[ { "uniprot_canonical_ac": "P18272-1", "uniprot_ac": "P18272", "uniprot_id": "NCAP_EBOZM", "mass": { "chemical_mass": 83287.0, "monoisotopic_mass": 83287.0 }, "refseq": { "ac": "NP_066243", "name": "nucleoprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066243" }, "gene_names": [ { "name": "NP", "type": "recommended", "evidence": [ { "id": "P18272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P18272" } ] } ], "protein_names": [ { "name": "Nucleoprotein", "type": "recommended", "evidence": [ { "id": "P18272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P18272/entry#names_and_taxonomy" } ] }, { "name": "Ebola NP", "type": "synonym", "evidence": [ { "id": "P18272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P18272/entry#names_and_taxonomy" } ] }, { "name": "Nucleocapsid protein", "type": "synonym", "evidence": [ { "id": "P18272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P18272/entry#names_and_taxonomy" } ] }, { "name": "Protein N", "type": "synonym", "evidence": [ { "id": "P18272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P18272/entry#names_and_taxonomy" } ] }, { "name": "eNP", "type": "synonym", "evidence": [ { "id": "P18272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P18272/entry#names_and_taxonomy" } ] }, { "name": "nucleoprotein", "type": "synonym", "evidence": [ { "id": "NP_066243", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066243" } ] } ], "function": [ { "annotation": "Oligomerizes into helical capsid to encapsidate the viral genome, protecting it from nucleases and the cellular innate immune response (PubMed:16719918, PubMed:25865894, PubMed:26119732, PubMed:30333622). VP35 binds to and stabilizes monomeric NP, keeping it soluble (PubMed:25865894, PubMed:26119732). Upon virus replication, NP is recruited to bind cooperatively viral genomic RNA and VP35 is released (PubMed:29144446). The encapsidated genomic RNA is termed the nucleocapsid and serves as template for transcription and replication. The nucleocapsid is helical with a pitch of 10.81 NP per turn and a diameter of about 22nm (PubMed:22247782). Each NP binds to six nucleotides of viral genomic RNA, three being exposed to the solvant and three hidden into the nucleocapsid (PubMed:30333622). Also recruits host PPP2R5C phosphatase to dephosphorylate VP30 and thereby promote viral transcription (PubMed:27755595, PubMed:29290611). Upon virion assembly and budding, NP binds to VP24 and possibly host STAU1 (PubMed:28794491, PubMed:30301857).", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272#function" }, { "database": "PubMed", "id": "29144446", "url": "https://glygen.org/publication/PubMed/29144446" }, { "database": "PubMed", "id": "26119732", "url": "https://glygen.org/publication/PubMed/26119732" }, { "database": "PubMed", "id": "30301857", "url": "https://glygen.org/publication/PubMed/30301857" }, { "database": "PubMed", "id": "22247782", "url": "https://glygen.org/publication/PubMed/22247782" }, { "database": "PubMed", "id": "27755595", "url": "https://glygen.org/publication/PubMed/27755595" }, { "database": "PubMed", "id": "25865894", "url": "https://glygen.org/publication/PubMed/25865894" }, { "database": "PubMed", "id": "28794491", "url": "https://glygen.org/publication/PubMed/28794491" }, { "database": "PubMed", "id": "30333622", "url": "https://glygen.org/publication/PubMed/30333622" }, { "database": "PubMed", "id": "16719918", "url": "https://glygen.org/publication/PubMed/16719918" }, { "database": "PubMed", "id": "29290611", "url": "https://glygen.org/publication/PubMed/29290611" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 21, "end_pos": 21, "sequence_org": "Y", "sequence_mut": "A", "comment": "More than 90% loss of oligomerization; when associated with A-21.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" }, { "database": "PubMed", "id": "25865894", "url": "https://glygen.org/publication/PubMed/25865894" } ] }, { "start_pos": 22, "end_pos": 22, "sequence_org": "H", "sequence_mut": "A", "comment": "More than 90% loss of oligomerization; when associated with A-22.