31119047", "url": "https://pubmed.ncbi.nlm.nih.gov/31119047" }, { "database": "PubMed", "id": "31119584", "url": "https://pubmed.ncbi.nlm.nih.gov/31119584" }, { "database": "PubMed", "id": "31122311", "url": "https://pubmed.ncbi.nlm.nih.gov/31122311" }, { "database": "PubMed", "id": "31139021", "url": "https://pubmed.ncbi.nlm.nih.gov/31139021" }, { "database": "PubMed", "id": "31143097", "url": "https://pubmed.ncbi.nlm.nih.gov/31143097" }, { "database": "PubMed", "id": "31150511", "url": "https://pubmed.ncbi.nlm.nih.gov/31150511" }, { "database": "PubMed", "id": "31157169", "url": "https://pubmed.ncbi.nlm.nih.gov/31157169" }, { "database": "PubMed", "id": "31160483", "url": "https://pubmed.ncbi.nlm.nih.gov/31160483" }, { "database": "PubMed", "id": "31183073", "url": "https://pubmed.ncbi.nlm.nih.gov/31183073" }, { "database": "PubMed", "id": "31186741", "url": "https://pubmed.ncbi.nlm.nih.gov/31186741" }, { "database": "PubMed", "id": "31195734", "url": "https://pubmed.ncbi.nlm.nih.gov/31195734" }, { "database": "PubMed", "id": "31197106", "url": "https://pubmed.ncbi.nlm.nih.gov/31197106" }, { "database": "PubMed", "id": "31199048", "url": "https://pubmed.ncbi.nlm.nih.gov/31199048" }, { "database": "PubMed", "id": "31227006", "url": "https://pubmed.ncbi.nlm.nih.gov/31227006" }, { "database": "PubMed", "id": "31247000", "url": "https://pubmed.ncbi.nlm.nih.gov/31247000" }, { "database": "PubMed", "id": "31263479", "url": "https://pubmed.ncbi.nlm.nih.gov/31263479" }, { "database": "PubMed", "id": "31276504", "url": "https://pubmed.ncbi.nlm.nih.gov/31276504" }, { "database": "PubMed", "id": "31281490", "url": "https://pubmed.ncbi.nlm.nih.gov/31281490" }, { "database": "PubMed", "id": "31284427", "url": "https://pubmed.ncbi.nlm.nih.gov/31284427" }, { "database": "PubMed", "id": "31288897", "url": "https://pubmed.ncbi.nlm.nih.gov/31288897" }, { "database": "PubMed", "id": "31290289", "url": "https://pubmed.ncbi.nlm.nih.gov/31290289" }, { "database": "PubMed", "id": "31319869", "url": "https://pubmed.ncbi.nlm.nih.gov/31319869" }, { "database": "PubMed", "id": "31333726", "url": "https://pubmed.ncbi.nlm.nih.gov/31333726" }, { "database": "PubMed", "id": "31337843", "url": "https://pubmed.ncbi.nlm.nih.gov/31337843" }, { "database": "PubMed", "id": "31345230", "url": "https://pubmed.ncbi.nlm.nih.gov/31345230" }, { "database": "PubMed", "id": "31360736", "url": "https://pubmed.ncbi.nlm.nih.gov/31360736" }, { "database": "PubMed", "id": "31383875", "url": "https://pubmed.ncbi.nlm.nih.gov/31383875" }, { "database": "PubMed", "id": "31393061", "url": "https://pubmed.ncbi.nlm.nih.gov/31393061" }, { "database": "PubMed", "id": "31409554", "url": "https://pubmed.ncbi.nlm.nih.gov/31409554" }, { "database": "PubMed", "id": "31420605", "url": "https://pubmed.ncbi.nlm.nih.gov/31420605" }, { "database": "PubMed", "id": "31428587", "url": "https://pubmed.ncbi.nlm.nih.gov/31428587" }, { "database": "PubMed", "id": "31431660", "url": "https://pubmed.ncbi.nlm.nih.gov/31431660" }, { "database": "PubMed", "id": "31464372", "url": "https://pubmed.ncbi.nlm.nih.gov/31464372" }, { "database": "PubMed", "id": "31480645", "url": "https://pubmed.ncbi.nlm.nih.gov/31480645" }, { "database": "PubMed", "id": "31482977", "url": "https://pubmed.ncbi.nlm.nih.gov/31482977" }, { "database": "PubMed", "id": "31496729", "url": "https://pubmed.ncbi.nlm.nih.gov/31496729" }, { "database": "PubMed", "id": "31500366", "url": "https://pubmed.ncbi.nlm.nih.gov/31500366" }, { "database": "PubMed", "id": "31509054", "url": "https://pubmed.ncbi.nlm.nih.gov/31509054" }, { "database": "PubMed", "id": "31510045", "url": "https://pubmed.ncbi.nlm.nih.gov/31510045" }, { "database": "PubMed", "id": "31519182", "url": "https://pubmed.ncbi.nlm.nih.gov/31519182" }, { "database": "PubMed", "id": "31523184", "url": "https://pubmed.ncbi.nlm.nih.gov/31523184" }, { "database": "PubMed", "id": "31527082", "url": "https://pubmed.ncbi.nlm.nih.gov/31527082" }, { "database": "PubMed", "id": "31527632", "url": "https://pubmed.ncbi.nlm.nih.gov/31527632" }, { "database": "PubMed", "id": "31540244", "url": "https://pubmed.ncbi.nlm.nih.gov/31540244" }, { "database": "PubMed", "id": "31547231", "url": "https://pubmed.ncbi.nlm.nih.gov/31547231" }, { "database": "PubMed", "id": "31549311", "url": "https://pubmed.ncbi.nlm.nih.gov/31549311" }, { "database": "PubMed", "id": "31551414", "url": "https://pubmed.ncbi.nlm.nih.gov/31551414" }, { "database": "PubMed", "id": "31571328", "url": "https://pubmed.ncbi.nlm.nih.gov/31571328" }, { "database": "PubMed", "id": "31571914", "url": "https://pubmed.ncbi.nlm.nih.gov/31571914" }, { "database": "PubMed", "id": "31572671", "url": "https://pubmed.ncbi.nlm.nih.gov/31572671" }, { "database": "PubMed", "id": "31579406", "url": "https://pubmed.ncbi.nlm.nih.gov/31579406" }, { "database": "PubMed", "id": "31583053", "url": "https://pubmed.ncbi.nlm.nih.gov/31583053" }, { "database": "PubMed", "id": "31584065", "url": "https://pubmed.ncbi.nlm.nih.gov/31584065" }, { "database": "PubMed", "id": "31591437", "url": "https://pubmed.ncbi.nlm.nih.gov/31591437" }, { "database": "PubMed", "id": "31592121", "url": "https://pubmed.ncbi.nlm.nih.gov/31592121" }, { "database": "PubMed", "id": "31597121", "url": "https://pubmed.ncbi.nlm.nih.gov/31597121" }, { "database": "PubMed", "id": "31605257", "url": "https://pubmed.ncbi.nlm.nih.gov/31605257" }, { "database": "PubMed", "id": "31607750", "url": "https://pubmed.ncbi.nlm.nih.gov/31607750" }, { "database": "PubMed", "id": "31614723", "url": "https://pubmed.ncbi.nlm.nih.gov/31614723" }, { "database": "PubMed", "id": "31629677", "url": "https://pubmed.ncbi.nlm.nih.gov/31629677" }, { "database": "PubMed", "id": "31632477", "url": "https://pubmed.ncbi.nlm.nih.gov/31632477" }, { "database": "PubMed", "id": "31635212", "url": "https://pubmed.ncbi.nlm.nih.gov/31635212" }, { "database": "PubMed", "id": "31649511", "url": "https://pubmed.ncbi.nlm.nih.gov/31649511" }, { "database": "PubMed", "id": "31653015", "url": "https://pubmed.ncbi.nlm.nih.gov/31653015" }, { "database": "PubMed", "id": "31657882", "url": "https://pubmed.ncbi.nlm.nih.gov/31657882" }, { "database": "PubMed", "id": "31661137", "url": "https://pubmed.ncbi.nlm.nih.gov/31661137" }, { "database": "PubMed", "id": "31665911", "url": "https://pubmed.ncbi.nlm.nih.gov/31665911" }, { "database": "PubMed", "id": "31679138", "url": "https://pubmed.ncbi.nlm.nih.gov/31679138" }, { "database": "PubMed", "id": "31680960", "url": "https://pubmed.ncbi.nlm.nih.gov/31680960" }, { "database": "PubMed", "id": "31680961", "url": "https://pubmed.ncbi.nlm.nih.gov/31680961" }, { "database": "PubMed", "id": "31686763", "url": "https://pubmed.ncbi.nlm.nih.gov/31686763" }, { "database": "PubMed", "id": "31686909", "url": "https://pubmed.ncbi.nlm.nih.gov/31686909" }, { "database": "PubMed", "id": "31708904", "url": "https://pubmed.ncbi.nlm.nih.gov/31708904" }, { "database": "PubMed", "id": "31710966", "url": "https://pubmed.ncbi.nlm.nih.gov/31710966" }, { "database": "PubMed", "id": "31723205", "url": "https://pubmed.ncbi.nlm.nih.gov/31723205" }, { "database": "PubMed", "id": "31725811", "url": "https://pubmed.ncbi.nlm.nih.gov/31725811" }, { "database": "PubMed", "id": "31728130", "url": "https://pubmed.ncbi.nlm.nih.gov/31728130" }, { "database": "PubMed", "id": "31729456", "url": "https://pubmed.ncbi.nlm.nih.gov/31729456" }, { "database": "PubMed", "id": "31740700", "url": "https://pubmed.ncbi.nlm.nih.gov/31740700" }, { "database": "PubMed", "id": "31740942", "url": "https://pubmed.ncbi.nlm.nih.gov/31740942" }, { "database": "PubMed", "id": "31762815", "url": "https://pubmed.ncbi.nlm.nih.gov/31762815" }, { "database": "PubMed", "id": "31772226", "url": "https://pubmed.ncbi.nlm.nih.gov/31772226" }, { "database": "PubMed", "id": "31780930", "url": "https://pubmed.ncbi.nlm.nih.gov/31780930" }, { "database": "PubMed", "id": "31787905", "url": "https://pubmed.ncbi.nlm.nih.gov/31787905" }, { "database": "PubMed", "id": "31790465", "url": "https://pubmed.ncbi.nlm.nih.gov/31790465" }, { "database": "PubMed", "id": "31795454", "url": "https://pubmed.ncbi.nlm.nih.gov/31795454" }, { "database": "PubMed", "id": "31827405", "url": "https://pubmed.ncbi.nlm.nih.gov/31827405" }, { "database": "PubMed", "id": "31834925", "url": "https://pubmed.ncbi.nlm.nih.gov/31834925" }, { "database