[
{
"title": "The LIM protein fhlA is essential for heart chamber development in zebrafish embryos.",
"journal": "Current molecular medicine",
"date": "2013-07",
"authors": "Xie H, Fan X, Tang X, Wan Y, Chen F, Wang X, Wang Y, Li Y, Tang M, Liu D, Jiang Z, Liu X, Yuan W, Li G, Ye X, Zhou J, Mo X, Deng Y, Wu X",
"reference": {
"type": "PubMed",
"id": "23438903",
"url": "https://pubmed.ncbi.nlm.nih.gov/23438903"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8C984-1",
"protein_name": "Myosin light chain kinase 3",
"gene_name": "mylk3",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8C984",
"url": "https://www.uniprot.org/uniprotkb/A8C984"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.23438903",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Inorganic phosphate export by the retrovirus receptor XPR1 in metazoans.",
"journal": "Cell Rep.",
"date": "2013",
"authors": "Giovannini D, Touhami J, Charnet P, Sitbon M, Battini JL",
"reference": {
"type": "PubMed",
"id": "23791524",
"url": "https://pubmed.ncbi.nlm.nih.gov/23791524"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8DZH4-1",
"protein_name": "Solute carrier family 53 member 1",
"gene_name": "xpr1",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q9UBH6-1",
"protein_name": "Solute carrier family 53 member 1",
"gene_name": "XPR1",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8DZH4",
"url": "https://www.uniprot.org/uniprotkb/A8DZH4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.23791524",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "The phosphate exporter xpr1b is required for differentiation of tissue-resident macrophages.",
"journal": "Cell reports",
"date": "2014-09-25",
"authors": "Meireles Ana M, Shiau Celia E, Guenther Catherine A, Sidik Harwin, Kingsley David M, Talbot William S",
"reference": {
"type": "PubMed",
"id": "25220463",
"url": "https://pubmed.ncbi.nlm.nih.gov/25220463"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8DZH4-1",
"protein_name": "Solute carrier family 53 member 1",
"gene_name": "xpr1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8DZH4",
"url": "https://www.uniprot.org/uniprotkb/A8DZH4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.25220463",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Expression of a zebrafish caudal homeobox gene correlates with the establishment of posterior cell lineages at gastrulation.",
"journal": "Differentiation",
"date": "1992",
"authors": "Joly J S, Maury M, Joly C, Duprey P, Boulekbache H, Condamine H",
"reference": {
"type": "PubMed",
"id": "1354191",
"url": "https://pubmed.ncbi.nlm.nih.gov/1354191"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8KBT9-1",
"protein_name": "Homeobox protein CDX-4",
"gene_name": "cdx4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8KBT9",
"url": "https://www.uniprot.org/uniprotkb/A8KBT9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.1354191",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Zebrafish Cdx4 regulates neural crest cell specification and migratory behaviors in the posterior body.",
"journal": "Dev. Biol.",
"date": "2021",
"authors": "Rocha Manuel, Kushkowski Elaine, Schnirman Ruby, Booth Clare, Singh Noor, Beadell Alana, Prince Victoria E",
"reference": {
"type": "PubMed",
"id": "34389276",
"url": "https://pubmed.ncbi.nlm.nih.gov/34389276"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8KBT9-1",
"protein_name": "Homeobox protein CDX-4",
"gene_name": "cdx4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8KBT9",
"url": "https://www.uniprot.org/uniprotkb/A8KBT9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.34389276",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Hand2 delineates mesothelium progenitors and is reactivated in mesothelioma.",
"journal": "Nat. Commun.",
"date": "2022",
"authors": "Prummel KD, Crowell HL, Nieuwenhuize S, Brombacher EC, Daetwyler S, Soneson C, Kresoja-Rakic J, Kocere A, Ronner M, Ernst A, Labbaf Z, Clouthier DE, Firulli AB, Sanchez-Iranzo H, Naganathan SR, O'Rourke R, Raz E, Mercader N, Burger A, Felley-Bosco E, Huisken J, Robinson MD, Mosimann C",
"reference": {
"type": "PubMed",
"id": "35354817",
"url": "https://pubmed.ncbi.nlm.nih.gov/35354817"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8KBT9-1",
"protein_name": "Homeobox protein CDX-4",
"gene_name": "cdx4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8KBT9",
"url": "https://www.uniprot.org/uniprotkb/A8KBT9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.35354817",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Analysis of FGF function in normal and no tail zebrafish embryos reveals separate mechanisms for formation of the trunk and the tail.",
"journal": "Development",
"date": "1995",
"authors": "Griffin K, Patient R, Holder N",
"reference": {
"type": "PubMed",
"id": "7555724",
"url": "https://pubmed.ncbi.nlm.nih.gov/7555724"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8KBT9-1",
"protein_name": "Homeobox protein CDX-4",
"gene_name": "cdx4",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "O13148-1",
"protein_name": "Ephrin type-A receptor 4a",
"gene_name": "epha4a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8KBT9",
"url": "https://www.uniprot.org/uniprotkb/A8KBT9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.7555724",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Zebrafish wnt8 and wnt8b share a common activity but are involved in distinct developmental pathways.",
"journal": "Development",
"date": "1995",
"authors": "Kelly G M, Greenstein P, Erezyilmaz D F, Moon R T",
"reference": {
"type": "PubMed",
"id": "7600994",
"url": "https://pubmed.ncbi.nlm.nih.gov/7600994"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8KBT9-1",
"protein_name": "Homeobox protein CDX-4",
"gene_name": "cdx4",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "P51029-1",
"protein_name": "Protein Wnt-8b",
"gene_name": "wnt8b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q90YL8-1",
"protein_name": "Protein Wnt",
"gene_name": "wnt8-2",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "P51028-1",
"protein_name": "Protein Wnt-8a",
"gene_name": "wnt8a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8KBT9",
"url": "https://www.uniprot.org/uniprotkb/A8KBT9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.7600994",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 4
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Ultraviolet irradiation impairs epiboly in zebrafish embryos: evidence for a microtubule-dependent mechanism of epiboly.",
"journal": "Development",
"date": "1993",
"authors": "Str\u00e4hle U, Jesuthasan S",
"reference": {
"type": "PubMed",
"id": "8187646",
"url": "https://pubmed.ncbi.nlm.nih.gov/8187646"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8KBT9-1",
"protein_name": "Homeobox protein CDX-4",
"gene_name": "cdx4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8KBT9",
"url": "https://www.uniprot.org/uniprotkb/A8KBT9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.8187646",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Cyp27c1 Red-Shifts the Spectral Sensitivity of Photoreceptors by Converting Vitamin A1 into A2.",
"journal": "Current biology : CB",
"date": "2015-12-07",
"authors": "Enright Jennifer M, Toomey Matthew B, Sato Shin-ya, Temple Shelby E, Allen James R, Fujiwara Rina, Kramlinger Valerie M, Nagy Leslie D, Johnson Kevin M, Xiao Yi, How Martin J, Johnson Stephen L, Roberts Nicholas W, Kefalov Vladimir J, Guengerich F Peter, Corbo Joseph C",
"reference": {
"type": "PubMed",
"id": "26549260",
"url": "https://pubmed.ncbi.nlm.nih.gov/26549260"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A8WGA0-1",
"protein_name": "Cytochrome P450 27C1",
"gene_name": "cyp27c1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A8WGA0",
"url": "https://www.uniprot.org/uniprotkb/A8WGA0"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.26549260",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "An alternative isomerohydrolase in the retinal M\u00fcller cells of a cone-dominant species.",
"journal": "The FEBS journal",
"date": "2011-08",
"authors": "Takahashi Yusuke, Moiseyev Gennadiy, Chen Ying, Nikolaeva Olga, Ma Jian-Xing",
"reference": {
"type": "PubMed",
"id": "21676174",
"url": "https://pubmed.ncbi.nlm.nih.gov/21676174"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A9C3R8-1",
"protein_name": "Retinal Mueller cells isomerohydrolase",
"gene_name": "rpe65c",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A9C3R8",
"url": "https://www.uniprot.org/uniprotkb/A9C3R8"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.21676174",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Identification of the key residues determining the product specificity of isomerohydrolase.",
"journal": "Biochemistry",
"date": "2012-05-22",
"authors": "Takahashi Yusuke, Moiseyev Gennadiy, Nikolaeva Olga, Ma Jian-xing",
"reference": {
"type": "PubMed",
"id": "22512451",
"url": "https://pubmed.ncbi.nlm.nih.gov/22512451"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A9C3R8-1",
"protein_name": "Retinal Mueller cells isomerohydrolase",
"gene_name": "rpe65c",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A9C3R8",
"url": "https://www.uniprot.org/uniprotkb/A9C3R8"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.22512451",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "An enzymatic mechanism for generating the precursor of endogenous 13-cis retinoic acid in the brain.",
"journal": "The FEBS journal",
"date": "2011-04",
"authors": "Takahashi Yusuke, Moiseyev Gennadiy, Chen Ying, Farjo Krysten, Nikolaeva Olga, Ma Jian-Xing",
"reference": {
"type": "PubMed",
"id": "21235714",
"url": "https://pubmed.ncbi.nlm.nih.gov/21235714"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A9C3R9-1",
"protein_name": "All-trans-retinyl ester 13-cis isomerohydrolase",
"gene_name": "rpe65b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A9C3R9",
"url": "https://www.uniprot.org/uniprotkb/A9C3R9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.21235714",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "KCTD13 is a major driver of mirrored neuroanatomical phenotypes of the 16p11.2 copy number variant.",
"journal": "Nature",
"date": "2012",
"authors": "Golzio Christelle, Willer Jason, Talkowski Michael E, Oh Edwin C, Taniguchi Yu, Jacquemont S\u00e9bastien, Reymond Alexandre, Sun Mei, Sawa Akira, Gusella James F, Kamiya Atsushi, Beckmann Jacques S, Katsanis Nicholas",
"reference": {
"type": "PubMed",
"id": "22596160",
"url": "https://pubmed.ncbi.nlm.nih.gov/22596160"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "A9ULR9-1",
"protein_name": "BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1",
"gene_name": "kctd13",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q8WZ19-1",
"protein_name": "BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1",
"gene_name": "KCTD13",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "Q8BGV7-1",
"protein_name": "BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 1",
"gene_name": "Kctd13",
"tax_name": "Mouse"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "A9ULR9",
"url": "https://www.uniprot.org/uniprotkb/A9ULR9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.22596160",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 3
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Molecular cloning and developmental expression of plakophilin 2 in zebrafish.",
"journal": "Biochem. Biophys. Res. Commun.",
"date": "2008",
"authors": "Moriarty Miriam A, Martin Eva D, Byrnes Lucy, Grealy Maura",
"reference": {
"type": "PubMed",
"id": "18164260",
"url": "https://pubmed.ncbi.nlm.nih.gov/18164260"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0BF33-1",
"protein_name": "Plakophilin-2",
"gene_name": "pkp2",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0BF33",
"url": "https://www.uniprot.org/uniprotkb/B0BF33"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.18164260",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Loss of plakophilin 2 disrupts heart development in zebrafish.",