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" }, { "database": "PubMed", "id": "25865894", "url": "https://glygen.org/publication/PubMed/25865894" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Zaire ebolavirus (strain Mayinga-76)", "taxid": 128952, "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "common_name": "Zaire ebolavirus", "glygen_name": "Ebola (EBOV)", "reference_species": "Zaire ebolavirus (strain Mayinga-76) [128952]" } ], "gene": [ { "name": "NP", "url": "https://www.uniprot.org/uniprotkb/P18272", "locus": {} } ], "crossref": [ { "id": "911830", "url": "https://www.ncbi.nlm.nih.gov/gene/911830", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4QAZ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4QAZ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4QB0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4QB0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4YPI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4YPI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4Z9P", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4Z9P&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4ZTA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4ZTA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4ZTG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4ZTG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4ZTI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4ZTI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5T3T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5T3T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5Z9W", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5Z9W&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6C54", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6C54&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6EHL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6EHL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6EHM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6EHM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6NUT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6NUT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8USN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8USN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8UST", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8UST&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Y9J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Y9J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "16888", "url": "https://www.iedb.org/epitope/16888", "database": "IEDB", "categories": [ "Other" ] }, { "id": "17527", "url": "https://www.iedb.org/epitope/17527", "database": "IEDB", "categories": [ "Other" ] }, { "id": "32188", "url": "https://www.iedb.org/epitope/32188", "database": "IEDB", "categories": [ "Other" ] }, { "id": "54673", "url": "https://www.iedb.org/epitope/54673", "database": "IEDB", "categories": [ "Other" ] }, { "id": "57802", "url": "https://www.iedb.org/epitope/57802", "database": "IEDB", "categories": [ "Other" ] }, { "id": "75566", "url": "https://www.iedb.org/epitope/75566", "database": "IEDB", "categories": [ "Other" ] }, { "id": "IPR008609", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008609", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00004qaz", "url": "https://www.rcsb.org/structure/pdb_00004qaz", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004qb0", "url": "https://www.rcsb.org/structure/pdb_00004qb0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ypi", "url": "https://www.rcsb.org/structure/pdb_00004ypi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004z9p", "url": "https://www.rcsb.org/structure/pdb_00004z9p", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004zta", "url": "https://www.rcsb.org/structure/pdb_00004zta", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ztg", "url": "https://www.rcsb.org/structure/pdb_00004ztg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004zti", "url": "https://www.rcsb.org/structure/pdb_00004zti", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005t3t", "url": "https://www.rcsb.org/structure/pdb_00005t3t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005z9w", "url": "https://www.rcsb.org/structure/pdb_00005z9w", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006c54", "url": "https://www.rcsb.org/structure/pdb_00006c54", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ehl", "url": "https://www.rcsb.org/structure/pdb_00006ehl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ehm", "url": "https://www.rcsb.org/structure/pdb_00006ehm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006nut", "url": "https://www.rcsb.org/structure/pdb_00006nut", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008usn", "url": "https://www.rcsb.org/structure/pdb_00008usn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ust", "