": "PubMed", "id": "31835877", "url": "https://pubmed.ncbi.nlm.nih.gov/31835877" }, { "database": "PubMed", "id": "31844089", "url": "https://pubmed.ncbi.nlm.nih.gov/31844089" }, { "database": "PubMed", "id": "31852504", "url": "https://pubmed.ncbi.nlm.nih.gov/31852504" }, { "database": "PubMed", "id": "31852899", "url": "https://pubmed.ncbi.nlm.nih.gov/31852899" }, { "database": "PubMed", "id": "31857650", "url": "https://pubmed.ncbi.nlm.nih.gov/31857650" }, { "database": "PubMed", "id": "31861050", "url": "https://pubmed.ncbi.nlm.nih.gov/31861050" }, { "database": "PubMed", "id": "31862959", "url": "https://pubmed.ncbi.nlm.nih.gov/31862959" }, { "database": "PubMed", "id": "31870092", "url": "https://pubmed.ncbi.nlm.nih.gov/31870092" }, { "database": "PubMed", "id": "31871542", "url": "https://pubmed.ncbi.nlm.nih.gov/31871542" }, { "database": "PubMed", "id": "31883527", "url": "https://pubmed.ncbi.nlm.nih.gov/31883527" }, { "database": "PubMed", "id": "31885701", "url": "https://pubmed.ncbi.nlm.nih.gov/31885701" }, { "database": "PubMed", "id": "31889900", "url": "https://pubmed.ncbi.nlm.nih.gov/31889900" }, { "database": "PubMed", "id": "31893310", "url": "https://pubmed.ncbi.nlm.nih.gov/31893310" }, { "database": "PubMed", "id": "31897228", "url": "https://pubmed.ncbi.nlm.nih.gov/31897228" }, { "database": "PubMed", "id": "31900384", "url": "https://pubmed.ncbi.nlm.nih.gov/31900384" }, { "database": "PubMed", "id": "31910234", "url": "https://pubmed.ncbi.nlm.nih.gov/31910234" }, { "database": "PubMed", "id": "31915509", "url": "https://pubmed.ncbi.nlm.nih.gov/31915509" }, { "database": "PubMed", "id": "31919413", "url": "https://pubmed.ncbi.nlm.nih.gov/31919413" }, { "database": "PubMed", "id": "31922234", "url": "https://pubmed.ncbi.nlm.nih.gov/31922234" }, { "database": "PubMed", "id": "31931846", "url": "https://pubmed.ncbi.nlm.nih.gov/31931846" }, { "database": "PubMed", "id": "31932581", "url": "https://pubmed.ncbi.nlm.nih.gov/31932581" }, { "database": "PubMed", "id": "31936857", "url": "https://pubmed.ncbi.nlm.nih.gov/31936857" }, { "database": "PubMed", "id": "31941116", "url": "https://pubmed.ncbi.nlm.nih.gov/31941116" }, { "database": "PubMed", "id": "31957155", "url": "https://pubmed.ncbi.nlm.nih.gov/31957155" }, { "database": "PubMed", "id": "31957179", "url": "https://pubmed.ncbi.nlm.nih.gov/31957179" }, { "database": "PubMed", "id": "31957323", "url": "https://pubmed.ncbi.nlm.nih.gov/31957323" }, { "database": "PubMed", "id": "31988347", "url": "https://pubmed.ncbi.nlm.nih.gov/31988347" }, { "database": "PubMed", "id": "32005797", "url": "https://pubmed.ncbi.nlm.nih.gov/32005797" }, { "database": "PubMed", "id": "32010815", "url": "https://pubmed.ncbi.nlm.nih.gov/32010815" }, { "database": "PubMed", "id": "32012648", "url": "https://pubmed.ncbi.nlm.nih.gov/32012648" }, { "database": "PubMed", "id": "32021440", "url": "https://pubmed.ncbi.nlm.nih.gov/32021440" }, { "database": "PubMed", "id": "32075106", "url": "https://pubmed.ncbi.nlm.nih.gov/32075106" }, { "database": "PubMed", "id": "32081857", "url": "https://pubmed.ncbi.nlm.nih.gov/32081857" }, { "database": "PubMed", "id": "32101017", "url": "https://pubmed.ncbi.nlm.nih.gov/32101017" }, { "database": "PubMed", "id": "32116552", "url": "https://pubmed.ncbi.nlm.nih.gov/32116552" }, { "database": "PubMed", "id": "32117763", "url": "https://pubmed.ncbi.nlm.nih.gov/32117763" }, { "database": "PubMed", "id": "32140390", "url": "https://pubmed.ncbi.nlm.nih.gov/32140390" }, { "database": "PubMed", "id": "32152268", "url": "https://pubmed.ncbi.nlm.nih.gov/32152268" }, { "database": "PubMed", "id": "32152504", "url": "https://pubmed.ncbi.nlm.nih.gov/32152504" }, { "database": "PubMed", "id": "32174768", "url": "https://pubmed.ncbi.nlm.nih.gov/32174768" }, { "database": "PubMed", "id": "32176823", "url": "https://pubmed.ncbi.nlm.nih.gov/32176823" }, { "database": "PubMed", "id": "32194726", "url": "https://pubmed.ncbi.nlm.nih.gov/32194726" }, { "database": "PubMed", "id": "32265715", "url": "https://pubmed.ncbi.nlm.nih.gov/32265715" }, { "database": "PubMed", "id": "32276265", "url": "https://pubmed.ncbi.nlm.nih.gov/32276265" }, { "database": "PubMed", "id": "32286266", "url": "https://pubmed.ncbi.nlm.nih.gov/32286266" }, { "database": "PubMed", "id": "32290365", "url": "https://pubmed.ncbi.nlm.nih.gov/32290365" }, { "database": "PubMed", "id": "32316166", "url": "https://pubmed.ncbi.nlm.nih.gov/32316166" }, { "database": "PubMed", "id": "32323830", "url": "https://pubmed.ncbi.nlm.nih.gov/32323830" }, { "database": "PubMed", "id": "32340328", "url": "https://pubmed.ncbi.nlm.nih.gov/32340328" }, { "database": "PubMed", "id": "32341333", "url": "https://pubmed.ncbi.nlm.nih.gov/32341333" }, { "database": "PubMed", "id": "32347294", "url": "https://pubmed.ncbi.nlm.nih.gov/32347294" }, { "database": "PubMed", "id": "32347651", "url": "https://pubmed.ncbi.nlm.nih.gov/32347651" }, { "database": "PubMed", "id": "32350708", "url": "https://pubmed.ncbi.nlm.nih.gov/32350708" }, { "database": "PubMed", "id": "32363163", "url": "https://pubmed.ncbi.nlm.nih.gov/32363163" }, { "database": "PubMed", "id": "32365859", "url": "https://pubmed.ncbi.nlm.nih.gov/32365859" }, { "database": "PubMed", "id": "32371982", "url": "https://pubmed.ncbi.nlm.nih.gov/32371982" }, { "database": "PubMed", "id": "32374759", "url": "https://pubmed.ncbi.nlm.nih.gov/32374759" }, { "database": "PubMed", "id": "32375544", "url": "https://pubmed.ncbi.nlm.nih.gov/32375544" }, { "database": "PubMed", "id": "32375768", "url": "https://pubmed.ncbi.nlm.nih.gov/32375768" }, { "database": "PubMed", "id": "32385243", "url": "https://pubmed.ncbi.nlm.nih.gov/32385243" }, { "database": "PubMed", "id": "32398948", "url": "https://pubmed.ncbi.nlm.nih.gov/32398948" }, { "database": "PubMed", "id": "32410646", "url": "https://pubmed.ncbi.nlm.nih.gov/32410646" }, { "database": "PubMed", "id": "32414345", "url": "https://pubmed.ncbi.nlm.nih.gov/32414345" }, { "database": "PubMed", "id": "32421688", "url": "https://pubmed.ncbi.nlm.nih.gov/32421688" }, { "database": "PubMed", "id": "32432052", "url": "https://pubmed.ncbi.nlm.nih.gov/32432052" }, { "database": "PubMed", "id": "32437392", "url": "https://pubmed.ncbi.nlm.nih.gov/32437392" }, { "database": "PubMed", "id": "32439931", "url": "https://pubmed.ncbi.nlm.nih.gov/32439931" }, { "database": "PubMed", "id": "32440143", "url": "https://pubmed.ncbi.nlm.nih.gov/32440143" }, { "database": "PubMed", "id": "32442683", "url": "https://pubmed.ncbi.nlm.nih.gov/32442683" }, { "database": "PubMed", "id": "32463592", "url": "https://pubmed.ncbi.nlm.nih.gov/32463592" }, { "database": "PubMed", "id": "32466169", "url": "https://pubmed.ncbi.nlm.nih.gov/32466169" }, { "database": "PubMed", "id": "32471246", "url": "https://pubmed.ncbi.nlm.nih.gov/32471246" }, { "database": "PubMed", "id": "32499871", "url": "https://pubmed.ncbi.nlm.nih.gov/32499871" }, { "database": "PubMed", "id": "32516328", "url": "https://pubmed.ncbi.nlm.nih.gov/32516328" }, { "database": "PubMed", "id": "32530390", "url": "https://pubmed.ncbi.nlm.nih.gov/32530390" }, { "database": "PubMed", "id": "32541784", "url": "https://pubmed.ncbi.nlm.nih.gov/32541784" }, { "database": "PubMed", "id": "32547096", "url": "https://pubmed.ncbi.nlm.nih.gov/32547096" }, { "database": "PubMed", "id": "32547392", "url": "https://pubmed.ncbi.nlm.nih.gov/32547392" }, { "database": "PubMed", "id": "32554303", "url": "https://pubmed.ncbi.nlm.nih.gov/32554303" }, { "database": "PubMed", "id": "32555194", "url": "https://pubmed.ncbi.nlm.nih.gov/32555194" }, { "database": "PubMed", "id": "32560319", "url": "https://pubmed.ncbi.nlm.nih.gov/32560319" }, { "database": "PubMed", "id": "32576196", "url": "https://pubmed.ncbi.nlm.nih.gov/32576196" }, { "database": "PubMed", "id": "32579864", "url": "https://pubmed.ncbi.nlm.nih.gov/32579864" }, { "database": "PubMed", "id": "32587773", "url": "https://pubmed.ncbi.nlm.nih.gov/32587773" }, { "database": "PubMed", "id": "32610557", "url": "https://pubmed.ncbi.nlm.nih.gov/32610557" }, { "database": "PubMed", "id": "32627020", "url": "https://pubmed.ncbi.nlm.nih.gov/32627020" }, { "database": "PubMed", "id": "32627831", "url": "https://pubmed.ncbi.nlm.nih.gov/32627831" }, { "database": "PubMed", "id": "32635337", "url": "https://pubmed.ncbi.nlm.nih