"journal": "The International journal of developmental biology",
"date": "2012",
"authors": "Moriarty Miriam A, Ryan Rebecca, Lalor Pierce, Dockery Peter, Byrnes Lucy, Grealy Maura",
"reference": {
"type": "PubMed",
"id": "23124967",
"url": "https://pubmed.ncbi.nlm.nih.gov/23124967"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0BF33-1",
"protein_name": "Plakophilin-2",
"gene_name": "pkp2",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0BF33",
"url": "https://www.uniprot.org/uniprotkb/B0BF33"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.23124967",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Proneural gene requirement for hair cell differentiation in the zebrafish lateral line.",
"journal": "Dev. Biol.",
"date": "2006",
"authors": "Sarrazin Andres F, Villablanca Eduardo J, Nu\u00f1ez Viviana A, Sandoval Pablo C, Ghysen Alain, Allende Miguel L",
"reference": {
"type": "PubMed",
"id": "16678150",
"url": "https://pubmed.ncbi.nlm.nih.gov/16678150"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0R059-1",
"protein_name": "Protein atonal homolog 1a",
"gene_name": "atoh1a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0R059",
"url": "https://www.uniprot.org/uniprotkb/B0R059"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.16678150",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Atoh1a expression must be restricted by Notch signaling for effective morphogenesis of the posterior lateral line primordium in zebrafish.",
"journal": "Development",
"date": "2010",
"authors": "Matsuda Miho, Chitnis Ajay B",
"reference": {
"type": "PubMed",
"id": "20876657",
"url": "https://pubmed.ncbi.nlm.nih.gov/20876657"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0R059-1",
"protein_name": "Protein atonal homolog 1a",
"gene_name": "atoh1a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0R059",
"url": "https://www.uniprot.org/uniprotkb/B0R059"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.20876657",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Sox2 and Fgf interact with Atoh1 to promote sensory competence throughout the zebrafish inner ear.",
"journal": "Dev. Biol.",
"date": "2011",
"authors": "Sweet Elly M, Vemaraju Shruti, Riley Bruce B",
"reference": {
"type": "PubMed",
"id": "21801718",
"url": "https://pubmed.ncbi.nlm.nih.gov/21801718"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0R059-1",
"protein_name": "Protein atonal homolog 1a",
"gene_name": "atoh1a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0R059",
"url": "https://www.uniprot.org/uniprotkb/B0R059"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.21801718",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "foxg1a is required for hair cell development and regeneration in the zebrafish lateral line.",
"journal": "Biol. Open",
"date": "2024",
"authors": "Turner E.M., McGraw H.F., Bell J.M., Biesemeyer C., Hendricks R., Vanderbeck M.M.",
"reference": {
"type": "PubMed",
"id": "39301848",
"url": "https://pubmed.ncbi.nlm.nih.gov/39301848"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0R059-1",
"protein_name": "Protein atonal homolog 1a",
"gene_name": "atoh1a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0R059",
"url": "https://www.uniprot.org/uniprotkb/B0R059"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.39301848",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Overexpression of neurogenin induces ectopic expression of HuC in zebrafish.",
"journal": "Neurosci. Lett.",
"date": "1997",
"authors": "Kim C H, Bae Y K, Yamanaka Y, Yamashita S, Shimizu T, Fujii R, Park H C, Yeo S Y, Huh T L, Hibi M, Hirano T",
"reference": {
"type": "PubMed",
"id": "9469669",
"url": "https://pubmed.ncbi.nlm.nih.gov/9469669"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0R059-1",
"protein_name": "Protein atonal homolog 1a",
"gene_name": "atoh1a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "O42606-1",
"protein_name": "Neurogenin-1",
"gene_name": "neurog1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0R059",
"url": "https://www.uniprot.org/uniprotkb/B0R059"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.9469669",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Identification and characterization of a novel fibronectin in zebrafish.",
"journal": "Exp. Cell Res.",
"date": "2001",
"authors": "Zhao Q, Liu X, Collodi P",
"reference": {
"type": "PubMed",
"id": "11478847",
"url": "https://pubmed.ncbi.nlm.nih.gov/11478847"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0S602-1",
"protein_name": "Fibronectin",
"gene_name": "fn1a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0S602",
"url": "https://www.uniprot.org/uniprotkb/B0S602"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.11478847",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Novel form of fibronectin from zebrafish mediates infectious hematopoietic necrosis virus infection.",
"journal": "J. Virol.",
"date": "2002",
"authors": "Liu Xiangyu, Collodi Paul",
"reference": {
"type": "PubMed",
"id": "11752139",
"url": "https://pubmed.ncbi.nlm.nih.gov/11752139"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0S602-1",
"protein_name": "Fibronectin",
"gene_name": "fn1a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0S602",
"url": "https://www.uniprot.org/uniprotkb/B0S602"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.11752139",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Fgf3 and Fgf8 dependent and independent transcription factors are required for otic placode specification.",
"journal": "Development",
"date": "2003",
"authors": "Liu Dong, Chu Hsin, Maves Lisa, Yan Yi-Lin, Morcos Paul A, Postlethwait John H, Westerfield Monte",
"reference": {
"type": "PubMed",
"id": "12668634",
"url": "https://pubmed.ncbi.nlm.nih.gov/12668634"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0S602-1",
"protein_name": "Fibronectin",
"gene_name": "fn1a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0S602",
"url": "https://www.uniprot.org/uniprotkb/B0S602"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.12668634",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Fibronectin and Hand2 influence tubulogenesis during pronephros development and mesonephros regeneration in zebrafish (Danio rerio).",
"journal": "PLoS ONE",
"date": "2024",
"authors": "Garavito-Aguilar Z.V., Acosta-Virguez E., Avila-Jimenez E., Otalora-Tarazona S., Pineros-Romero C.C., Sanabria-Camargo C.A., Uribe-Montes L.C.",
"reference": {
"type": "PubMed",
"id": "39240899",
"url": "https://pubmed.ncbi.nlm.nih.gov/39240899"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0S602-1",
"protein_name": "Fibronectin",
"gene_name": "fn1a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "P57102-1",
"protein_name": "Heart- and neural crest derivatives-expressed protein 2",
"gene_name": "hand2",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0S602",
"url": "https://www.uniprot.org/uniprotkb/B0S602"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.39240899",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Mutations affecting the cardiovascular system and other internal organs in zebrafish.",
"journal": "Development",
"date": "1996",
"authors": "Chen J N, Haffter P, Odenthal J, Vogelsang E, Brand M, van Eeden F J, Furutani-Seiki M, Granato M, Hammerschmidt M, Heisenberg C P, Jiang Y J, Kane D A, Kelsh R N, Mullins M C, N\u00fcsslein-Volhard C",
"reference": {
"type": "PubMed",
"id": "9007249",
"url": "https://pubmed.ncbi.nlm.nih.gov/9007249"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0S602-1",
"protein_name": "Fibronectin",
"gene_name": "fn1a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "F1REV3-1",
"protein_name": "Krev interaction trapped protein 1",
"gene_name": "krit1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0S602",
"url": "https://www.uniprot.org/uniprotkb/B0S602"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.9007249",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "One melanocortin 4 and two melanocortin 5 receptors from zebrafish show remarkable conservation in structure and pharmacology.",
"journal": "J. Neurochem.",
"date": "2002",
"authors": "Ringholm Aneta, Fredriksson Robert, Poliakova Natalia, Yan Yi-Lin, Postlethwait John H, Larhammar Dan, Schi\u00f6th Helgi B",
"reference": {
"type": "PubMed",
"id": "12091460",
"url": "https://pubmed.ncbi.nlm.nih.gov/12091460"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0V1P1-1",
"protein_name": "Melanocortin receptor 4",
"gene_name": "mc4r",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0V1P1",
"url": "https://www.uniprot.org/uniprotkb/B0V1P1"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.12091460",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Developmental control of the melanocortin-4 receptor by MRAP2 proteins in zebrafish.",
"journal": "Science (New York, N.Y.)",
"date": "2013-07-19",
"authors": "Sebag Julien A, Zhang Chao, Hinkle Patricia M, Bradshaw Amanda M, Cone Roger D",
"reference": {
"type": "PubMed",
"id": "23869017",
"url": "https://pubmed.ncbi.nlm.nih.gov/23869017"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B0V1P1-1",
"protein_name": "Melanocortin receptor 4",
"gene_name": "mc4r",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "F8W4H9-1",
"protein_name": "Melanocortin-2 receptor accessory protein 2A",
"gene_name": "mrap2a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "P0DM64-1",
"protein_name": "Melanocortin-2 receptor accessory protein 2B",
"gene_name": "mrap2b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B0V1P1",
"url": "https://www.uniprot.org/uniprotkb/B0V1P1"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.23869017",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 3
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Cystic kidney gene seahorse regulates cilia-mediated processes and Wnt pathways.",
"journal": "Developmental cell",
"date": "2008-06",
"authors": "Kishimoto Norihito, Cao Ying, Park Alice, Sun Zhaoxia",
"reference": {
"type": "PubMed",
"id": "18539122",
"url": "https://pubmed.ncbi.nlm.nih.gov/18539122"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DH20-1",
"protein_name": "Dynein axonemal assembly factor 11",
"gene_name": "dnaaf11",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DH20",
"url": "https://www.uniprot.org/uniprotkb/B3DH20"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.18539122",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Mutations in zebrafish leucine-rich repeat-containing six-like affect cilia motility and result in pronephric cysts, but have variable effects on left-right patterning.",
"journal": "Development (Cambridge, England)",
"date": "2009-05",
"authors": "Serluca Fabrizio C, Xu Bo, Okabe Noriko, Baker Kari, Lin Shin-Yi, Sullivan-Brown Jessica, Konieczkowski David J, Jaffe Kimberly M, Bradner Joshua M, Fishman Mark C, Burdine Rebecca D",
"reference": {
"type": "PubMed",
"id": "19395640",
"url": "https://pubmed.ncbi.nlm.nih.gov/19395640"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DH20-1",
"protein_name": "Dynein axonemal assembly factor 11",
"gene_name": "dnaaf11",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DH20",
"url": "https://www.uniprot.org/uniprotkb/B3DH20"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.19395640",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "c21orf59/kurly controls both cilia motility and polarization.",
"journal": "Cell Rep.",
"date": "2016",
"authors": "Jaffe KM, Grimes DT, Schottenfeld-Roames J, Werner ME, Ku TS, Kim SK, Pelliccia JL, Morante NF, Mitchell BJ, Burdine RD",
"reference": {
"type": "PubMed",
"id": "26904945",
"url": "https://pubmed.ncbi.nlm.nih.gov/26904945"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DH20-1",
"protein_name": "Dynein axonemal assembly factor 11",
"gene_name": "dnaaf11",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q6DRC3-1",
"protein_name": "Cilia- and flagella-associated protein 298",