url": "https://www.rcsb.org/structure/pdb_00008ust", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008y9j", "url": "https://www.rcsb.org/structure/pdb_00008y9j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QAZ", "url": "https://www.rcsb.org/structure/4QAZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QB0", "url": "https://www.rcsb.org/structure/4QB0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YPI", "url": "https://www.rcsb.org/structure/4YPI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4Z9P", "url": "https://www.rcsb.org/structure/4Z9P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZTA", "url": "https://www.rcsb.org/structure/4ZTA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZTG", "url": "https://www.rcsb.org/structure/4ZTG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZTI", "url": "https://www.rcsb.org/structure/4ZTI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T3T", "url": "https://www.rcsb.org/structure/5T3T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Z9W", "url": "https://www.rcsb.org/structure/5Z9W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6C54", "url": "https://www.rcsb.org/structure/6C54", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EHL", "url": "https://www.rcsb.org/structure/6EHL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EHM", "url": "https://www.rcsb.org/structure/6EHM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NUT", "url": "https://www.rcsb.org/structure/6NUT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8USN", "url": "https://www.rcsb.org/structure/8USN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8UST", "url": "https://www.rcsb.org/structure/8UST", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Y9J", "url": "https://www.rcsb.org/structure/8Y9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF05505", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF05505", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_066243", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066243", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P18272-1", "url": "https://www.uniprot.org/uniprotkb/P18272-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSRPQKIWMAPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKYLEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNEVNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITAASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDDDPTDSQDTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVLFDLDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ", "length": 739, "header": "sp|P18272-1|NCAP_EBOZM Isoform 1 of Nucleoprotein OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=NP PE=1 SV=2 CANONICAL=P18272-1" }, "isoforms": [ { "isoform_ac": "P18272-1", "url": "https://www.uniprot.org/uniprotkb/P18272/entry#P18272-1", "sequence": { "sequence": "MDSRPQKIWMAPSLTESDMDYHKILTAGLSVQQGIVRQRVIPVYQVNNLEEICQLIIQAFEAGVDFQESADSFLLMLCLHHAYQGDYKLFLESGAVKYLEGHGFRFEVKKRDGVKRLEELLPAVSSGKNIKRTLAAMPEEETTEANAGQFLSFASLFLPKLVVGEKACLEKVQRQIQVHAEQGLIQYPTAWQSVGHMMVIFRLMRTNFLIKFLLIHQGMHMVAGHDANDAVISNSVAQARFSGLLIVKTVLDHILQKTERGVRLHPLARTAKVKNEVNSFKAALSSLAKHGEYAPFARLLNLSGVNNLEHGLFPQLSAIALGVATAHGSTLAGVNVGEQYQQLREAATEAEKQLQQYAESRELDHLGLDDQEKKILMNFHQKKNEISFQQTNAMVTLRKERLAKLTEAITAASLPKTSGHYDDDDDIPFPGPINDDDNPGHQDDDPTDSQDTTIPDVVVDPDDGSYGEYQSYSENGMNAPDDLVLFDLDEDDEDTKPVPNRSTKGGQQKNSQKGQHIEGRQTQSRPIQNVPGPHRTIHHASAPLTDNDRRNEPSGSTSPRMLTPINEEADPLDDADDETSSLPPLESDDEEQDRDGTSNRTPTVAPPAPVYRDHSEKKELPQDEQQDQDHTQEARNQDSDNTQSEHSFEEMYRHILRSQGPFDAVLYYHMMKDEPVVFSTSDGKEYTYPDSLEEEYPPWLTEKEAMNEENRFVTLDGQQFYWPVMNHKNKFMAILQHHQ", "length": 739, "header": "sp|P18272-1|NCAP_EBOZM Isoform 1 of Nucleoprotein OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=NP PE=1 SV=2 CANONICAL=P18272-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Molecular characterization of guinea pig-adapted variants of Ebola virus.", "journal": "Virology", "date": "2000", "authors": "Volchkov V.E., Klenk H.D., Chepurnov A.A., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "11062045", "url": "https://glygen.org/publication/PubMed/11062045" } ] }, { "title": "The assembly of Ebola virus nucleocapsid requires virion-associated proteins 35 and 24 and posttranslational modification of nucleoprotein.", "journal": "Mol. Cell", "date": "2002", "authors": "Huang Yue, Xu Ling, Sun Yongnian, Nabel Gary J", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "12191476", "url": "https://glygen.org/publication/PubMed/12191476" } ] }, { "title": "Identification