.gov/32635337" }, { "database": "PubMed", "id": "32661241", "url": "https://pubmed.ncbi.nlm.nih.gov/32661241" }, { "database": "PubMed", "id": "32665601", "url": "https://pubmed.ncbi.nlm.nih.gov/32665601" }, { "database": "PubMed", "id": "32676926", "url": "https://pubmed.ncbi.nlm.nih.gov/32676926" }, { "database": "PubMed", "id": "32678073", "url": "https://pubmed.ncbi.nlm.nih.gov/32678073" }, { "database": "PubMed", "id": "32694512", "url": "https://pubmed.ncbi.nlm.nih.gov/32694512" }, { "database": "PubMed", "id": "32705280", "url": "https://pubmed.ncbi.nlm.nih.gov/32705280" }, { "database": "PubMed", "id": "32705779", "url": "https://pubmed.ncbi.nlm.nih.gov/32705779" }, { "database": "PubMed", "id": "32707717", "url": "https://pubmed.ncbi.nlm.nih.gov/32707717" }, { "database": "PubMed", "id": "32728700", "url": "https://pubmed.ncbi.nlm.nih.gov/32728700" }, { "database": "PubMed", "id": "32733154", "url": "https://pubmed.ncbi.nlm.nih.gov/32733154" }, { "database": "PubMed", "id": "32733649", "url": "https://pubmed.ncbi.nlm.nih.gov/32733649" }, { "database": "PubMed", "id": "32744507", "url": "https://pubmed.ncbi.nlm.nih.gov/32744507" }, { "database": "PubMed", "id": "32753891", "url": "https://pubmed.ncbi.nlm.nih.gov/32753891" }, { "database": "PubMed", "id": "32753957", "url": "https://pubmed.ncbi.nlm.nih.gov/32753957" }, { "database": "PubMed", "id": "32756405", "url": "https://pubmed.ncbi.nlm.nih.gov/32756405" }, { "database": "PubMed", "id": "32758183", "url": "https://pubmed.ncbi.nlm.nih.gov/32758183" }, { "database": "PubMed", "id": "32766133", "url": "https://pubmed.ncbi.nlm.nih.gov/32766133" }, { "database": "PubMed", "id": "32781572", "url": "https://pubmed.ncbi.nlm.nih.gov/32781572" }, { "database": "PubMed", "id": "32782388", "url": "https://pubmed.ncbi.nlm.nih.gov/32782388" }, { "database": "PubMed", "id": "32787969", "url": "https://pubmed.ncbi.nlm.nih.gov/32787969" }, { "database": "PubMed", "id": "32788653", "url": "https://pubmed.ncbi.nlm.nih.gov/32788653" }, { "database": "PubMed", "id": "32794021", "url": "https://pubmed.ncbi.nlm.nih.gov/32794021" }, { "database": "PubMed", "id": "32811805", "url": "https://pubmed.ncbi.nlm.nih.gov/32811805" }, { "database": "PubMed", "id": "32823607", "url": "https://pubmed.ncbi.nlm.nih.gov/32823607" }, { "database": "PubMed", "id": "32825725", "url": "https://pubmed.ncbi.nlm.nih.gov/32825725" }, { "database": "PubMed", "id": "32829599", "url": "https://pubmed.ncbi.nlm.nih.gov/32829599" }, { "database": "PubMed", "id": "32842681", "url": "https://pubmed.ncbi.nlm.nih.gov/32842681" }, { "database": "PubMed", "id": "32843616", "url": "https://pubmed.ncbi.nlm.nih.gov/32843616" }, { "database": "PubMed", "id": "32850353", "url": "https://pubmed.ncbi.nlm.nih.gov/32850353" }, { "database": "PubMed", "id": "32863234", "url": "https://pubmed.ncbi.nlm.nih.gov/32863234" }, { "database": "PubMed", "id": "32867711", "url": "https://pubmed.ncbi.nlm.nih.gov/32867711" }, { "database": "PubMed", "id": "32875583", "url": "https://pubmed.ncbi.nlm.nih.gov/32875583" }, { "database": "PubMed", "id": "32877278", "url": "https://pubmed.ncbi.nlm.nih.gov/32877278" }, { "database": "PubMed", "id": "32899862", "url": "https://pubmed.ncbi.nlm.nih.gov/32899862" }, { "database": "PubMed", "id": "32904445", "url": "https://pubmed.ncbi.nlm.nih.gov/32904445" }, { "database": "PubMed", "id": "32913468", "url": "https://pubmed.ncbi.nlm.nih.gov/32913468" }, { "database": "PubMed", "id": "32921413", "url": "https://pubmed.ncbi.nlm.nih.gov/32921413" }, { "database": "PubMed", "id": "32922037", "url": "https://pubmed.ncbi.nlm.nih.gov/32922037" }, { "database": "PubMed", "id": "32922194", "url": "https://pubmed.ncbi.nlm.nih.gov/32922194" }, { "database": "PubMed", "id": "32945383", "url": "https://pubmed.ncbi.nlm.nih.gov/32945383" }, { "database": "PubMed", "id": "32945500", "url": "https://pubmed.ncbi.nlm.nih.gov/32945500" }, { "database": "PubMed", "id": "32948740", "url": "https://pubmed.ncbi.nlm.nih.gov/32948740" }, { "database": "PubMed", "id": "32957504", "url": "https://pubmed.ncbi.nlm.nih.gov/32957504" }, { "database": "PubMed", "id": "32962206", "url": "https://pubmed.ncbi.nlm.nih.gov/32962206" }, { "database": "PubMed", "id": "32968045", "url": "https://pubmed.ncbi.nlm.nih.gov/32968045" }, { "database": "PubMed", "id": "32977414", "url": "https://pubmed.ncbi.nlm.nih.gov/32977414" }, { "database": "PubMed", "id": "33006750", "url": "https://pubmed.ncbi.nlm.nih.gov/33006750" }, { "database": "PubMed", "id": "33007920", "url": "https://pubmed.ncbi.nlm.nih.gov/33007920" }, { "database": "PubMed", "id": "33008000", "url": "https://pubmed.ncbi.nlm.nih.gov/33008000" }, { "database": "PubMed", "id": "33013390", "url": "https://pubmed.ncbi.nlm.nih.gov/33013390" }, { "database": "PubMed", "id": "33013932", "url": "https://pubmed.ncbi.nlm.nih.gov/33013932" }, { "database": "PubMed", "id": "33015464", "url": "https://pubmed.ncbi.nlm.nih.gov/33015464" }, { "database": "PubMed", "id": "33024816", "url": "https://pubmed.ncbi.nlm.nih.gov/33024816" }, { "database": "PubMed", "id": "33037285", "url": "https://pubmed.ncbi.nlm.nih.gov/33037285" }, { "database": "PubMed", "id": "33038921", "url": "https://pubmed.ncbi.nlm.nih.gov/33038921" }, { "database": "PubMed", "id": "33040080", "url": "https://pubmed.ncbi.nlm.nih.gov/33040080" }, { "database": "PubMed", "id": "33047031", "url": "https://pubmed.ncbi.nlm.nih.gov/33047031" }, { "database": "PubMed", "id": "33054056", "url": "https://pubmed.ncbi.nlm.nih.gov/33054056" }, { "database": "PubMed", "id": "33060766", "url": "https://pubmed.ncbi.nlm.nih.gov/33060766" }, { "database": "PubMed", "id": "33062024", "url": "https://pubmed.ncbi.nlm.nih.gov/33062024" }, { "database": "PubMed", "id": "33071789", "url": "https://pubmed.ncbi.nlm.nih.gov/33071789" }, { "database": "PubMed", "id": "33072436", "url": "https://pubmed.ncbi.nlm.nih.gov/33072436" }, { "database": "PubMed", "id": "33082914", "url": "https://pubmed.ncbi.nlm.nih.gov/33082914" }, { "database": "PubMed", "id": "33101052", "url": "https://pubmed.ncbi.nlm.nih.gov/33101052" }, { "database": "PubMed", "id": "33103284", "url": "https://pubmed.ncbi.nlm.nih.gov/33103284" }, { "database": "PubMed", "id": "33106477", "url": "https://pubmed.ncbi.nlm.nih.gov/33106477" }, { "database": "PubMed", "id": "33114687", "url": "https://pubmed.ncbi.nlm.nih.gov/33114687" }, { "database": "PubMed", "id": "33116125", "url": "https://pubmed.ncbi.nlm.nih.gov/33116125" }, { "database": "PubMed", "id": "33121495", "url": "https://pubmed.ncbi.nlm.nih.gov/33121495" }, { "database": "PubMed", "id": "33125102", "url": "https://pubmed.ncbi.nlm.nih.gov/33125102" }, { "database": "PubMed", "id": "33138025", "url": "https://pubmed.ncbi.nlm.nih.gov/33138025" }, { "database": "PubMed", "id": "33138208", "url": "https://pubmed.ncbi.nlm.nih.gov/33138208" }, { "database": "PubMed", "id": "33139695", "url": "https://pubmed.ncbi.nlm.nih.gov/33139695" }, { "database": "PubMed", "id": "33147101", "url": "https://pubmed.ncbi.nlm.nih.gov/33147101" }, { "database": "PubMed", "id": "33150178", "url": "https://pubmed.ncbi.nlm.nih.gov/33150178" }, { "database": "PubMed", "id": "33153119", "url": "https://pubmed.ncbi.nlm.nih.gov/33153119" }, { "database": "PubMed", "id": "33177160", "url": "https://pubmed.ncbi.nlm.nih.gov/33177160" }, { "database": "PubMed", "id": "33179291", "url": "https://pubmed.ncbi.nlm.nih.gov/33179291" }, { "database": "PubMed", "id": "33184290", "url": "https://pubmed.ncbi.nlm.nih.gov/33184290" }, { "database": "PubMed", "id": "33186539", "url": "https://pubmed.ncbi.nlm.nih.gov/33186539" }, { "database": "PubMed", "id": "33193858", "url": "https://pubmed.ncbi.nlm.nih.gov/33193858" }, { "database": "PubMed", "id": "33212946", "url": "https://pubmed.ncbi.nlm.nih.gov/33212946" }, { "database": "PubMed", "id": "33219203", "url": "https://pubmed.ncbi.nlm.nih.gov/33219203" }, { "database": "PubMed", "id": "33240414", "url": "https://pubmed.ncbi.nlm.nih.gov/33240414" }, { "database": "PubMed", "id": "33243998", "url": "https://pubmed.ncbi.nlm.nih.gov/33243998" }, { "database": "PubMed", "id": "33256016", "url": "https://pubmed.ncbi.nlm.nih.gov/33256016" }, { "database": "PubMed", "id": "33266502", "url": "https://pubmed.ncbi.nlm.nih.gov/33266502" }, { "database": "PubMed", "id": "33280832", "url": "https