"gene_name": "cfap298",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DH20",
"url": "https://www.uniprot.org/uniprotkb/B3DH20"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"mutagenesis": [
{
"start_pos": 44,
"end_pos": 44,
"sequence_org": "I",
"sequence_mut": "N",
"comment": "In tm304; temperature sensitive allele with strongest phenotypes at 32 degrees Celsius and milder phenotypes at 25 degrees Celsius. Body curvature defects and kidney cysts are seen in larval stages. Left-right asymmetry is abnormal with reversed or random positioning of heart, liver and pancreas. Males are infertile. Cilium length and number are unaffected. Initiation of cilium motility is impaired, and cilium outer dynein arms are absent. Cilium polarity is disorganized.",
"evidence": [
{
"database": "UniProtKB",
"id": "Q6DRC3",
"url": "https://www.uniprot.org/uniprotkb/Q6DRC3"
},
{
"database": "PubMed",
"id": "26904945",
"url": "https://pubmed.ncbi.nlm.nih.gov/26904945"
}
],
"uniprot_canonical_ac": "Q6DRC3-1"
}
],
"record_id": "pubmed.26904945",
"abstract": "",
"glycosylation": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Early stages of zebrafish eye formation require the coordinated activity of Wnt11, Fz5, and the Wnt/beta-catenin pathway.",
"journal": "Neuron",
"date": "2005-07-07",
"authors": "Cavodeassi Florencia, Carreira-Barbosa Filipa, Young Rodrigo M, Concha Miguel L, Allende Miguel L, Houart Corinne, Tada Masazumi, Wilson Stephen W",
"reference": {
"type": "PubMed",
"id": "15996547",
"url": "https://pubmed.ncbi.nlm.nih.gov/15996547"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DIG4-1",
"protein_name": "Frizzled-5",
"gene_name": "fzd5",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "O73864-1",
"protein_name": "Protein Wnt-11",
"gene_name": "wnt11f2; wnt11",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "P51029-1",
"protein_name": "Protein Wnt-8b",
"gene_name": "wnt8b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DIG4",
"url": "https://www.uniprot.org/uniprotkb/B3DIG4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.15996547",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 3
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "A secreted WNT-ligand-binding domain of FZD5 generated by a frameshift mutation causes autosomal dominant coloboma.",
"journal": "Hum. Mol. Genet.",
"date": "2016",
"authors": "Liu Chunqiao, Widen Sonya A, Williamson Kathleen A, Ratnapriya Rinki, Gerth-Kahlert Christina, Rainger Joe, Alur Ramakrishna P, Strachan Erin, Manjunath Souparnika H, Balakrishnan Archana, Floyd James A, , Li Tiansen, Waskiewicz Andrew, Brooks Brian P, Lehmann Ordan J, FitzPatrick David R, Swaroop Anand",
"reference": {
"type": "PubMed",
"id": "26908622",
"url": "https://pubmed.ncbi.nlm.nih.gov/26908622"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DIG4-1",
"protein_name": "Frizzled-5",
"gene_name": "fzd5",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q13467-1",
"protein_name": "Frizzled-5",
"gene_name": "FZD5",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "P56704-1",
"protein_name": "Protein Wnt-3a",
"gene_name": "WNT3A",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "O00755-1",
"protein_name": "Protein Wnt-7a",
"gene_name": "WNT7A",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DIG4",
"url": "https://www.uniprot.org/uniprotkb/B3DIG4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.26908622",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 4
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Mutations in KLHL40 are a frequent cause of severe autosomal-recessive nemaline myopathy.",
"journal": "American journal of human genetics",
"date": "2013",
"authors": "Ravenscroft G, Miyatake S, Lehtokari VL, Todd EJ, Vornanen P, Yau KS, Hayashi YK, Miyake N, Tsurusaki Y, Doi H, Saitsu H, Osaka H, Yamashita S, Ohya T, Sakamoto Y, Koshimizu E, Imamura S, Yamashita M, Ogata K, Shiina M, Bryson-Richardson RJ, Vaz R, Ceyhan O, Brownstein CA, Swanson LC, Monnot S, Romero NB, Amthor H, Kresoje N, Sivadorai P, Kiraly-Borri C, Haliloglu G, Talim B, Orhan D, Kale G, Charles AK, Fabian VA, Davis MR, Lammens M, Sewry CA, Manzur A, Muntoni F, Clarke NF, North KN, Bertini E, Nevo Y, Willichowski E, Silberg IE, Topaloglu H, Beggs AH, Allcock RJ, Nishino I, Wallgren-Pettersson C, Matsumoto N, Laing NG",
"reference": {
"type": "PubMed",
"id": "23746549",
"url": "https://pubmed.ncbi.nlm.nih.gov/23746549"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DIV9-1",
"protein_name": "Kelch-like protein 40a",
"gene_name": "klhl40a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "E9QJ30-1",
"protein_name": "Kelch-like protein 40b",
"gene_name": "klhl40b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q2TBA0-1",
"protein_name": "Kelch-like protein 40",
"gene_name": "KLHL40",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "Q9D783-1",
"protein_name": "Kelch-like protein 40",
"gene_name": "Klhl40",
"tax_name": "Mouse"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DIV9",
"url": "https://www.uniprot.org/uniprotkb/B3DIV9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.23746549",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 4
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Zebrafish mutants with disrupted early T-cell and thymus development identified in early pressure screen.",
"journal": "Dev. Dyn.",
"date": "2008",
"authors": "Trede Nikolaus S, Ota Tatsuya, Kawasaki Hirohide, Paw Barry H, Katz Tammisty, Demarest Bradley, Hutchinson Sarah, Zhou Yi, Hersey Candace, Zapata Agustin, Amemiya Chris T, Zon Leonard I",
"reference": {
"type": "PubMed",
"id": "18729230",
"url": "https://pubmed.ncbi.nlm.nih.gov/18729230"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DJT0-1",
"protein_name": "Spliceosome associated factor 3, U4/U6 recycling protein",
"gene_name": "sart3",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DJT0",
"url": "https://www.uniprot.org/uniprotkb/B3DJT0"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.18729230",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Large-scale forward genetic screening analysis of development of hematopoiesis in zebrafish.",
"journal": "J. Genet. Genomics",
"date": "2012",
"authors": "Wang Kun, Huang Zhibin, Zhao Lingfeng, Liu Wei, Chen Xiaohui, Meng Ping, Lin Qing, Chi Yali, Xu Mengchang, Ma Ning, Zhang Yiyue, Zhang Wenqing",
"reference": {
"type": "PubMed",
"id": "23021547",
"url": "https://pubmed.ncbi.nlm.nih.gov/23021547"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DJT0-1",
"protein_name": "Spliceosome associated factor 3, U4/U6 recycling protein",
"gene_name": "sart3",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DJT0",
"url": "https://www.uniprot.org/uniprotkb/B3DJT0"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.23021547",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Zebrafish as a model for understanding the evolution of the vertebrate immune system and human primary immunodeficiency.",
"journal": "Exp. Hematol.",
"date": "2014",
"authors": "Iwanami Norimasa",
"reference": {
"type": "PubMed",
"id": "24824573",
"url": "https://pubmed.ncbi.nlm.nih.gov/24824573"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DJT0-1",
"protein_name": "Spliceosome associated factor 3, U4/U6 recycling protein",
"gene_name": "sart3",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DJT0",
"url": "https://www.uniprot.org/uniprotkb/B3DJT0"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.24824573",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "The spliceosome factor sart3 regulates hematopoietic stem/progenitor cell development in zebrafish through the p53 pathway.",
"journal": "Cell Death Dis.",
"date": "2021",
"authors": "Zhao Yan, Wu Mei, Li Jing, Meng Ping, Chen Jiakui, Huang Zhibin, Xu Jin, Wen Zilong, Zhang Wenqing, Zhang Yiyue",
"reference": {
"type": "PubMed",
"id": "34611130",
"url": "https://pubmed.ncbi.nlm.nih.gov/34611130"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3DJT0-1",
"protein_name": "Spliceosome associated factor 3, U4/U6 recycling protein",
"gene_name": "sart3",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q7ZUW7-1",
"protein_name": "Protein Mdm4",
"gene_name": "mdm4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3DJT0",
"url": "https://www.uniprot.org/uniprotkb/B3DJT0"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.34611130",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Duplication of the IGFBP-2 gene in teleost fish: protein structure and functionality conservation and gene expression divergence.",
"journal": "PloS one",
"date": "2008",
"authors": "Zhou J, Li W, Kamei H, Duan C",
"reference": {
"type": "PubMed",
"id": "19081843",
"url": "https://pubmed.ncbi.nlm.nih.gov/19081843"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3F211-1",
"protein_name": "Insulin-like growth factor-binding protein 2-B",
"gene_name": "igfbp2b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q9PTH3-1",
"protein_name": "Insulin-like growth factor-binding protein 2-A",
"gene_name": "igfbp2a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "P18065-1",
"protein_name": "Insulin-like growth factor-binding protein 2",
"gene_name": "IGFBP2",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3F211",
"url": "https://www.uniprot.org/uniprotkb/B3F211"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"mutagenesis": [
{
"start_pos": 216,
"end_pos": 219,
"sequence_org": "KKLR",
"sequence_mut": "NNLA",
"comment": "Does not disrupt growth-inhibiting activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P18065",
"url": "https://www.uniprot.org/uniprotkb/P18065"
},
{
"database": "PubMed",
"id": "19081843",
"url": "https://pubmed.ncbi.nlm.nih.gov/19081843"
}
],
"uniprot_canonical_ac": "P18065-1"
},
{
"start_pos": 303,
"end_pos": 303,
"sequence_org": "D",
"sequence_mut": "E",
"comment": "Does not disrupt growth-inhibiting activity. Loss of endothelial progenitor cells-endothelial adhesion activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "P18065",
"url": "https://www.uniprot.org/uniprotkb/P18065"
},
{
"database": "PubMed",
"id": "19081843",
"url": "https://pubmed.ncbi.nlm.nih.gov/19081843"
},
{
"database": "PubMed",
"id": "26076738",
"url": "https://pubmed.ncbi.nlm.nih.gov/26076738"
}
],
"uniprot_canonical_ac": "P18065-1"
}
],
"record_id": "pubmed.19081843",
"abstract": "",
"glycosylation": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 3
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Evolution of the insulin-like growth factor binding protein (IGFBP) family.",
"journal": "Endocrinology",
"date": "2011",
"authors": "Daza Daniel Ocampo, Sundstr\u00f6m G\u00f6rel, Bergqvist Christina A, Duan Cunming, Larhammar Dan",
"reference": {
"type": "PubMed",
"id": "21505050",
"url": "https://pubmed.ncbi.nlm.nih.gov/21505050"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3F211-1",
"protein_name": "Insulin-like growth factor-binding protein 2-B",
"gene_name": "igfbp2b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB40E5I1-1",
"protein_name": "Insulin-like growth factor-binding protein 6a precursor",
"gene_name": "igfbp6a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "F6N9E8-1",
"protein_name": "Insulin-like growth factor-binding protein 6",
"gene_name": "igfbp6b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3F211",
"url": "https://www.uniprot.org/uniprotkb/B3F211"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.21505050",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 3
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Insulin-like growth factor (IGF) signalling and genome-wide transcriptional regulation in fast muscle of zebrafish following a single-satiating meal.",
"journal": "J. Exp. Biol.",
"date": "2011",
"authors": "Amaral Ian P G, Johnston Ian A",
"reference": {
"type": "PubMed",
"id": "21653807",
"url": "https://pubmed.ncbi.nlm.nih.gov/21653807"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3F211-1",