://pubmed.ncbi.nlm.nih.gov/33280832" }, { "database": "PubMed", "id": "33282634", "url": "https://pubmed.ncbi.nlm.nih.gov/33282634" }, { "database": "PubMed", "id": "33293793", "url": "https://pubmed.ncbi.nlm.nih.gov/33293793" }, { "database": "PubMed", "id": "33303839", "url": "https://pubmed.ncbi.nlm.nih.gov/33303839" }, { "database": "PubMed", "id": "33318473", "url": "https://pubmed.ncbi.nlm.nih.gov/33318473" }, { "database": "PubMed", "id": "33318517", "url": "https://pubmed.ncbi.nlm.nih.gov/33318517" }, { "database": "PubMed", "id": "33319180", "url": "https://pubmed.ncbi.nlm.nih.gov/33319180" }, { "database": "PubMed", "id": "33338921", "url": "https://pubmed.ncbi.nlm.nih.gov/33338921" }, { "database": "PubMed", "id": "33363017", "url": "https://pubmed.ncbi.nlm.nih.gov/33363017" }, { "database": "PubMed", "id": "33364504", "url": "https://pubmed.ncbi.nlm.nih.gov/33364504" }, { "database": "PubMed", "id": "33376545", "url": "https://pubmed.ncbi.nlm.nih.gov/33376545" }, { "database": "PubMed", "id": "33390782", "url": "https://pubmed.ncbi.nlm.nih.gov/33390782" }, { "database": "PubMed", "id": "33390959", "url": "https://pubmed.ncbi.nlm.nih.gov/33390959" }, { "database": "PubMed", "id": "33392189", "url": "https://pubmed.ncbi.nlm.nih.gov/33392189" }, { "database": "PubMed", "id": "33407478", "url": "https://pubmed.ncbi.nlm.nih.gov/33407478" }, { "database": "PubMed", "id": "33413430", "url": "https://pubmed.ncbi.nlm.nih.gov/33413430" }, { "database": "PubMed", "id": "33414447", "url": "https://pubmed.ncbi.nlm.nih.gov/33414447" }, { "database": "PubMed", "id": "33452459", "url": "https://pubmed.ncbi.nlm.nih.gov/33452459" }, { "database": "PubMed", "id": "33455947", "url": "https://pubmed.ncbi.nlm.nih.gov/33455947" }, { "database": "PubMed", "id": "33468992", "url": "https://pubmed.ncbi.nlm.nih.gov/33468992" }, { "database": "PubMed", "id": "33477701", "url": "https://pubmed.ncbi.nlm.nih.gov/33477701" }, { "database": "PubMed", "id": "33500384", "url": "https://pubmed.ncbi.nlm.nih.gov/33500384" }, { "database": "PubMed", "id": "33506378", "url": "https://pubmed.ncbi.nlm.nih.gov/33506378" }, { "database": "PubMed", "id": "33526785", "url": "https://pubmed.ncbi.nlm.nih.gov/33526785" }, { "database": "PubMed", "id": "33530617", "url": "https://pubmed.ncbi.nlm.nih.gov/33530617" }, { "database": "PubMed", "id": "33535610", "url": "https://pubmed.ncbi.nlm.nih.gov/33535610" }, { "database": "PubMed", "id": "33537819", "url": "https://pubmed.ncbi.nlm.nih.gov/33537819" }, { "database": "PubMed", "id": "33547375", "url": "https://pubmed.ncbi.nlm.nih.gov/33547375" }, { "database": "PubMed", "id": "33552283", "url": "https://pubmed.ncbi.nlm.nih.gov/33552283" }, { "database": "PubMed", "id": "33562475", "url": "https://pubmed.ncbi.nlm.nih.gov/33562475" }, { "database": "PubMed", "id": "33566837", "url": "https://pubmed.ncbi.nlm.nih.gov/33566837" }, { "database": "PubMed", "id": "33571243", "url": "https://pubmed.ncbi.nlm.nih.gov/33571243" }, { "database": "PubMed", "id": "33575473", "url": "https://pubmed.ncbi.nlm.nih.gov/33575473" }, { "database": "PubMed", "id": "33576447", "url": "https://pubmed.ncbi.nlm.nih.gov/33576447" }, { "database": "PubMed", "id": "33579227", "url": "https://pubmed.ncbi.nlm.nih.gov/33579227" }, { "database": "PubMed", "id": "33585557", "url": "https://pubmed.ncbi.nlm.nih.gov/33585557" }, { "database": "PubMed", "id": "33588847", "url": "https://pubmed.ncbi.nlm.nih.gov/33588847" }, { "database": "PubMed", "id": "33614493", "url": "https://pubmed.ncbi.nlm.nih.gov/33614493" }, { "database": "PubMed", "id": "33614606", "url": "https://pubmed.ncbi.nlm.nih.gov/33614606" }, { "database": "PubMed", "id": "33615197", "url": "https://pubmed.ncbi.nlm.nih.gov/33615197" }, { "database": "PubMed", "id": "33624300", "url": "https://pubmed.ncbi.nlm.nih.gov/33624300" }, { "database": "PubMed", "id": "33648498", "url": "https://pubmed.ncbi.nlm.nih.gov/33648498" }, { "database": "PubMed", "id": "33659212", "url": "https://pubmed.ncbi.nlm.nih.gov/33659212" }, { "database": "PubMed", "id": "33659252", "url": "https://pubmed.ncbi.nlm.nih.gov/33659252" }, { "database": "PubMed", "id": "33664437", "url": "https://pubmed.ncbi.nlm.nih.gov/33664437" }, { "database": "PubMed", "id": "33664847", "url": "https://pubmed.ncbi.nlm.nih.gov/33664847" }, { "database": "PubMed", "id": "33670586", "url": "https://pubmed.ncbi.nlm.nih.gov/33670586" }, { "database": "PubMed", "id": "33672955", "url": "https://pubmed.ncbi.nlm.nih.gov/33672955" }, { "database": "PubMed", "id": "33686185", "url": "https://pubmed.ncbi.nlm.nih.gov/33686185" }, { "database": "PubMed", "id": "33690611", "url": "https://pubmed.ncbi.nlm.nih.gov/33690611" }, { "database": "PubMed", "id": "33718332", "url": "https://pubmed.ncbi.nlm.nih.gov/33718332" }, { "database": "PubMed", "id": "33723214", "url": "https://pubmed.ncbi.nlm.nih.gov/33723214" }, { "database": "PubMed", "id": "33723215", "url": "https://pubmed.ncbi.nlm.nih.gov/33723215" }, { "database": "PubMed", "id": "33731670", "url": "https://pubmed.ncbi.nlm.nih.gov/33731670" }, { "database": "PubMed", "id": "33732339", "url": "https://pubmed.ncbi.nlm.nih.gov/33732339" }, { "database": "PubMed", "id": "33742122", "url": "https://pubmed.ncbi.nlm.nih.gov/33742122" }, { "database": "PubMed", "id": "33758209", "url": "https://pubmed.ncbi.nlm.nih.gov/33758209" }, { "database": "PubMed", "id": "33785835", "url": "https://pubmed.ncbi.nlm.nih.gov/33785835" }, { "database": "PubMed", "id": "33802884", "url": "https://pubmed.ncbi.nlm.nih.gov/33802884" }, { "database": "PubMed", "id": "33808215", "url": "https://pubmed.ncbi.nlm.nih.gov/33808215" }, { "database": "PubMed", "id": "33817134", "url": "https://pubmed.ncbi.nlm.nih.gov/33817134" }, { "database": "PubMed", "id": "33817584", "url": "https://pubmed.ncbi.nlm.nih.gov/33817584" }, { "database": "PubMed", "id": "33824274", "url": "https://pubmed.ncbi.nlm.nih.gov/33824274" }, { "database": "PubMed", "id": "33829865", "url": "https://pubmed.ncbi.nlm.nih.gov/33829865" }, { "database": "PubMed", "id": "33837205", "url": "https://pubmed.ncbi.nlm.nih.gov/33837205" }, { "database": "PubMed", "id": "33839702", "url": "https://pubmed.ncbi.nlm.nih.gov/33839702" }, { "database": "PubMed", "id": "33845796", "url": "https://pubmed.ncbi.nlm.nih.gov/33845796" }, { "database": "PubMed", "id": "33850634", "url": "https://pubmed.ncbi.nlm.nih.gov/33850634" }, { "database": "PubMed", "id": "33854967", "url": "https://pubmed.ncbi.nlm.nih.gov/33854967" }, { "database": "PubMed", "id": "33858515", "url": "https://pubmed.ncbi.nlm.nih.gov/33858515" }, { "database": "PubMed", "id": "33867823", "url": "https://pubmed.ncbi.nlm.nih.gov/33867823" }, { "database": "PubMed", "id": "33868237", "url": "https://pubmed.ncbi.nlm.nih.gov/33868237" }, { "database": "PubMed", "id": "33868471", "url": "https://pubmed.ncbi.nlm.nih.gov/33868471" }, { "database": "PubMed", "id": "33874915", "url": "https://pubmed.ncbi.nlm.nih.gov/33874915" }, { "database": "PubMed", "id": "33916378", "url": "https://pubmed.ncbi.nlm.nih.gov/33916378" }, { "database": "PubMed", "id": "33959030", "url": "https://pubmed.ncbi.nlm.nih.gov/33959030" }, { "database": "PubMed", "id": "33967735", "url": "https://pubmed.ncbi.nlm.nih.gov/33967735" }, { "database": "PubMed", "id": "34033176", "url": "https://pubmed.ncbi.nlm.nih.gov/34033176" }, { "database": "PubMed", "id": "34073781", "url": "https://pubmed.ncbi.nlm.nih.gov/34073781" }, { "database": "PubMed", "id": "34200497", "url": "https://pubmed.ncbi.nlm.nih.gov/34200497" }, { "database": "PubMed", "id": "34522717", "url": "https://pubmed.ncbi.nlm.nih.gov/34522717" }, { "database": "PubMed", "id": "34589963", "url": "https://pubmed.ncbi.nlm.nih.gov/34589963" }, { "database": "PubMed", "id": "34909046", "url": "https://pubmed.ncbi.nlm.nih.gov/34909046" }, { "database": "PubMed", "id": "34918581", "url": "https://pubmed.ncbi.nlm.nih.gov/34918581" }, { "database": "PubMed", "id": "34938598", "url": "https://pubmed.ncbi.nlm.nih.gov/34938598" }, { "database": "PubMed", "id": "34995578", "url": "https://pubmed.ncbi.nlm.nih.gov/34995578" }, { "database": "PubMed", "id": "35008578", "url": "https://pubmed.ncbi.nlm.nih.gov/35008578" }, { "database": "PubMed", "id": "35126712", "url": "https://pubmed.ncbi.nlm.nih.gov/35126712" }, { "database": "PubMed", "id": "35250564", "url": "https://pubmed.ncbi.nlm.nih.gov/35250564" }, { "database": "PubMed", "id": "35269443", "url": "https://pubmed.ncbi.nlm.nih.gov/35269443" }, { "database": "PubMed", "id": "35271909", "url": "https://pubmed.ncbi.nlm.nih.gov/35271909" }, { "database": "PubMed", "id": "35347116", "url": "https://pubmed.ncbi.nlm.nih.gov/35347116" }, { "database": "PubMed", "id": "35366279", "url": "https://pubmed.ncbi.nlm.nih.gov/35366279" }, { "database": "PubMed", "id": "35514261", "url": "https://pubmed.ncbi.nlm.nih.gov/35514261" }, { "database": "PubMed", "id": "35641033", "url": "https://pubmed.ncbi.nlm.nih.gov/35641033" }, { "database": "PubMed", "id": "35661967", "url": "https://pubmed.ncbi.nlm.nih.gov/35661967" }, { "database": "PubMed", "id": "35731713", "url": "https://pubmed.ncbi.nlm.nih.gov/35731713" }, { "database": "PubMed", "id": "35783523", "url": "https://pubmed.ncbi.nlm.nih.gov/35783523" }, { "database": "PubMed", "id": "35918763", "url": "https://pubmed.ncbi.nlm.nih.gov/35918763" }, { "database": "PubMed", "id": "35929438", "url": "https://pubmed.ncbi.nlm.nih.gov/35929438" }, { "database": "PubMed", "id": "35954193", "url": "https://pubmed.ncbi.nlm.nih.gov/35954193" }, { "database": "PubMed", "id": "35977495", "url": "https://pubmed.ncbi.nlm.nih.gov/35977495" }, { "database": "PubMed", "id": "36041631", "url": "https://pubmed.ncbi.nlm.nih.gov/36041631" }, { "database": "PubMed", "id": "36115854", "url": "https://pubmed.ncbi.nlm.nih.gov/36115854" }, { "database": "PubMed", "id": "36142605", "url": "https://pubmed.ncbi.nlm.nih.gov/36142605" }, { "database": "PubMed", "id": "36174454", "url": "https://pubmed.ncbi.nlm.nih.gov/36174454" }, { "database": "PubMed", "id": "36182968", "url": "https://pubmed.ncbi.nlm.nih.gov/36182968" }, { "database": "PubMed", "id": "36222151", "url": "https://pubmed.ncbi.nlm.nih.gov/36222151" }, { "database": "PubMed", "id": "36222195", "url": "https://pubmed.ncbi.nlm.nih.gov/36222195" }, { "database": "PubMed", "id": "36314765", "url": "https://pubmed.ncbi.nlm.nih.gov/36314765" }, { "database": "PubMed", "id": "36404440", "url": "https://pubmed.ncbi.nlm.nih.gov/36404440" }, { "database": "PubMed", "id": "36406198", "url": "https://pubmed.ncbi.nlm.nih.gov/36406198" }, { "database": "PubMed", "id": "36444808", "url": "https://pubmed.ncbi.nlm.nih.gov/36444808" }, { "database": "PubMed", "id": "9094314", "url": "https://pubmed.ncbi.nlm.nih.gov/9094314" }, { "database": "PubMed", "id": "9722592", "url": "https://pubmed.ncbi.nlm.nih.gov/9722592" }, { "database": "PubMed", "id": "9736715", "url": "https://pubmed.ncbi.nlm.nih.gov/9736715" }, { "database": "PubMed", "id": "9850049", "url": "https://pubmed.ncbi.nlm.nih.gov/9850049" }, { "database": "PubMed", "id": "9857186", "url": "https://pubmed.ncbi.nlm.nih.gov/9857186" }, { "database": "PubMed", "id": "15047712", "url": "https://pubmed.ncbi.nlm.nih.gov/15047712" }, { "database": "PubMed", "id": "16266983", "url": "https://pubmed.ncbi.nlm.nih.gov/16266983" }, { "database": "PubMed", "id": "20333297", "url": "https://pubmed.ncbi.nlm.nih.gov/20333297" }, { "database": "PubMed", "id": "20978158", "url": "https://pubmed.ncbi.nlm.nih.gov/20978158" }, { "database": "PubMed", "id": "14761976", "url": "https://pubmed.ncbi.nlm.nih.gov/14761976" } ], "site_lbl": "Ser473", "uniprot_canonical_ac": "P31749-1" } ], "record_id": "pubmed.22634313", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Towards an integrative approach to understanding the role of chemerin in human health and disease.", "journal": "Obes. Rev.", "date": "2013", "authors": "Rourke J L, Dranse H J, Sinal C J", "reference": { "type": "PubMed", "id": "23216632", "url": "https://pubmed.ncbi.nlm.nih.gov/23216632" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23216632", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemerin is an antimicrobial agent in human epidermis.", "journal": "PloS one", "date": "2013", "authors": "Banas Magdalena, Zabieglo Katarzyna, Kasetty Gopinath, Kapinska-Mrowiecka Monika, Borowczyk Julia, Drukala Justyna, Murzyn Krzysztof, Zabel Brian A, Butcher Eugene C, Schroeder Jens M, Schmidtchen Artur, Cichy Joanna", "reference": { "type": "PubMed", "id": "23527010", "url": "https://pubmed.ncbi.nlm.nih.gov/23527010" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.23527010", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemerin regulation and role in host defense.", "journal": "American journal of clinical and experimental immunology", "date": "2014", "authors": "Zabel BA, Kwitniewski M, Banas M, Zabieglo K, Murzyn K, Cichy J", "reference": { "type": "PubMed", "id": "24660117", "url": "https://pubmed.ncbi.nlm.nih.gov/24660117" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.24660117", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Chemerin promotes invasion of oral squamous cell carcinoma by stimulating IL-6 and TNF-\u03b1 production via STAT3 activation.", "journal": "Molecular biology reports", "date": "2024-03-23", "authors": "Lu Zhiyuan, Liu Jiayu, Wan Quan, Wu Yu, Wu Wanqiu, Chen Yiyang", "reference": { "type": "PubMed", "id": "38520551", "url": "https://pubmed.ncbi.nlm.nih.gov/38520551" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38520551", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Prognostic significance of the chemerin level in coronavirus disease 2019 patients.", "journal": "Medicine", "date": "2024-04-05", "authors": "Gokdemir G\u00fcl \u015eahika, Gokdemir Mehmet Tahir, Ara\u00e7 Song\u00fcl, Yoku\u015f Beran", "reference": { "type": "PubMed", "id": "38579052", "url": "https://pubmed.ncbi.nlm.nih.gov/38579052" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38579052", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Research progress of chemerin in polycystic ovary syndrome].", "journal": "Sheng li xue bao : [Acta physiologica Sinica]", "date": "2024-06-25", "authors": "Zhu Xiao-Juan, Qiu Hang, Liu Sheng-Lan, Dai Wei, Hu Hai-Bo, Huang Hao", "reference": { "type": "PubMed", "id": "38939937", "url": "https://pubmed.ncbi.nlm.nih.gov/38939937" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38939937", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Structure of G protein-coupled receptor GPR1 bound to full-length chemerin adipokine reveals a chemokine-like reverse binding mode.", "journal": "PLoS biology", "date": "2024-10", "authors": "Liu Aijun, Liu Yezhou, Chen Geng, Lyu Wenping, Ye Fang, Wang Junlin, Liao Qiwen, Zhu Lizhe, Du Yang, Ye Richard D", "reference": { "type": "PubMed", "id": "39466725", "url": "https://pubmed.ncbi.nlm.nih.gov/39466725" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" }, { "uniprot_canonical_ac": "P46091-1", "protein_name": "Chemerin-like receptor 2", "gene_name": "CMKLR2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.39466725", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Tazarotene-induced gene 2 (TIG2), a novel retinoid-responsive gene in skin.", "journal": "J. Invest. Dermatol.", "date": "1997", "authors": "Nagpal S, Patel S, Jacobe H, DiSepio D, Ghosn C, Malhotra M, Teng M, Duvic M, Chandraratna RA", "reference": { "type": "PubMed", "id": "9204961", "url": "https://pubmed.ncbi.nlm.nih.gov/9204961" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q99969-1", "protein_name": "Retinoic acid receptor responder protein 2", "gene_name": "RARRES2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q99969", "url": "https://www.uniprot.org/uniprotkb/Q99969" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9204961", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "EGFR phosphorylates and inhibits lung tumor suppressor GPRC5A in lung cancer.", "journal": "Molecular cancer", "date": "2014", "authors": "Lin X, Zhong S, Ye X, Liao Y, Yao F, Yang X, Sun B, Zhang J, Li Q, Gao Y, Wang Y, Liu J, Han B, Chin YE, Zhou BP, Deng J", "reference": { "type": "PubMed", "id": "25311788", "url": "https://pubmed.ncbi.nlm.nih.gov/25311788" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NFJ5-1", "protein_name": "Retinoic acid-induced protein 3", "gene_name": "GPRC5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P00533-1", "protein_name": "Epidermal growth factor receptor", "gene_name": "EGFR", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 317, "end_pos": 317, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" }, { "database": "PubMed", "id": "25311788", "url": "https://pubmed.ncbi.nlm.nih.gov/25311788" }, { "database": "iPTMnet", "id": "Q8NFJ5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8NFJ5" }, { "database": "PubMed", "id": "15951569", "url": "https://pubmed.ncbi.nlm.nih.gov/15951569" }, { "database": "PubMed", "id": "17389395", "url": "https://pubmed.ncbi.nlm.nih.gov/17389395" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" } ], "site_lbl": "Tyr317", "uniprot_canonical_ac": "Q8NFJ5-1" }, { "start_pos": 320, "end_pos": 320, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" }, { "database": "PubMed", "id": "25311788", "url": "https://pubmed.ncbi.nlm.nih.gov/25311788" }, { "database": "iPTMnet", "id": "Q8NFJ5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8NFJ5" }, { "database": "PubMed", "id": "18083107", "url": "https://pubmed.ncbi.nlm.nih.gov/18083107" } ], "site_lbl": "Tyr320", "uniprot_canonical_ac": "Q8NFJ5-1" }, { "start_pos": 347, "end_pos": 347, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" }, { "database": "PubMed", "id": "25311788", "url": "https://pubmed.ncbi.nlm.nih.gov/25311788" }, { "database": "PubMed", "id": "23186163", "url": "https://pubmed.ncbi.nlm.nih.gov/23186163" }, { "database": "iPTMnet", "id": "Q8NFJ5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8NFJ5" }, { "database": "PubMed", "id": "17016520", "url": "https://pubmed.ncbi.nlm.nih.gov/17016520" }, { "database": "PubMed", "id": "18083107", "url": "https://pubmed.ncbi.nlm.nih.gov/18083107" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://pubmed.ncbi.nlm.nih.gov/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" } ], "site_lbl": "Tyr347", "uniprot_canonical_ac": "Q8NFJ5-1" }, { "start_pos": 350, "end_pos": 350, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" }, { "database": "PubMed", "id": "25311788", "url": "https://pubmed.ncbi.nlm.nih.gov/25311788" }, { "database": "iPTMnet", "id": "Q8NFJ5", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q8NFJ5" }, { "database": "PubMed", "id": "18083107", "url": "https://pubmed.ncbi.nlm.nih.gov/18083107" }, { "database": "PubMed", "id": "18452278", "url": "https://pubmed.ncbi.nlm.nih.gov/18452278" }, { "database": "PubMed", "id": "18691976", "url": "https://pubmed.ncbi.nlm.nih.gov/18691976" } ], "site_lbl": "Tyr350", "uniprot_canonical_ac": "Q8NFJ5-1" } ], "record_id": "pubmed.25311788", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Deciphering the molecular regulatory of RAB32/GPRC5A axis in chronic obstructive pulmonary disease.", "journal": "Respiratory research", "date": "2024-03-06", "authors": "Wu Yixing, He Binfeng, Hua Jianlan, Hu Weiping, Han Yaopin, Zhang Jing", "reference": { "type": "PubMed", "id": "38448858", "url": "https://pubmed.ncbi.nlm.nih.gov/38448858" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NFJ5-1", "protein_name": "Retinoic acid-induced protein 3", "gene_name": "GPRC5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q13637-1", "protein_name": "Ras-related protein Rab-32", "gene_name": "RAB32", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38448858", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "[Inhibitory effect of downregulating G protein-coupled receptor class C group 5 member A expression on lipopolysaccharide-induced inflammatory response in human gingival fibroblasts].", "journal": "Zhonghua kou qiang yi xue za zhi = Zhonghua kouqiang yixue zazhi = Chinese journal of stomatology", "date": "2024-04-09", "authors": "Hu Y H, Shang L L, Ge S H", "reference": { "type": "PubMed", "id": "38548591", "url": "https://pubmed.ncbi.nlm.nih.gov/38548591" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NFJ5-1", "protein_name": "Retinoic acid-induced protein 3", "gene_name": "GPRC5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38548591", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GPRC5A promotes paclitaxel resistance and glucose content in NSCLC.", "journal": "Anti-cancer drugs", "date": "2024-08-01", "authors": "Wang Yan, Gao Liang, Wang Feiyu, Yu Cunjun, Chen Chen, Xia Chunwei", "reference": { "type": "PubMed", "id": "38602327", "url": "https://pubmed.ncbi.nlm.nih.gov/38602327" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NFJ5-1", "protein_name": "Retinoic acid-induced protein 3", "gene_name": "GPRC5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38602327", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "GPRC5A promotes gallbladder cancer metastasis by upregulating TNS4 via the JAK2-STAT3 pathway.", "journal": "Cancer letters", "date": "2024-08-28", "authors": "Yang Jiahua, Li Xuechuan, Chen Shili, Li Guoqiang, Pu Peng, Yang Yang, Wu Wenguang, Geng Yajun, Liu Yingbin", "reference": { "type": "PubMed", "id": "38942137", "url": "https://pubmed.ncbi.nlm.nih.gov/38942137" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NFJ5-1", "protein_name": "Retinoic acid-induced protein 3", "gene_name": "GPRC5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q8IZW8-1", "protein_name": "Tensin-4", "gene_name": "TNS4", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38942137", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Identification by differential display of a mRNA specifically induced by 12-O-tetradecanoylphorbol-13-acetate (TPA) in T84 human colon carcinoma cells.", "journal": "Cell. Mol. Biol.", "date": "1996", "authors": "Cafferata E G, Gonzalez-Guerrico A M, Pivetta O H, Santa-Coloma T A", "reference": { "type": "PubMed", "id": "8832110", "url": "https://pubmed.ncbi.nlm.nih.gov/8832110" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NFJ5-1", "protein_name": "Retinoic acid-induced protein 3", "gene_name": "GPRC5A", "tax_name": "Human" }, { "uniprot_canonical_ac": "P49788-1", "protein_name": "Retinoic acid receptor responder protein 1", "gene_name": "RARRES1", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.8832110", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Molecular cloning and characterization of a novel retinoic acid-inducible gene that encodes a putative G protein-coupled receptor.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Cheng Y, Lotan R", "reference": { "type": "PubMed", "id": "9857033", "url": "https://pubmed.ncbi.nlm.nih.gov/9857033" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q8NFJ5-1", "protein_name": "Retinoic acid-induced protein 3", "gene_name": "GPRC5A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q8NFJ5", "url": "https://www.uniprot.org/uniprotkb/Q8NFJ5" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9857033", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "The essential Smp3 protein is required for addition of the side-branching fourth mannose during assembly of yeast glycosylphosphatidylinositols.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Grimme SJ, Westfall BA, Wiedman JM, Taron CH, Orlean P", "reference": { "type": "PubMed", "id": "11356840", "url": "https://pubmed.ncbi.nlm.nih.gov/11356840" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86VD9-1", "protein_name": "GPI alpha-1,2-mannosyltransferase 4", "gene_name": "PIGZ", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q04174-1", "protein_name": "GPI mannosyltransferase 4", "gene_name": "SMP3", "tax_name": "Baker's yeast" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86VD9", "url": "https://www.uniprot.org/uniprotkb/Q86VD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.11356840", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Human Smp3p adds a fourth mannose to yeast and human glycosylphosphatidylinositol precursors in vivo.", "journal": "The Journal of biological chemistry", "date": "2004-08-20", "authors": "Taron Barbara W, Colussi Paul A, Wiedman Jill M, Orlean Peter, Taron Christopher H", "reference": { "type": "PubMed", "id": "15208306", "url": "https://pubmed.ncbi.nlm.nih.gov/15208306" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86VD9-1", "protein_name": "GPI alpha-1,2-mannosyltransferase 4", "gene_name": "PIGZ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86VD9", "url": "https://www.uniprot.org/uniprotkb/Q86VD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.15208306", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A Neutralizing Antibody Recognizing Primarily N-Linked Glycan Targets the Silent Face of the HIV