"protein_name": "Insulin-like growth factor-binding protein 2-B",
"gene_name": "igfbp2b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0A8M1NAI0-1",
"protein_name": "Krueppel-like factor 11b",
"gene_name": "klf11b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB40E5I1-1",
"protein_name": "Insulin-like growth factor-binding protein 6a precursor",
"gene_name": "igfbp6a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "F6N9E8-1",
"protein_name": "Insulin-like growth factor-binding protein 6",
"gene_name": "igfbp6b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A5PMC4-1",
"protein_name": "Vesicular integral-membrane protein VIP36 precursor",
"gene_name": "lman2",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3F211",
"url": "https://www.uniprot.org/uniprotkb/B3F211"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.21653807",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 5
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Follicle-Stimulating Hormone Regulates igfbp Gene Expression Directly or via Downstream Effectors to Modulate Igf3 Effects on Zebrafish Spermatogenesis.",
"journal": "Front. Endocrinol.",
"date": "2017",
"authors": "Safian Diego, van der Kant Henk J G, Crespo Diego, Bogerd Jan, Schulz R\u00fcdiger W",
"reference": {
"type": "PubMed",
"id": "29209278",
"url": "https://pubmed.ncbi.nlm.nih.gov/29209278"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3F211-1",
"protein_name": "Insulin-like growth factor-binding protein 2-B",
"gene_name": "igfbp2b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3F211",
"url": "https://www.uniprot.org/uniprotkb/B3F211"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.29209278",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Real-time PCR array to study the effects of chemicals on the growth hormone/insulin-like growth factors (GH/IGFs) axis of zebrafish embryos/larvae.",
"journal": "Chemosphere",
"date": "2018",
"authors": "Dang Yao, Wang Fei'er, Liu Chunsheng",
"reference": {
"type": "PubMed",
"id": "29803886",
"url": "https://pubmed.ncbi.nlm.nih.gov/29803886"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3F211-1",
"protein_name": "Insulin-like growth factor-binding protein 2-B",
"gene_name": "igfbp2b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3F211",
"url": "https://www.uniprot.org/uniprotkb/B3F211"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.29803886",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Insulin-like growth factor binding proteins inhibit oocyte maturation of zebrafish.",
"journal": "Gen. Comp. Endocrinol.",
"date": "2019",
"authors": "Li Jianzhen, Wang Yamei, Kang Tao, Li Xuehui, Niu Caiyan",
"reference": {
"type": "PubMed",
"id": "31170402",
"url": "https://pubmed.ncbi.nlm.nih.gov/31170402"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3F211-1",
"protein_name": "Insulin-like growth factor-binding protein 2-B",
"gene_name": "igfbp2b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB40E5I1-1",
"protein_name": "Insulin-like growth factor-binding protein 6a precursor",
"gene_name": "igfbp6a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "F6N9E8-1",
"protein_name": "Insulin-like growth factor-binding protein 6",
"gene_name": "igfbp6b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3F211",
"url": "https://www.uniprot.org/uniprotkb/B3F211"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.31170402",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 3
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "HMGA2 contributes to vascular development and sprouting angiogenesis by promoting IGFBP2 production.",
"journal": "Exp. Cell Res.",
"date": "2021",
"authors": "Wang J, Chen Y, Zeng Z, Feng R, Wang Q, Zhang Q, Sun K, Chen AF, Lu Y, Yu Y",
"reference": {
"type": "PubMed",
"id": "34547256",
"url": "https://pubmed.ncbi.nlm.nih.gov/34547256"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3F211-1",
"protein_name": "Insulin-like growth factor-binding protein 2-B",
"gene_name": "igfbp2b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0A8M6YTH0-1",
"protein_name": "Death effector domain-containing 1",
"gene_name": "dedd1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3F211",
"url": "https://www.uniprot.org/uniprotkb/B3F211"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.34547256",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Estrogen signaling characteristics of Atlantic croaker G protein-coupled receptor 30 (GPR30) and evidence it is involved in maintenance of oocyte meiotic arrest.",
"journal": "Endocrinology",
"date": "2008-07",
"authors": "Pang Yefei, Dong Jing, Thomas Peter",
"reference": {
"type": "PubMed",
"id": "18420744",
"url": "https://pubmed.ncbi.nlm.nih.gov/18420744"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3G515-1",
"protein_name": "G protein-coupled estrogen receptor 1",
"gene_name": "gper1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3G515",
"url": "https://www.uniprot.org/uniprotkb/B3G515"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.18420744",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Identification of a membrane estrogen receptor in zebrafish with homology to mammalian GPER and its high expression in early germ cells of the testis.",
"journal": "Biology of reproduction",
"date": "2009-06",
"authors": "Liu Xiaochun, Zhu Pei, Sham Kathy W Y, Yuen Jacky M L, Xie Chuanming, Zhang Yong, Liu Yun, Li Shuisheng, Huang Xigui, Cheng Christopher H K, Lin Haoran",
"reference": {
"type": "PubMed",
"id": "19228597",
"url": "https://pubmed.ncbi.nlm.nih.gov/19228597"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3G515-1",
"protein_name": "G protein-coupled estrogen receptor 1",
"gene_name": "gper1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3G515",
"url": "https://www.uniprot.org/uniprotkb/B3G515"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.19228597",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Role of G protein-coupled estrogen receptor 1, GPER, in inhibition of oocyte maturation by endogenous estrogens in zebrafish.",
"journal": "Developmental biology",
"date": "2010-06-15",
"authors": "Pang Yefei, Thomas Peter",
"reference": {
"type": "PubMed",
"id": "20382141",
"url": "https://pubmed.ncbi.nlm.nih.gov/20382141"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3G515-1",
"protein_name": "G protein-coupled estrogen receptor 1",
"gene_name": "gper1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3G515",
"url": "https://www.uniprot.org/uniprotkb/B3G515"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.20382141",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "G-protein-coupled estrogen receptor 1 is involved in brain development during zebrafish (Danio rerio) embryogenesis.",
"journal": "Biochemical and biophysical research communications",
"date": "2013-05-24",
"authors": "Shi Yanan, Liu Xiaochun, Zhu Pei, Li Jianzhen, Sham Kathy W Y, Cheng Shuk Han, Li Shuisheng, Zhang Yong, Cheng Christopher H K, Lin Haoran",
"reference": {
"type": "PubMed",
"id": "23583372",
"url": "https://pubmed.ncbi.nlm.nih.gov/23583372"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B3G515-1",
"protein_name": "G protein-coupled estrogen receptor 1",
"gene_name": "gper1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B3G515",
"url": "https://www.uniprot.org/uniprotkb/B3G515"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.23583372",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "AmotL2 integrates polarity and junctional cues to modulate cell shape.",
"journal": "Sci. Rep.",
"date": "2017",
"authors": "Hultin Sara, Subramani Aravindh, Hildebrand Sebastian, Zheng Yujuan, Majumdar Arindam, Holmgren Lars",
"reference": {
"type": "PubMed",
"id": "28790366",
"url": "https://pubmed.ncbi.nlm.nih.gov/28790366"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B8A5S6-1",
"protein_name": "Angiomotin-like 2b",
"gene_name": "amotl2b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B8A5S6",
"url": "https://www.uniprot.org/uniprotkb/B8A5S6"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.28790366",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Canonical Wnt Signaling Remodels Lipid Metabolism in Zebrafish Hepatocytes following Ras Oncogenic Insult.",
"journal": "Cancer Res.",
"date": "2018",
"authors": "Yao Yuxiao, Sun Shaoyang, Wang Jingjing, Fei Fei, Dong Zhaoru, Ke Ai-Wu, He Ruoyu, Wang Lei, Zhang Lili, Ji Min-Biao, Li Qiang, Yu Min, Shi Guo-Ming, Fan Jia, Gong Zhiyuan, Wang Xu",
"reference": {
"type": "PubMed",
"id": "30065049",
"url": "https://pubmed.ncbi.nlm.nih.gov/30065049"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B8JLM0-1",
"protein_name": "Choline/ethanolaminephosphotransferase 1",
"gene_name": "cept1a",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0A8M1PDR3-1",
"protein_name": "3.1.3.4; Phospholipid phosphatase 2b",
"gene_name": "plpp2b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B8JLM0",
"url": "https://www.uniprot.org/uniprotkb/B8JLM0"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.30065049",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Carboxypeptidase O is a glycosylphosphatidylinositol-anchored intestinal peptidase with acidic amino acid specificity.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Lyons PJ, Fricker LD",
"reference": {
"type": "PubMed",
"id": "21921028",
"url": "https://pubmed.ncbi.nlm.nih.gov/21921028"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B8JLQ9-1",
"protein_name": "Carboxypeptidase O",
"gene_name": "cpo",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q8IVL8-1",
"protein_name": "Carboxypeptidase O",
"gene_name": "CPO",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B8JLQ9",
"url": "https://www.uniprot.org/uniprotkb/B8JLQ9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.21921028",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Nasal embryonic LHRH factor plays a role in the developmental migration and projection of gonadotropin-releasing hormone 3 neurons in zebrafish.",
"journal": "Developmental dynamics : an official publication of the American Association of Anatomists",
"date": "2009-01",
"authors": "Palevitch Ori, Abraham Eytan, Borodovsky Natalya, Levkowitz Gil, Zohar Yonathan, Gothilf Yoav",
"reference": {
"type": "PubMed",
"id": "19097186",
"url": "https://pubmed.ncbi.nlm.nih.gov/19097186"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B8PYG1-1",
"protein_name": "NMDA receptor synaptonuclear signaling and neuronal migration factor",
"gene_name": "nsmfb; nsmf",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B8PYG1",
"url": "https://www.uniprot.org/uniprotkb/B8PYG1"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.19097186",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Negative Elongation Factor (NELF) Inhibits Premature Granulocytic Development in Zebrafish.",
"journal": "International journal of molecular sciences",
"date": "2022-03-30",
"authors": "Huang Mengling, Ahmed Abrar, Wang Wei, Wang Xue, Ma Cui, Jiang Haowei, Li Wei, Jing Lili",
"reference": {
"type": "PubMed",
"id": "35409193",
"url": "https://pubmed.ncbi.nlm.nih.gov/35409193"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B8PYG1-1",
"protein_name": "NMDA receptor synaptonuclear signaling and neuronal migration factor",
"gene_name": "nsmfb; nsmf",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB32TSV4-1",
"protein_name": "Negative elongation factor A isoform X1",
"gene_name": "nelfa",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B8PYG1",
"url": "https://www.uniprot.org/uniprotkb/B8PYG1"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.35409193",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Zebrafish RNase T2 genes and the evolution of secretory ribonucleases in animals.",
"journal": "BMC Evol. Biol.",
"date": "2009",
"authors": "Hillwig Melissa S, Rizhsky Ludmila, Wang Ying, Umanskaya Alisa, Essner Jeffrey J, MacIntosh Gustavo C",
"reference": {
"type": "PubMed",
"id": "19619322",
"url": "https://pubmed.ncbi.nlm.nih.gov/19619322"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B8XY56-1",