Envelope.", "journal": "Immunity", "date": "2018-03-20", "authors": "Zhou Tongqing, Zheng Anqi, Baxa Ulrich, Chuang Gwo-Yu, Georgiev Ivelin S, Kong Rui, O'Dell Sijy, Shahzad-Ul-Hussan Syed, Shen Chen-Hsiang, Tsybovsky Yaroslav, Bailer Robert T, Gift Syna K, Louder Mark K, McKee Krisha, Rawi Reda, Stevenson Catherine H, Stewart-Jones Guillaume B E, Taft Justin D, Waltari Eric, Yang Yongping, Zhang Baoshan, Shivatare Sachin S, Shivatare Vidya S, Lee Chang-Chun D, Wu Chung-Yi, , Mullikin James C, Bewley Carole A, Burton Dennis R, Polonis Victoria R, Shapiro Lawrence, Wong Chi-Huey, Mascola John R, Kwong Peter D, Wu Xueling", "reference": { "type": "PubMed", "id": "29548671", "url": "https://pubmed.ncbi.nlm.nih.gov/29548671" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q86VD9-1", "protein_name": "GPI alpha-1,2-mannosyltransferase 4", "gene_name": "PIGZ", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q86VD9", "url": "https://www.uniprot.org/uniprotkb/Q86VD9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "other", "prediction_tool_list": [], "site_category": "automatic_literature_mining", "site_category_dict": { "automatic_literature_mining": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 295, "start_aa": "Asn", "end_pos": 295, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn295", "evidence": [ { "id": "29548671", "database": "PubMed", "url": "https://pubmed.ncbi.nlm.nih.gov/29548671" }, { "id": "GLY_000481", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000481" } ], "mining_tool": "GlycoSiteMiner_1.0", "mining_tool_list": [ { "label": "GlycoSiteMiner_1.0" } ], "filter_code": "001000000000000000000.00010000000000.00.01001", "uniprot_canonical_ac": "Q86VD9-1" } ], "record_id": "pubmed.29548671", "abstract": "", "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 1 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_n_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl", "mining_tool", "filter_code", "uniprot_canonical_ac" ] } ] }, { "title": "Deficiency of Prdm13, a dorsomedial hypothalamus-enriched gene, mimics age-associated changes in sleep quality and adiposity.", "journal": "Aging cell", "date": "2015", "authors": "Satoh A, Brace CS, Rensing N, Imai S", "reference": { "type": "PubMed", "id": "25546159", "url": "https://pubmed.ncbi.nlm.nih.gov/25546159" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H4Q3-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "PRDM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "E9PZZ1-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "Prdm13", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H4Q3", "url": "https://www.uniprot.org/uniprotkb/Q9H4Q3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.25546159", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A unique PRDM13-associated variant in a Georgian Jewish family with probable North Carolina macular dystrophy and the possible contribution of a unique CFH variant.", "journal": "Molecular vision", "date": "2020", "authors": "Namburi P, Khateb S, Meyer S, Bentovim T, Ratnapriya R, Khramushin A, Swaroop A, Schueler-Furman O, Banin E, Sharon D", "reference": { "type": "PubMed", "id": "32476814", "url": "https://pubmed.ncbi.nlm.nih.gov/32476814" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H4Q3-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "PRDM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H4Q3", "url": "https://www.uniprot.org/uniprotkb/Q9H4Q3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.32476814", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "North Carolina Macular Dystrophy: Phenotypic Variability and Computational Analysis of Disease-Associated Noncoding Variants.", "journal": "Investigative ophthalmology & visual science", "date": "2021", "authors": "Green DJ, Lenassi E, Manning CS, McGaughey D, Sharma V, Black GC, Ellingford JM, Sergouniotis PI", "reference": { "type": "PubMed", "id": "34125159", "url": "https://pubmed.ncbi.nlm.nih.gov/34125159" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H4Q3-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "PRDM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H4Q3", "url": "https://www.uniprot.org/uniprotkb/Q9H4Q3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34125159", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A novel duplication involving PRDM13 in a Turkish family supports its role in North Carolina macular dystrophy (NCMD/MCDR1).", "journal": "Molecular vision", "date": "2021", "authors": "Small KW, Van de Sompele S, Nuytemans K, Vincent A, Yuregir OO, Ciloglu E, Sariyildiz C, Rosseel T, Avetisjan J, Udar N, Vance JM, Pericak-Vance MA, De Baere E, Shaya FS", "reference": { "type": "PubMed", "id": "34526759", "url": "https://pubmed.ncbi.nlm.nih.gov/34526759" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H4Q3-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "PRDM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H4Q3", "url": "https://www.uniprot.org/uniprotkb/Q9H4Q3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34526759", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "A recessive PRDM13 mutation results in congenital hypogonadotropic hypogonadism and cerebellar hypoplasia.", "journal": "The Journal of clinical investigation", "date": "2021", "authors": "Whittaker DE, Oleari R, Gregory LC, Le Quesne-Stabej P, Williams HJ, Torpiano JG, Formosa N, Cachia MJ, Field D, Lettieri A, Ocaka LA, Paganoni AJ, Rajabali SH, Riegman KL, De Martini LB, Chaya T, Robinson IC, Furukawa T, Cariboni A, Basson MA, Dattani MT", "reference": { "type": "PubMed", "id": "34730112", "url": "https://pubmed.ncbi.nlm.nih.gov/34730112" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H4Q3-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "PRDM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "E9PZZ1-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "Prdm13", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H4Q3", "url": "https://www.uniprot.org/uniprotkb/Q9H4Q3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.34730112", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Recessive PRDM13 mutations cause fatal perinatal brainstem dysfunction with cerebellar hypoplasia and disrupt Purkinje cell differentiation.", "journal": "American journal of human genetics", "date": "2022", "authors": "Coolen M, Altin N, Rajamani K, Pereira E, Siquier-Pernet K, Puig Lombardi E, Moreno N, Barcia G, Yvert M, Laquerriere A, Pouliet A, Nitschke P, Boddaert N, Rausell A, Razavi F, Afenjar A, Billette de Villemeur T, Al-Maawali A, Al-Thihli K, Baptista J, Beleza-Meireles A, Garel C, Legendre M, Gelot A, Burglen L, Moutton S, Cantagrel V", "reference": { "type": "PubMed", "id": "35390279", "url": "https://pubmed.ncbi.nlm.nih.gov/35390279" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H4Q3-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "PRDM13", "tax_name": "Human" }, { "uniprot_canonical_ac": "F1R7D7-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "prdm13", "tax_name": "Zebrafish" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H4Q3", "url": "https://www.uniprot.org/uniprotkb/Q9H4Q3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35390279", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Two novel non-coding single nucleotide variants in the DNase1 hypersensitivity site of PRDM13 causing North Carolina macular dystrophy in Korea.", "journal": "Molecular vision", "date": "2024", "authors": "Seo Yuri, Joo Kwangsic, Lee Junwon, Diaz Amber, Jang Sohyun, Cherry Timothy J, Bujakowska Kinga M, Han Jinu, Woo Se Joon, Small Kent W", "reference": { "type": "PubMed", "id": "38601016", "url": "https://pubmed.ncbi.nlm.nih.gov/38601016" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q9H4Q3-1", "protein_name": "PR domain zinc finger protein 13", "gene_name": "PRDM13", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q9H4Q3", "url": "https://www.uniprot.org/uniprotkb/Q9H4Q3" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.38601016", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Novel candidate genes and variants underlying autosomal recessive neurodevelopmental disorders with intellectual disability.", "journal": "Human genetics", "date": "2018", "authors": "Santos-Cortez RLP, Khan V, Khan FS, Mughal ZU, Chakchouk I, Lee K, Rasheed M, Hamza R, Acharya A, Ullah E, Saqib MAN, Abbe I, Ali G, Hassan MJ, Khan S, Azeem Z, Ullah I, Bamshad MJ, Nickerson DA, Schrauwen I, Ahmad W, Ansar M, Leal SM", "reference": { "type": "PubMed", "id": "30167849", "url": "https://pubmed.ncbi.nlm.nih.gov/30167849" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48553-1", "protein_name": "Trafficking protein particle complex subunit 10", "gene_name": "TRAPPC10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48553", "url": "https://www.uniprot.org/uniprotkb/P48553" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30167849", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Biallelic variants in TRAPPC10 cause a microcephalic TRAPPopathy disorder in humans and mice.", "journal": "PLoS genetics", "date": "2022-03", "authors": "Rawlins Lettie E, Almousa Hashem, Khan Shazia, Collins Stephan C, Milev Miroslav P, Leslie Joseph, Saint-Dic Djenann, Khan Valeed, Hincapie Ana Maria, Day Jacob O, McGavin Lucy, Rowley Christine, Harlalka Gaurav V, Vancollie Valerie E, Ahmad Wasim, Lelliott Christopher J, Gul Asma, Yalcin Binnaz, Crosby Andrew H, Sacher Michael, Baple Emma L", "reference": { "type": "PubMed", "id": "35298461", "url": "https://pubmed.ncbi.nlm.nih.gov/35298461" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48553-1", "protein_name": "Trafficking protein particle complex subunit 10", "gene_name": "TRAPPC10", "tax_name": "Human" }, { "uniprot_canonical_ac": "Q3TLI0-1", "protein_name": "Trafficking protein particle complex subunit 10", "gene_name": "Trappc10", "tax_name": "Mouse" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48553", "url": "https://www.uniprot.org/uniprotkb/P48553" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.35298461", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Isolation and characterization of a candidate gene for progressive myoclonus epilepsy on 21q22.3.", "journal": "Hum. Mol. Genet.", "date": "1995", "authors": "Yamakawa K, Mitchell S, Hubert R, Chen XN, Colbern S, Huo YK, Gadomski C, Kim UJ, Korenberg JR", "reference": { "type": "PubMed", "id": "7633421", "url": "https://pubmed.ncbi.nlm.nih.gov/7633421" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48553-1", "protein_name": "Trafficking protein particle complex subunit 10", "gene_name": "TRAPPC10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48553", "url": "https://www.uniprot.org/uniprotkb/P48553" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.7633421", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Genomic structure of the human GT334 (EHOC-1) gene mapping to 21q22.3.", "journal": "Gene", "date": "1997", "authors": "Lafreniere RG, Kibar Z, Rochefort DL, Han FY, Fon EA, Dube MP, Kang X, Baird S, Korneluk RG, Rommens JM, Rouleau GA", "reference": { "type": "PubMed", "id": "9370297", "url": "https://pubmed.ncbi.nlm.nih.gov/9370297" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "P48553-1", "protein_name": "Trafficking protein particle complex subunit 10", "gene_name": "TRAPPC10", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "P48553", "url": "https://www.uniprot.org/uniprotkb/P48553" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.9370297", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "PRAC2: a new gene expressed in human prostate and prostate cancer.", "journal": "Prostate", "date": "2003", "authors": "Olsson P, Motegi A, Bera TK, Lee B, Pastan I", "reference": { "type": "PubMed", "id": "12746837", "url": "https://pubmed.ncbi.nlm.nih.gov/12746837" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "D3DTV9-1", "protein_name": "Protein PRAC2", "gene_name": "PRAC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "D3DTV9", "url": "https://www.uniprot.org/uniprotkb/D3DTV9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.12746837", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Long noncoding RNA HOXB13-AS1 regulates HOXB13 gene methylation by interacting with EZH2 in glioma.", "journal": "Cancer medicine", "date": "2018", "authors": "Xiong Y, Kuang W, Lu S, Guo H, Wu M, Ye M, Wu L", "reference": { "type": "PubMed", "id": "30105866", "url": "https://pubmed.ncbi.nlm.nih.gov/30105866" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "D3DTV9-1", "protein_name": "Protein PRAC2", "gene_name": "PRAC2", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "D3DTV9", "url": "https://www.uniprot.org/uniprotkb/D3DTV9" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "record_id": "pubmed.30105866", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "phosphorylation": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] }, { "title": "Phosphoproteomic screening identifies Rab GTPases as novel downstream targets of PINK1.", "journal": "The EMBO journal", "date": "2015", "authors": "Lai YC, Kondapalli C, Lehneck R, Procter JB, Dill BD, Woodroof HI, Gourlay R, Peggie M, Macartney TJ, Corti O, Corvol JC, Campbell DG, Itzen A, Trost M, Muqit MM", "reference": { "type": "PubMed", "id": "26471730", "url": "https://pubmed.ncbi.nlm.nih.gov/26471730" }, "referenced_glycans": [], "referenced_proteins": [ { "uniprot_canonical_ac": "Q92930-1", "protein_name": "Ras-related protein Rab-8B", "gene_name": "RAB8B", "tax_name": "Human" }, { "uniprot_canonical_ac": "P61006-1", "protein_name": "Ras-related protein Rab-8A", "gene_name": "RAB8A", "tax_name": "Human" } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "Q92930", "url": "https://www.uniprot.org/uniprotkb/Q92930" } ], "common_name": "Human", "glygen_name": "Human", "reference_species": "Homo sapiens [9606]" } ], "phosphorylation": [ { "start_pos": 111, "end_pos": 111, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P61006", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61006" }, { "database": "PubMed", "id": "26471730", "url": "https://pubmed.ncbi.nlm.nih.gov/26471730" }, { "database": "PubMed", "id": "31361120", "url": "https://pubmed.ncbi.nlm.nih.gov/31361120" }, { "database": "PubMed", "id": "31663853", "url": "https://pubmed.ncbi.nlm.nih.gov/31663853" }, { "database": "PubMed", "id": "32227113", "url": "https://pubmed.ncbi.nlm.nih.gov/32227113" } ], "site_lbl": "Ser111", "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 72, "end_pos": 72, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by LRRK2", "evidence": [ { "database": "UniProtKB", "id": "P61006", "url": "https://www.uniprot.org/uniprotkb/P61006" }, { "database": "IntAct", "id": "P61006", "url": "https://www.ebi.ac.uk/intact/interactors/id:P61006*" }, { "database": "iPTMnet", "id": "P61006", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61006" }, { "database": "PubMed", "id": "31663853", "url": "https://pubmed.ncbi.nlm.nih.gov/31663853" }, { "database": "PubMed", "id": "26471730", "url": "https://pubmed.ncbi.nlm.nih.gov/26471730" }, { "database": "PubMed", "id": "29357897", "url": "https://pubmed.ncbi.nlm.nih.gov/29357897" }, { "database": "PubMed", "id": "29482628", "url": "https://pubmed.ncbi.nlm.nih.gov/29482628" }, { "database": "PubMed", "id": "30709905", "url": "https://pubmed.ncbi.nlm.nih.gov/30709905" }, { "database": "PubMed", "id": "32227113", "url": "https://pubmed.ncbi.nlm.nih.gov/32227113" }, { "database": "PubMed", "id": "29125462", "url": "https://pubmed.ncbi.nlm.nih.gov/29125462" }, { "database": "PubMed", "id": "30398148", "url": "https://pubmed.ncbi.nlm.nih.gov/30398148" }, { "database": "PubMed", "id": "26824392", "url": "https://pubmed.ncbi.nlm.nih.gov/26824392" } ], "site_lbl": "Thr72", "uniprot_canonical_ac": "P61006-1" }, { "start_pos": 74, "end_pos": 74, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "P61006", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/P61006" }, { "database": "PubMed", "id": "26471730", "url": "https://pubmed.ncbi.nlm.nih.gov/26471730" } ], "site_lbl": "Thr74", "uniprot_canonical_ac": "P61006-1" } ], "record_id": "pubmed.26471730", "abstract": "", "glycosylation": [], "mutagenesis": [], "snv": [], "glycation": [], "section_stats": [ { "table_id": "referenced_proteins", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "uniprot_canonical_ac", "protein_name", "gene_name", "tax_name" ] }, { "table_id": "referenced_glycans", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl", "uniprot_canonical_ac" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 } ], "sort_fields": [] } ] } ]