"protein_name": "Ribonuclease T2",
"gene_name": "rnaset2",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB13A9V5-1",
"protein_name": "4.6.1.19; Ribonuclease T2-like precursor",
"gene_name": "rnaset2l",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B8XY56",
"url": "https://www.uniprot.org/uniprotkb/B8XY56"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.19619322",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "rnaset2 mutant zebrafish model familial cystic leukoencephalopathy and reveal a role for RNase T2 in degrading ribosomal RNA.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2011",
"authors": "Haud N, Kara F, Diekmann S, Henneke M, Willer JR, Hillwig MS, Gregg RG, Macintosh GC, Gartner J, Alia A, Hurlstone AF",
"reference": {
"type": "PubMed",
"id": "21199949",
"url": "https://pubmed.ncbi.nlm.nih.gov/21199949"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "B8XY56-1",
"protein_name": "Ribonuclease T2",
"gene_name": "rnaset2",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB13A9V5-1",
"protein_name": "4.6.1.19; Ribonuclease T2-like precursor",
"gene_name": "rnaset2l",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "O00584-1",
"protein_name": "Ribonuclease T2",
"gene_name": "RNASET2",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "B8XY56",
"url": "https://www.uniprot.org/uniprotkb/B8XY56"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.21199949",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 3
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Atoh8, a bHLH transcription factor, is required for the development of retina and skeletal muscle in zebrafish.",
"journal": "PloS one",
"date": "2010-06-03",
"authors": "Yao Jihua, Zhou Jingyao, Liu Qiaoling, Lu Daru, Wang Lu, Qiao Xiaojing, Jia William",
"reference": {
"type": "PubMed",
"id": "20532172",
"url": "https://pubmed.ncbi.nlm.nih.gov/20532172"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "D2CLZ9-1",
"protein_name": "Transcription factor atoh8",
"gene_name": "atoh8",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "D2CLZ9",
"url": "https://www.uniprot.org/uniprotkb/D2CLZ9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.20532172",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Zebrafish atoh8 mutants do not recapitulate morpholino phenotypes.",
"journal": "PloS one",
"date": "2017",
"authors": "Place Elsie S, Smith James C",
"reference": {
"type": "PubMed",
"id": "28182631",
"url": "https://pubmed.ncbi.nlm.nih.gov/28182631"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "D2CLZ9-1",
"protein_name": "Transcription factor atoh8",
"gene_name": "atoh8",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "D2CLZ9",
"url": "https://www.uniprot.org/uniprotkb/D2CLZ9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.28182631",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "atoh8 expression pattern in early zebrafish embryonic development.",
"journal": "Histochemistry and cell biology",
"date": "2021-09",
"authors": "Fragale Ninfa, Divvela Satya Srirama Karthik, Brand-Saberi Beate",
"reference": {
"type": "PubMed",
"id": "34120256",
"url": "https://pubmed.ncbi.nlm.nih.gov/34120256"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "D2CLZ9-1",
"protein_name": "Transcription factor atoh8",
"gene_name": "atoh8",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "D2CLZ9",
"url": "https://www.uniprot.org/uniprotkb/D2CLZ9"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.34120256",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Disruption of Bardet-Biedl syndrome ciliary proteins perturbs planar cell polarity in vertebrates.",
"journal": "Nat. Genet.",
"date": "2005",
"authors": "Ross AJ, May-Simera H, Eichers ER, Kai M, Hill J, Jagger DJ, Leitch CC, Chapple JP, Munro PM, Fisher S, Tan PL, Phillips HM, Leroux MR, Henderson DJ, Murdoch JN, Copp AJ, Eliot MM, Lupski JR, Kemp DT, Dollfus H, Tada M, Katsanis N, Forge A, Beales PL",
"reference": {
"type": "PubMed",
"id": "16170314",
"url": "https://pubmed.ncbi.nlm.nih.gov/16170314"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EXH4-1",
"protein_name": "BBSome complex member BBS4",
"gene_name": "bbs4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EXH4",
"url": "https://www.uniprot.org/uniprotkb/E7EXH4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.16170314",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Bardet-Biedl syndrome genes are important in retrograde intracellular trafficking and Kupffer's vesicle cilia function.",
"journal": "Hum. Mol. Genet.",
"date": "2006",
"authors": "Yen Hsan-Jan, Tayeh Marwan K, Mullins Robert F, Stone Edwin M, Sheffield Val C, Slusarski Diane C",
"reference": {
"type": "PubMed",
"id": "16399798",
"url": "https://pubmed.ncbi.nlm.nih.gov/16399798"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EXH4-1",
"protein_name": "BBSome complex member BBS4",
"gene_name": "bbs4",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0A8N1Z238-1",
"protein_name": "DAN domain family member 5 precursor",
"gene_name": "dand5",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EXH4",
"url": "https://www.uniprot.org/uniprotkb/E7EXH4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.16399798",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "BBS10 encodes a vertebrate-specific chaperonin-like protein and is a major BBS locus.",
"journal": "Nat. Genet.",
"date": "2006",
"authors": "Stoetzel C, Laurier V, Davis EE, Muller J, Rix S, Badano JL, Leitch CC, Salem N, Chouery E, Corbani S, Jalk N, Vicaire S, Sarda P, Hamel C, Lacombe D, Holder M, Odent S, Holder S, Brooks AS, Elcioglu NH, Silva ED, Rossillion B, Sigaudy S, de Ravel TJ, Lewis RA, Leheup B, Verloes A, Amati-Bonneau P, Megarbane A, Poch O, Bonneau D, Beales PL, Mandel JL, Katsanis N, Dollfus H",
"reference": {
"type": "PubMed",
"id": "16582908",
"url": "https://pubmed.ncbi.nlm.nih.gov/16582908"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EXH4-1",
"protein_name": "BBSome complex member BBS4",
"gene_name": "bbs4",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q9DBI2-1",
"protein_name": "BBSome complex assembly protein BBS10",
"gene_name": "Bbs10",
"tax_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q8TAM1-1",
"protein_name": "BBSome complex assembly protein BBS10",
"gene_name": "BBS10",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EXH4",
"url": "https://www.uniprot.org/uniprotkb/E7EXH4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.16582908",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 3
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Bardet-Biedl syndrome: an emerging pathomechanism of intracellular transport.",
"journal": "Cell. Mol. Life Sci.",
"date": "2006",
"authors": "Blacque O E, Leroux M R",
"reference": {
"type": "PubMed",
"id": "16909204",
"url": "https://pubmed.ncbi.nlm.nih.gov/16909204"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EXH4-1",
"protein_name": "BBSome complex member BBS4",
"gene_name": "bbs4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EXH4",
"url": "https://www.uniprot.org/uniprotkb/E7EXH4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.16909204",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Copy-Number variation contributes to the mutational load of Bardet-Biedl syndrome.",
"journal": "Am. J. Hum. Genet.",
"date": "2016",
"authors": "Lindstrand Anna, Frangakis Stephan, Carvalho Claudia M B, Richardson Ellen B, McFadden Kelsey A, Willer Jason R, Pehlivan Davut, Liu Pengfei, Pediaditakis Igor L, Sabo Aniko, Lewis Richard Alan, Banin Eyal, Lupski James R, Davis Erica E, Katsanis Nicholas",
"reference": {
"type": "PubMed",
"id": "27486776",
"url": "https://pubmed.ncbi.nlm.nih.gov/27486776"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EXH4-1",
"protein_name": "BBSome complex member BBS4",
"gene_name": "bbs4",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AC58JIA8-1",
"protein_name": "Intraflagellar transport protein 74 homolog isoform X1",
"gene_name": "ift74",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "B8JK76-1",
"protein_name": "Serologically defined colon cancer antigen 8 homolog",
"gene_name": "Sdccag8; sdccag8",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q96LB3-1",
"protein_name": "Intraflagellar transport protein 74 homolog",
"gene_name": "IFT74",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EXH4",
"url": "https://www.uniprot.org/uniprotkb/E7EXH4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.27486776",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 4
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Loss of the Bardet-Biedl protein Bbs1 alters photoreceptor outer segment protein and lipid composition.",
"journal": "Nat. Commun.",
"date": "2022",
"authors": "Masek Markus, Etard Christelle, Hofmann Claudia, H\u00fclsmeier Andreas J, Zang Jingjing, Takamiya Masanari, Gesemann Matthias, Neuhauss Stephan C F, Hornemann Thorsten, Str\u00e4hle Uwe, Bachmann-Gagescu Ruxandra",
"reference": {
"type": "PubMed",
"id": "35277505",
"url": "https://pubmed.ncbi.nlm.nih.gov/35277505"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EXH4-1",
"protein_name": "BBSome complex member BBS4",
"gene_name": "bbs4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EXH4",
"url": "https://www.uniprot.org/uniprotkb/E7EXH4"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.35277505",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Galanin gene expression and effects of its knock-down on the development of the nervous system in larval zebrafish.",
"journal": "J. Comp. Neurol.",
"date": "2012",
"authors": "Podlasz P, Sallinen V, Chen Y-C, Kudo H, Fedorowska N, Panula P",
"reference": {
"type": "PubMed",
"id": "22522977",
"url": "https://pubmed.ncbi.nlm.nih.gov/22522977"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EZ53-1",
"protein_name": "Galanin peptides",
"gene_name": "gal",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EZ53",
"url": "https://www.uniprot.org/uniprotkb/E7EZ53"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.22522977",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "UHRF1 phosphorylation by cyclin A2/cyclin-dependent kinase 2 is required for zebrafish embryogenesis.",
"journal": "Molecular biology of the cell",
"date": "2012",
"authors": "Chu J, Loughlin EA, Gaur NA, SenBanerjee S, Jacob V, Monson C, Kent B, Oranu A, Ding Y, Ukomadu C, Sadler KC",
"reference": {
"type": "PubMed",
"id": "22072796",
"url": "https://pubmed.ncbi.nlm.nih.gov/22072796"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EZF3-1",
"protein_name": "E3 ubiquitin-protein ligase UHRF1",
"gene_name": "uhrf1",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q96T88-1",
"protein_name": "E3 ubiquitin-protein ligase UHRF1",
"gene_name": "UHRF1",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EZF3",
"url": "https://www.uniprot.org/uniprotkb/E7EZF3"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"mutagenesis": [
{
"start_pos": 649,
"end_pos": 649,
"sequence_org": "S",
"sequence_mut": "G",
"comment": "Non-phosphorylatable mutant; localizes only in nucleus and is unable to localize in cytoplasm.",
"evidence": [
{
"database": "UniProtKB",
"id": "E7EZF3",
"url": "https://www.uniprot.org/uniprotkb/E7EZF3"
},
{
"database": "PubMed",
"id": "22072796",
"url": "https://pubmed.ncbi.nlm.nih.gov/22072796"
}
],
"uniprot_canonical_ac": "E7EZF3-1"
}
],
"phosphorylation": [
{
"start_pos": 648,
"end_pos": 648,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "E7EZF3",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/E7EZF3"
},
{
"database": "PubMed",
"id": "22072796",
"url": "https://pubmed.ncbi.nlm.nih.gov/22072796"
}
],
"site_lbl": "Ser648",
"uniprot_canonical_ac": "E7EZF3-1"
},
{
"start_pos": 649,
"end_pos": 649,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine; by CDK2",
"evidence": [
{
"database": "UniProtKB",
"id": "E7EZF3",
"url": "https://www.uniprot.org/uniprotkb/E7EZF3"
},
{
"database": "iPTMnet",
"id": "E7EZF3",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/E7EZF3"
},
{
"database": "PubMed",
"id": "22072796",
"url": "https://pubmed.ncbi.nlm.nih.gov/22072796"
}
],
"site_lbl": "Ser649",
"uniprot_canonical_ac": "E7EZF3-1"
},
{
"start_pos": 661,
"end_pos": 661,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "Q96T88",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/Q96T88"
},
{
"database": "PubMed",
"id": "18767875",
"url": "https://pubmed.ncbi.nlm.nih.gov/18767875"
},
{
"database": "PubMed",
"id": "22072796",
"url": "https://pubmed.ncbi.nlm.nih.gov/22072796"
},
{
"database": "PubMed",
"id": "30357346",
"url": "https://pubmed.ncbi.nlm.nih.gov/30357346"
}
],
"site_lbl": "Ser661",
"uniprot_canonical_ac": "Q96T88-1"
}
],
"record_id": "pubmed.22072796",
"abstract": "",
"glycosylation": [],
"snv": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 3
},
{
"field": "total_sites",
"count": 3
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl",
"uniprot_canonical_ac"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Identification of mutations in the MYO9A gene in patients with congenital myasthenic syndrome.",
"journal": "Brain : a journal of neurology",
"date": "2016",
"authors": "O'Connor E, Topf A, Muller JS, Cox D, Evangelista T, Colomer J, Abicht A, Senderek J, Hasselmann O, Yaramis A, Laval SH, Lochmuller H",
"reference": {
"type": "PubMed",
"id": "27259756",
"url": "https://pubmed.ncbi.nlm.nih.gov/27259756"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EZG2-1",
"protein_name": "Unconventional myosin-IXAa",
"gene_name": "myo9aa",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "E7F3F0-1",
"protein_name": "Unconventional myosin-IXAb",
"gene_name": "myo9ab",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB13ABJ7-1",
"protein_name": "Unconventional myosin-IXAb",
"gene_name": "myo9ab",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q8C170-1",
"protein_name": "Unconventional myosin-IXa",
"gene_name": "Myo9a",
"tax_name": "Mouse"
},
{
"uniprot_canonical_ac": "B2RTY4-1",
"protein_name": "Unconventional myosin-IXa",
"gene_name": "MYO9A",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EZG2",
"url": "https://www.uniprot.org/uniprotkb/E7EZG2"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.27259756",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 5
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "MYO9A deficiency in motor neurons is associated with reduced neuromuscular agrin secretion.",
"journal": "Hum. Mol. Genet.",
"date": "2018",
"authors": "O'Connor E, Phan V, Cordts I, Cairns G, Hettwer S, Cox D, Lochmuller H, Roos A",
"reference": {
"type": "PubMed",
"id": "29462312",
"url": "https://pubmed.ncbi.nlm.nih.gov/29462312"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EZG2-1",
"protein_name": "Unconventional myosin-IXAa",
"gene_name": "myo9aa",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB13ABJ7-1",
"protein_name": "Unconventional myosin-IXAb",
"gene_name": "myo9ab",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EZG2",
"url": "https://www.uniprot.org/uniprotkb/E7EZG2"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.29462312",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Modulation of Agrin and RhoA Pathways Ameliorates Movement Defects and Synapse Morphology in MYO9A-Depleted Zebrafish.",
"journal": "Cells",
"date": "2019",
"authors": "O'Connor Emily, Cairns George, Spendiff Sally, Burns David, Hettwer Stefan, M\u00e4der Armin, M\u00fcller Juliane, Horvath Rita, Slater Clarke, Roos Andreas, Lochm\u00fcller Hanns",
"reference": {
"type": "PubMed",
"id": "31394789",
"url": "https://pubmed.ncbi.nlm.nih.gov/31394789"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7EZG2-1",
"protein_name": "Unconventional myosin-IXAa",
"gene_name": "myo9aa",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB13ABJ7-1",
"protein_name": "Unconventional myosin-IXAb",
"gene_name": "myo9ab",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7EZG2",
"url": "https://www.uniprot.org/uniprotkb/E7EZG2"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.31394789",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "CLP1 founder mutation links tRNA splicing and maturation to cerebellar development and neurodegeneration.",
"journal": "Cell",
"date": "2014",
"authors": "Schaffer AE, Eggens VR, Caglayan AO, Reuter MS, Scott E, Coufal NG, Silhavy JL, Xue Y, Kayserili H, Yasuno K, Rosti RO, Abdellateef M, Caglar C, Kasher PR, Cazemier JL, Weterman MA, Cantagrel V, Cai N, Zweier C, Altunoglu U, Satkin NB, Aktar F, Tuysuz B, Yalcinkaya C, Caksen H, Bilguvar K, Fu XD, Trotta CR, Gabriel S, Reis A, Gunel M, Baas F, Gleeson JG",
"reference": {
"type": "PubMed",
"id": "24766810",
"url": "https://pubmed.ncbi.nlm.nih.gov/24766810"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F3I6-1",
"protein_name": "Polyribonucleotide 5'-hydroxyl-kinase Clp1",
"gene_name": "clp1",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q92989-1",
"protein_name": "Polyribonucleotide 5'-hydroxyl-kinase Clp1",
"gene_name": "CLP1",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F3I6",
"url": "https://www.uniprot.org/uniprotkb/E7F3I6"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"mutagenesis": [
{
"start_pos": 35,
"end_pos": 35,
"sequence_org": "L",
"sequence_mut": "R",
"comment": "Lethality before 5 days post-fertilization (dpf).",
"evidence": [
{
"database": "UniProtKB",
"id": "E7F3I6",
"url": "https://www.uniprot.org/uniprotkb/E7F3I6"
},
{
"database": "PubMed",
"id": "24766810",
"url": "https://pubmed.ncbi.nlm.nih.gov/24766810"
}
],
"uniprot_canonical_ac": "E7F3I6-1"
}
],
"record_id": "pubmed.24766810",
"abstract": "",
"glycosylation": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Both STING and MAVS fish orthologs contribute to the induction of interferon mediated by RIG-I.",
"journal": "PloS one",
"date": "2012",
"authors": "Biacchesi St\u00e9phane, M\u00e9rour Emilie, Lamoureux Annie, Bernard Julie, Br\u00e9mont Michel",
"reference": {
"type": "PubMed",
"id": "23091644",
"url": "https://pubmed.ncbi.nlm.nih.gov/23091644"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F4N7-1",
"protein_name": "Stimulator of interferon genes protein",
"gene_name": "sting1",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0AB13AA18-1",
"protein_name": "Bromodomain-containing protein 8",
"gene_name": "brd8b",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F4N7",
"url": "https://www.uniprot.org/uniprotkb/E7F4N7"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.23091644",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Conservation of the STING-Mediated Cytosolic DNA Sensing Pathway in Zebrafish.",
"journal": "Journal of virology",
"date": "2015-08",
"authors": "Ge Rui, Zhou Yi, Peng Rui, Wang Rui, Li Mi, Zhang Yunbin, Zheng Chunfu, Wang Chen",
"reference": {
"type": "PubMed",
"id": "25972544",
"url": "https://pubmed.ncbi.nlm.nih.gov/25972544"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F4N7-1",
"protein_name": "Stimulator of interferon genes protein",
"gene_name": "sting1",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0A8M1P3F9-1",
"protein_name": "RNA helicase",
"gene_name": "dhx9",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F4N7",
"url": "https://www.uniprot.org/uniprotkb/E7F4N7"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.25972544",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Bi-allelic variants in HOPS complex subunit VPS41 cause cerebellar ataxia and abnormal membrane trafficking.",
"journal": "Brain : a journal of neurology",
"date": "2021",
"authors": "Sanderson LE, Lanko K, Alsagob M, Almass R, Al-Ahmadi N, Najafi M, Al-Muhaizea MA, Alzaidan H, AlDhalaan H, Perenthaler E, van der Linde HC, Nikoncuk A, Kuhn NA, Antony D, Owaidah TM, Raskin S, Vieira LGDR, Mombach R, Ahangari N, Silveira TRD, Ameziane N, Rolfs A, Alharbi A, Sabbagh RM, AlAhmadi K, Alawam B, Ghebeh H, AlHargan A, Albader AA, Binhumaid FS, Goljan E, Monies D, Mustafa OM, Aldosary M, AlBakheet A, Alyounes B, Almutairi F, Al-Odaib A, Aksoy DB, Basak AN, Palvadeau R, Trabzuni D, Rosenfeld JA, Karimiani EG, Meyer BF, Karakas B, Al-Mohanna F, Arold ST, Colak D, Maroofian R, Houlden H, Bertoli-Avella AM, Schmidts M, Barakat TS, van Ham TJ, Kaya N",
"reference": {
"type": "PubMed",
"id": "33764426",
"url": "https://pubmed.ncbi.nlm.nih.gov/33764426"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F590-1",
"protein_name": "Vacuolar protein sorting-associated protein 41 homolog",
"gene_name": "vps41",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "P49754-1",
"protein_name": "Vacuolar protein sorting-associated protein 41 homolog",
"gene_name": "VPS41",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F590",
"url": "https://www.uniprot.org/uniprotkb/E7F590"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.33764426",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "The lysosomal GPCR-like protein GPR137B regulates Rag and mTORC1 localization and activity.",
"journal": "Nature cell biology",
"date": "2019",
"authors": "Gan L, Seki A, Shen K, Iyer H, Han K, Hayer A, Wollman R, Ge X, Lin JR, Dey G, Talbot WS, Meyer T",
"reference": {
"type": "PubMed",
"id": "31036939",
"url": "https://pubmed.ncbi.nlm.nih.gov/31036939"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F594-1",
"protein_name": "G protein-coupled receptor 137Ba",
"gene_name": "gpr137ba",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q8N3F9-1",
"protein_name": "Integral membrane protein GPR137C",
"gene_name": "GPR137C",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "Q7L523-1",
"protein_name": "Ras-related GTP-binding protein A",
"gene_name": "RRAGA",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "P42345-1",
"protein_name": "Serine/threonine-protein kinase mTOR",
"gene_name": "MTOR",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "Q96N19-1",
"protein_name": "Integral membrane protein GPR137",
"gene_name": "GPR137",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "O60478-1",
"protein_name": "Integral membrane protein GPR137B",
"gene_name": "GPR137B",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "E9QGH2-1",
"protein_name": "Biogenesis of lysosome-related organelles complex 1 subunit 6",
"gene_name": "bloc1s6",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0A8M1PEI8-1",
"protein_name": "Dual specificity protein phosphatase",
"gene_name": "dusp1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F594",
"url": "https://www.uniprot.org/uniprotkb/E7F594"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.31036939",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 8
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "A role for G protein-coupled receptor 137b in bone remodeling in mouse and zebrafish.",
"journal": "Bone",
"date": "2019",
"authors": "Urso K, Caetano-Lopes J, Lee PY, Yan J, Henke K, Sury M, Liu H, Zgoda M, Jacome-Galarza C, Nigrovic PA, Duryea J, Harris MP, Charles JF",
"reference": {
"type": "PubMed",
"id": "31173907",
"url": "https://pubmed.ncbi.nlm.nih.gov/31173907"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F594-1",
"protein_name": "G protein-coupled receptor 137Ba",
"gene_name": "gpr137ba",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q8BNQ3-1",
"protein_name": "Integral membrane protein GPR137B",
"gene_name": "Gpr137b",
"tax_name": "Mouse"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F594",
"url": "https://www.uniprot.org/uniprotkb/E7F594"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.31173907",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "The Ribosome Biogenesis Protein Nol9 Is Essential for Definitive Hematopoiesis and Pancreas Morphogenesis in Zebrafish.",
"journal": "PLoS genetics",
"date": "2015",
"authors": "Bielczyk-Maczynska E, Lam Hung L, Ferreira L, Fleischmann T, Weis F, Fernandez-Pevida A, Harvey SA, Wali N, Warren AJ, Barroso I, Stemple DL, Cvejic A",
"reference": {
"type": "PubMed",
"id": "26624285",
"url": "https://pubmed.ncbi.nlm.nih.gov/26624285"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F654-1",
"protein_name": "Polynucleotide 5'-hydroxyl-kinase NOL9",
"gene_name": "nol9",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F654",
"url": "https://www.uniprot.org/uniprotkb/E7F654"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.26624285",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Functional characterisation of the maturation of the blood-brain barrier in larval zebrafish.",
"journal": "PLoS ONE",
"date": "2013",
"authors": "Fleming Angeleen, Diekmann Heike, Goldsmith Paul",
"reference": {
"type": "PubMed",
"id": "24147021",
"url": "https://pubmed.ncbi.nlm.nih.gov/24147021"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F6F7-1",
"protein_name": "Iron-sulfur clusters transporter ABCB7, mitochondrial",
"gene_name": "abcb7",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A3KGZ4-1",
"protein_name": "ABC-type oligopeptide transporter ABCB9",
"gene_name": "abcb9",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F6F7",
"url": "https://www.uniprot.org/uniprotkb/E7F6F7"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.24147021",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Danio rerio ABC transporter genes abcb3 and abcb7 play a protecting role against metal contamination.",
"journal": "Journal of applied toxicology : JAT",
"date": "2016-12",
"authors": "Lerebours Ad\u00e9la\u00efde, To Van Vinh, Bourdineaud Jean-Paul",
"reference": {
"type": "PubMed",
"id": "27734548",
"url": "https://pubmed.ncbi.nlm.nih.gov/27734548"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F6F7-1",
"protein_name": "Iron-sulfur clusters transporter ABCB7, mitochondrial",
"gene_name": "abcb7",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q801W2-1",
"protein_name": "ABC-type antigen peptide transporter",
"gene_name": "tap2a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F6F7",
"url": "https://www.uniprot.org/uniprotkb/E7F6F7"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.27734548",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Vertebrate myosin\u00a01d regulates left-right organizer morphogenesis and laterality.",
"journal": "Nature communications",
"date": "2018-08-23",
"authors": "Saydmohammed Manush, Yagi Hisato, Calderon Michael, Clark Madeline J, Feinstein Timothy, Sun Ming, Stolz Donna B, Watkins Simon C, Amack Jeffrey D, Lo Cecilia W, Tsang Michael",
"reference": {
"type": "PubMed",
"id": "30139971",
"url": "https://pubmed.ncbi.nlm.nih.gov/30139971"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7F9L8-1",
"protein_name": "Unconventional myosin-Id",
"gene_name": "myo1d",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q63357-1",
"protein_name": "Unconventional myosin-Id",
"gene_name": "Myo1d",
"tax_name": "Rat"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7F9L8",
"url": "https://www.uniprot.org/uniprotkb/E7F9L8"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.30139971",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Ubiad1 is an antioxidant enzyme that regulates eNOS activity by CoQ10 synthesis.",
"journal": "Cell",
"date": "2013",
"authors": "Mugoni V, Postel R, Catanzaro V, De Luca E, Turco E, Digilio G, Silengo L, Murphy MP, Medana C, Stainier DY, Bakkers J, Santoro MM",
"reference": {
"type": "PubMed",
"id": "23374346",
"url": "https://pubmed.ncbi.nlm.nih.gov/23374346"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7FB98-1",
"protein_name": "UbiA prenyltransferase domain-containing protein 1",
"gene_name": "ubiad1",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q9Y5Z9-1",
"protein_name": "UbiA prenyltransferase domain-containing protein 1",
"gene_name": "UBIAD1",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7FB98",
"url": "https://www.uniprot.org/uniprotkb/E7FB98"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"mutagenesis": [
{
"start_pos": 82,
"end_pos": 82,
"sequence_org": "L",
"sequence_mut": "Q",
"comment": "In bar(S847); increased oxidative stress, DNA damage and cell death specifically in blood vessels and the heart.",
"evidence": [
{
"database": "UniProtKB",
"id": "E7FB98",
"url": "https://www.uniprot.org/uniprotkb/E7FB98"
},
{
"database": "PubMed",
"id": "23374346",
"url": "https://pubmed.ncbi.nlm.nih.gov/23374346"
}
],
"uniprot_canonical_ac": "E7FB98-1"
}
],
"record_id": "pubmed.23374346",
"abstract": "",
"glycosylation": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "UBIAD1-mediated vitamin K2 synthesis is required for vascular endothelial cell survival and development.",
"journal": "Development (Cambridge, England)",
"date": "2013-04",
"authors": "Hegarty Jeffrey M, Yang Hongbo, Chi Neil C",
"reference": {
"type": "PubMed",
"id": "23533172",
"url": "https://pubmed.ncbi.nlm.nih.gov/23533172"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7FB98-1",
"protein_name": "UbiA prenyltransferase domain-containing protein 1",
"gene_name": "ubiad1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7FB98",
"url": "https://www.uniprot.org/uniprotkb/E7FB98"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"mutagenesis": [
{
"start_pos": 65,
"end_pos": 65,
"sequence_org": "L",
"sequence_mut": "Q",
"comment": "In reh(S587); cranial vascular hemmorhages in multiple areas of the head, leading to death by 72 hpf.",
"evidence": [
{
"database": "UniProtKB",
"id": "E7FB98",
"url": "https://www.uniprot.org/uniprotkb/E7FB98"
},
{
"database": "PubMed",
"id": "23533172",
"url": "https://pubmed.ncbi.nlm.nih.gov/23533172"
}
],
"uniprot_canonical_ac": "E7FB98-1"
}
],
"record_id": "pubmed.23533172",
"abstract": "",
"glycosylation": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Defective adgra2 (gpr124) splicing and function in zebrafish ouchless mutants.",
"journal": "Development (Cambridge, England)",
"date": "2017-01-01",
"authors": "Bostaille Naguissa, Gauquier Anne, Stainier Didier Y R, Raible David W, Vanhollebeke Benoit",
"reference": {
"type": "PubMed",
"id": "27979884",
"url": "https://pubmed.ncbi.nlm.nih.gov/27979884"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7FBY6-1",
"protein_name": "Adhesion G protein-coupled receptor A2",
"gene_name": "adgra2",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7FBY6",
"url": "https://www.uniprot.org/uniprotkb/E7FBY6"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"mutagenesis": [
{
"start_pos": 126,
"end_pos": 149,
"sequence_org": "DLSSNRIGCLTPEMFQGLTNLTKL",
"sequence_mut": "",
"comment": "In ouchless mutant; cerebrovascular defects characterized by impaired dorsal root ganglia formation in larvae. Defects are caused by accumulation of the protein in the endoplasmic reticulum and inability to reach the plasma membrane.",
"evidence": [
{
"database": "UniProtKB",
"id": "E7FBY6",
"url": "https://www.uniprot.org/uniprotkb/E7FBY6"
},
{
"database": "PubMed",
"id": "27979830",
"url": "https://pubmed.ncbi.nlm.nih.gov/27979830"
},
{
"database": "PubMed",
"id": "27979884",
"url": "https://pubmed.ncbi.nlm.nih.gov/27979884"
}
],
"uniprot_canonical_ac": "E7FBY6-1"
}
],
"record_id": "pubmed.27979884",
"abstract": "",
"glycosylation": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "A molecular mechanism for Wnt ligand-specific signaling.",
"journal": "Science (New York, N.Y.)",
"date": "2018",
"authors": "Eubelen M, Bostaille N, Cabochette P, Gauquier A, Tebabi P, Dumitru AC, Koehler M, Gut P, Alsteens D, Stainier DYR, Garcia-Pino A, Vanhollebeke B",
"reference": {
"type": "PubMed",
"id": "30026314",
"url": "https://pubmed.ncbi.nlm.nih.gov/30026314"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "E7FBY6-1",
"protein_name": "Adhesion G protein-coupled receptor A2",
"gene_name": "adgra2",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "P56706-1",
"protein_name": "Protein Wnt-7b",
"gene_name": "WNT7B",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "Q96PE1-1",
"protein_name": "Adhesion G protein-coupled receptor A2",
"gene_name": "ADGRA2",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "O00755-1",
"protein_name": "Protein Wnt-7a",
"gene_name": "WNT7A",
"tax_name": "Human"
},
{
"uniprot_canonical_ac": "O95980-1",
"protein_name": "Reversion-inducing cysteine-rich protein with Kazal motifs",
"gene_name": "RECK",
"tax_name": "Human"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "E7FBY6",
"url": "https://www.uniprot.org/uniprotkb/E7FBY6"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"mutagenesis": [
{
"start_pos": 206,
"end_pos": 206,
"sequence_org": "S",
"sequence_mut": "A",
"comment": "Does not affect interaction with RECK.",
"evidence": [
{
"database": "UniProtKB",
"id": "O00755",
"url": "https://www.uniprot.org/uniprotkb/O00755"
},
{
"database": "PubMed",
"id": "30026314",
"url": "https://pubmed.ncbi.nlm.nih.gov/30026314"
}
],
"uniprot_canonical_ac": "O00755-1"
},
{
"start_pos": 241,
"end_pos": 241,
"sequence_org": "V",
"sequence_mut": "A",
"comment": "In 4A; abolished interaction with RECK; when associated with 251-A-A-252 and A-262.",
"evidence": [
{
"database": "UniProtKB",
"id": "O00755",
"url": "https://www.uniprot.org/uniprotkb/O00755"
},
{
"database": "PubMed",
"id": "30026314",
"url": "https://pubmed.ncbi.nlm.nih.gov/30026314"
}
],
"uniprot_canonical_ac": "O00755-1"
},
{
"start_pos": 251,
"end_pos": 252,
"sequence_org": "FL",
"sequence_mut": "AA",
"comment": "In 4A; abolished interaction with RECK; when associated with A-241 and A-262.",
"evidence": [
{
"database": "UniProtKB",
"id": "O00755",
"url": "https://www.uniprot.org/uniprotkb/O00755"
},
{
"database": "PubMed",
"id": "30026314",
"url": "https://pubmed.ncbi.nlm.nih.gov/30026314"
}
],
"uniprot_canonical_ac": "O00755-1"
},
{
"start_pos": 262,
"end_pos": 262,
"sequence_org": "K",
"sequence_mut": "A",
"comment": "In 4A; abolished interaction with RECK; when associated with A-241 and 251-A-A-252.",
"evidence": [
{
"database": "UniProtKB",
"id": "O00755",
"url": "https://www.uniprot.org/uniprotkb/O00755"
},
{
"database": "PubMed",
"id": "30026314",
"url": "https://pubmed.ncbi.nlm.nih.gov/30026314"
}
],
"uniprot_canonical_ac": "O00755-1"
},
{
"start_pos": 225,
"end_pos": 272,
"sequence_org": "CQNACKRILMSKKTEMEIVDGLIEGCKTQPLPQDPLWQCFLESSQSVH",
"sequence_mut": "",
"comment": "Abolished interaction with WNT7A.",
"evidence": [
{
"database": "UniProtKB",
"id": "O95980",
"url": "https://www.uniprot.org/uniprotkb/O95980"
},
{
"database": "PubMed",
"id": "30026314",
"url": "https://pubmed.ncbi.nlm.nih.gov/30026314"
}
],
"uniprot_canonical_ac": "O95980-1"
}
],
"record_id": "pubmed.30026314",
"abstract": "",
"glycosylation": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 5
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Efficient genome-wide mutagenesis of zebrafish genes by retroviral insertions.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "2007",
"authors": "Wang Dongmei, Jao Li-En, Zheng Naizhong, Dolan Kyle, Ivey Jessica, Zonies Seth, Wu Xiaolin, Wu Kangmai, Yang Hongbo, Meng Qingchao, Zhu Zuoyan, Zhang Bo, Lin Shuo, Burgess Shawn M",
"reference": {
"type": "PubMed",
"id": "17640903",
"url": "https://pubmed.ncbi.nlm.nih.gov/17640903"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q08CK7-1",
"protein_name": "Insulin-like growth factor 2 mRNA-binding protein 1",
"gene_name": "igf2bp1",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A0A8M1NAK9-1",
"protein_name": "1.1.1.300; Retinol dehydrogenase 14b",
"gene_name": "rdh14b",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "A4FUN9-1",
"protein_name": "Calcium homeostasis modulator protein 5",
"gene_name": "calhm5.1",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "F6NJC6-1",
"protein_name": "Tubby-related protein 4",
"gene_name": "tulp4a",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q08CK7",
"url": "https://www.uniprot.org/uniprotkb/Q08CK7"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.17640903",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 4
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Molecular insights into the coding region determinant-binding protein-RNA interaction through site-directed mutagenesis in the heterogeneous nuclear ribonucleoprotein-K-homology domains.",
"journal": "J. Biol. Chem.",
"date": "2015",
"authors": "Barnes Mark, van Rensburg Gerrit, Li Wai-Ming, Mehmood Kashif, Mackedenski Sebastian, Chan Ching-Man, King Dustin T, Miller Andrew L, Lee Chow H",
"reference": {
"type": "PubMed",
"id": "25389298",
"url": "https://pubmed.ncbi.nlm.nih.gov/25389298"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q08CK7-1",
"protein_name": "Insulin-like growth factor 2 mRNA-binding protein 1",
"gene_name": "igf2bp1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q08CK7",
"url": "https://www.uniprot.org/uniprotkb/Q08CK7"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.25389298",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Igf2bp1 is required for hepatic outgrowth during early liver development in zebrafish.",
"journal": "Gene",
"date": "2020",
"authors": "Wu Junjie, Lu Chang, Ge Si, Mei Jie, Li Xiaohui, Guo Wenjie",
"reference": {
"type": "PubMed",
"id": "32240777",
"url": "https://pubmed.ncbi.nlm.nih.gov/32240777"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q08CK7-1",
"protein_name": "Insulin-like growth factor 2 mRNA-binding protein 1",
"gene_name": "igf2bp1",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q08CK7",
"url": "https://www.uniprot.org/uniprotkb/Q08CK7"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.32240777",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "The zebrafish kohtalo/trap230 gene is required for the development of the brain, neural crest, and pronephric kidney.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2005-12-20",
"authors": "Hong Sung-Kook, Haldin Caroline E, Lawson Nathan D, Weinstein Brant M, Dawid Igor B, Hukriede Neil A",
"reference": {
"type": "PubMed",
"id": "16344459",
"url": "https://pubmed.ncbi.nlm.nih.gov/16344459"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q2QCI8-1",
"protein_name": "Mediator of RNA polymerase II transcription subunit 12",
"gene_name": "med12",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q2QCI8",
"url": "https://www.uniprot.org/uniprotkb/Q2QCI8"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.16344459",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Zebrafish Trap230/Med12 is required as a coactivator for Sox9-dependent neural crest, cartilage and ear development.",
"journal": "Developmental biology",
"date": "2006-08-01",
"authors": "Rau Marlene J, Fischer Sabine, Neumann Carl J",
"reference": {
"type": "PubMed",
"id": "16712834",
"url": "https://pubmed.ncbi.nlm.nih.gov/16712834"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q2QCI8-1",
"protein_name": "Mediator of RNA polymerase II transcription subunit 12",
"gene_name": "med12",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q2QCI8",
"url": "https://www.uniprot.org/uniprotkb/Q2QCI8"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.16712834",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "A subunit of the mediator complex regulates vertebrate neuronal development.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2006-11-14",
"authors": "Wang Xiaoqun, Yang Nan, Uno Etsuko, Roeder Robert G, Guo Su",
"reference": {
"type": "PubMed",
"id": "17088561",
"url": "https://pubmed.ncbi.nlm.nih.gov/17088561"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q2QCI8-1",
"protein_name": "Mediator of RNA polymerase II transcription subunit 12",
"gene_name": "med12",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q08BY1-1",
"protein_name": "Mediator of RNA polymerase II transcription subunit 17",
"gene_name": "med17",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q2QCI8",
"url": "https://www.uniprot.org/uniprotkb/Q2QCI8"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.17088561",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Nipbl and mediator cooperatively regulate gene expression to control limb development.",
"journal": "PLoS Genet.",
"date": "2014",
"authors": "Muto Akihiko, Ikeda Shingo, Lopez-Burks Martha E, Kikuchi Yutaka, Calof Anne L, Lander Arthur D, Schilling Thomas F",
"reference": {
"type": "PubMed",
"id": "25255084",
"url": "https://pubmed.ncbi.nlm.nih.gov/25255084"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q2QCI8-1",
"protein_name": "Mediator of RNA polymerase II transcription subunit 12",
"gene_name": "med12",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q2QCI8",
"url": "https://www.uniprot.org/uniprotkb/Q2QCI8"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.25255084",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Separate roles for Med12 and Wnt signaling in regulation of oxytocin expression.",
"journal": "Biol. Open",
"date": "2018",
"authors": "Spikol Emma D, Glasgow Eric",
"reference": {
"type": "PubMed",
"id": "29530929",
"url": "https://pubmed.ncbi.nlm.nih.gov/29530929"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q2QCI8-1",
"protein_name": "Mediator of RNA polymerase II transcription subunit 12",
"gene_name": "med12",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q2QCI8",
"url": "https://www.uniprot.org/uniprotkb/Q2QCI8"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.29530929",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Mediator complex subunit Med12 regulates cardiac jelly development and AV valve formation in zebrafish.",
"journal": "Prog. Biophys. Mol. Biol.",
"date": "2018",
"authors": "Segert Julia, Schneider Isabelle, Berger Ina M, Rottbauer Wolfgang, Just Steffen",
"reference": {
"type": "PubMed",
"id": "30036562",
"url": "https://pubmed.ncbi.nlm.nih.gov/30036562"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q2QCI8-1",
"protein_name": "Mediator of RNA polymerase II transcription subunit 12",
"gene_name": "med12",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q2QCI8",
"url": "https://www.uniprot.org/uniprotkb/Q2QCI8"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.30036562",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Evolutionary conservation of zebrafish linkage group 14 with frequently deleted regions of human chromosome 5 in myeloid malignancies.",
"journal": "Proc. Natl. Acad. Sci. U.S.A.",
"date": "2002",
"authors": "Liu Ting Xi, Zhou Yi, Kanki John P, Deng Min, Rhodes Jennifer, Yang Hong Wei, Sheng Xiao Ming, Zon Leonard I, Look A Thomas",
"reference": {
"type": "PubMed",
"id": "11983906",
"url": "https://pubmed.ncbi.nlm.nih.gov/11983906"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q5MD89-1",
"protein_name": "Vascular endothelial growth factor receptor 3",
"gene_name": "flt4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q5MD89",
"url": "https://www.uniprot.org/uniprotkb/Q5MD89"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.11983906",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "sonic hedgehog and vascular endothelial growth factor act upstream of the Notch pathway during arterial endothelial differentiation.",
"journal": "Dev. Cell",
"date": "2002",
"authors": "Lawson Nathan D, Vogel Andreas M, Weinstein Brant M",
"reference": {
"type": "PubMed",
"id": "12110173",
"url": "https://pubmed.ncbi.nlm.nih.gov/12110173"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q5MD89-1",
"protein_name": "Vascular endothelial growth factor receptor 3",
"gene_name": "flt4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q5MD89",
"url": "https://www.uniprot.org/uniprotkb/Q5MD89"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.12110173",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Molecular distinction between arteries and veins.",
"journal": "Cell Tissue Res.",
"date": "2003",
"authors": "Torres-V\u00e1zquez Jes\u00fas, Kamei Makoto, Weinstein Brant M",
"reference": {
"type": "PubMed",
"id": "14505031",
"url": "https://pubmed.ncbi.nlm.nih.gov/14505031"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q5MD89-1",
"protein_name": "Vascular endothelial growth factor receptor 3",
"gene_name": "flt4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q5MD89",
"url": "https://www.uniprot.org/uniprotkb/Q5MD89"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.14505031",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "The zebrafish common cardinal veins develop by a novel mechanism: lumen ensheathment.",
"journal": "Development",
"date": "2013",
"authors": "Helker Christian S M, Schuermann Annika, Karpanen Terhi, Zeuschner Dagmar, Belting Heinz-Georg, Affolter Markus, Schulte-Merker Stefan, Herzog Wiebke",
"reference": {
"type": "PubMed",
"id": "23698350",
"url": "https://pubmed.ncbi.nlm.nih.gov/23698350"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q5MD89-1",
"protein_name": "Vascular endothelial growth factor receptor 3",
"gene_name": "flt4",
"tax_name": "Zebrafish"
},
{
"uniprot_canonical_ac": "Q68SP4-1",
"protein_name": "Cadherin-5",
"gene_name": "cdh5",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q5MD89",
"url": "https://www.uniprot.org/uniprotkb/Q5MD89"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.23698350",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 2
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "FLT4 causes developmental disorders of the cardiovascular and lymphovascular systems via pleiotropic molecular mechanisms.",
"journal": "Cardiovasc. Res.",
"date": "2024",
"authors": "Kasher P.R., Williams S.G., Keavney B.D., Monaghan R.M., Naylor R.W., Flatman D.",
"reference": {
"type": "PubMed",
"id": "38713105",
"url": "https://pubmed.ncbi.nlm.nih.gov/38713105"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q5MD89-1",
"protein_name": "Vascular endothelial growth factor receptor 3",
"gene_name": "flt4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q5MD89",
"url": "https://www.uniprot.org/uniprotkb/Q5MD89"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.38713105",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "CM082 suppresses hypoxia-induced retinal neovascularization in larval zebrafish.",
"journal": "Front. Pharmacol.",
"date": "2024",
"authors": "Hu B., Yin W., Zhang J.L., Fan D.G.",
"reference": {
"type": "PubMed",
"id": "39135806",
"url": "https://pubmed.ncbi.nlm.nih.gov/39135806"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q5MD89-1",
"protein_name": "Vascular endothelial growth factor receptor 3",
"gene_name": "flt4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q5MD89",
"url": "https://www.uniprot.org/uniprotkb/Q5MD89"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.39135806",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
},
{
"title": "Mapping the cellular expression patterns of vascular endothelial growth factor aa and bb genes and their receptors in the adult zebrafish brain during constitutive and regenerative neurogenesis.",
"journal": "Neural Dev.",
"date": "2024",
"authors": "Rastegar S., Diotel N., Fernezelian D., Pfitsch S.",
"reference": {
"type": "PubMed",
"id": "39267104",
"url": "https://pubmed.ncbi.nlm.nih.gov/39267104"
},
"referenced_glycans": [],
"referenced_proteins": [
{
"uniprot_canonical_ac": "Q5MD89-1",
"protein_name": "Vascular endothelial growth factor receptor 3",
"gene_name": "flt4",
"tax_name": "Zebrafish"
}
],
"species": [
{
"name": "Danio rerio",
"taxid": 7955,
"evidence": [
{
"database": "UniProtKB",
"id": "Q5MD89",
"url": "https://www.uniprot.org/uniprotkb/Q5MD89"
}
],
"common_name": "Zebrafish",
"glygen_name": "Zebrafish",
"reference_species": "Danio rerio [7955]"
}
],
"record_id": "pubmed.39267104",
"abstract": "",
"glycosylation": [],
"mutagenesis": [],
"snv": [],
"phosphorylation": [],
"glycation": [],
"section_stats": [
{
"table_id": "referenced_proteins",
"table_stats": [
{
"field": "total",
"count": 1
}
],
"sort_fields": [
"uniprot_canonical_ac",
"protein_name",
"gene_name",
"tax_name"
]
},
{
"table_id": "referenced_glycans",
"table_stats": [
{
"field": "total",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_sites",
"count": 0
},
{
"field": "o_linked_sites",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
}
],
"sort_fields": []
}
]
}
]