of murine T-cell epitopes in Ebola virus nucleoprotein.", "journal": "Virology", "date": "2004-01-05", "authors": "Simmons Graham, Lee Anee, Rennekamp Andrew J, Fan Xin, Bates Paul, Shen Hao", "evidence": [ { "database": "IEDB", "id": "17527", "url": "https://www.iedb.org/epitope/17527" }, { "database": "IEDB", "id": "57802", "url": "https://www.iedb.org/epitope/57802" }, { "database": "IEDB", "id": "75566", "url": "https://www.iedb.org/epitope/75566" } ], "reference": [ { "type": "PubMed", "id": "14972550", "url": "https://glygen.org/publication/PubMed/14972550" } ] }, { "title": "Functional mapping of the nucleoprotein of Ebola virus.", "journal": "Journal of virology", "date": "2006-04", "authors": "Watanabe Shinji, Noda Takeshi, Kawaoka Yoshihiro", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "16571791", "url": "https://glygen.org/publication/PubMed/16571791" } ] }, { "title": "Effect of Ebola virus proteins GP, NP and VP35 on VP40 VLP morphology.", "journal": "Virology journal", "date": "2006-05-23", "authors": "Johnson Reed F, Bell Peter, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "16719918", "url": "https://glygen.org/publication/PubMed/16719918" } ] }, { "title": "Computational prediction and identification of HLA-A2.1-specific Ebola virus CTL epitopes.", "journal": "Virology", "date": "2007-04-10", "authors": "Sundar Krishnan, Boesen Agnieszka, Coico Richard", "evidence": [ { "database": "IEDB", "id": "16888", "url": "https://www.iedb.org/epitope/16888" }, { "database": "IEDB", "id": "32188", "url": "https://www.iedb.org/epitope/32188" }, { "database": "IEDB", "id": "54673", "url": "https://www.iedb.org/epitope/54673" } ], "reference": [ { "type": "PubMed", "id": "17123567", "url": "https://glygen.org/publication/PubMed/17123567" } ] }, { "title": "Mapping of the VP40-binding regions of the nucleoprotein of Ebola virus.", "journal": "J. Virol.", "date": "2007", "authors": "Watanabe S., Noda T., Kawaoka Y., Sagara H.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "17229682", "url": "https://glygen.org/publication/PubMed/17229682" } ] }, { "title": "The organisation of Ebola virus reveals a capacity for extensive, modular polyploidy.", "journal": "PloS one", "date": "2012", "authors": "Beniac Daniel R, Melito Pasquale L, Devarennes Shauna L, Hiebert Shannon L, Rabb Melissa J, Lamboo Lindsey L, Jones Steven M, Booth Timothy F", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "22247782", "url": "https://glygen.org/publication/PubMed/22247782" } ] }, { "title": "The structure of the C-terminal domain of the Zaire ebolavirus nucleoprotein.", "journal": "Acta Crystallogr. D", "date": "2014", "authors": "Derewenda Z.S., Derewenda U., Engel D.A., Ellena J.F., Dziubanska P.J.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "25195755", "url": "https://glygen.org/publication/PubMed/25195755" } ] }, { "title": "An Intrinsically Disordered Peptide from Ebola Virus VP35 Controls Viral RNA Synthesis by Modulating Nucleoprotein-RNA Interactions.", "journal": "Cell reports", "date": "2015-04-21", "authors": "Leung Daisy W, Borek Dominika, Luthra Priya, Binning Jennifer M, Anantpadma Manu, Liu Gai, Harvey Ian B, Su Zhaoming, Endlich-Frazier Ariel, Pan Juanli, Shabman Reed S, Chiu Wah, Davey Robert A, Otwinowski Zbyszek, Basler Christopher F, Amarasinghe Gaya K", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "25865894", "url": "https://glygen.org/publication/PubMed/25865894" } ] }, { "title": "Insight into the Ebola virus nucleocapsid assembly mechanism: crystal structure of Ebola virus nucleoprotein core domain at 1.8 Aa resolution.", "journal": "Protein Cell", "date": "2015", "authors": "Liu B., Liu X., Wang W., Guo Y., Li G., Dong S., Xia B., Yang P., Rao Z., Yang C., Lou Z.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "25910597", "url": "https://glygen.org/publication/PubMed/25910597" } ] }, { "title": "Assembly of the Ebola Virus Nucleoprotein from a Chaperoned VP35 Complex.", "journal": "Cell reports", "date": "2015-07-07", "authors": "Kirchdoerfer Robert N, Abelson Dafna M, Li Sheng, Wood Malcolm R, Saphire Erica Ollmann", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "26119732", "url": "https://glygen.org/publication/PubMed/26119732" } ] }, { "title": "The nucleoprotein gene of Ebola virus: cloning, sequencing, and in vitro expression.", "journal": "Virology", "date": "1989", "authors": "Sanchez A., Auperin D.D., Holloway B.P., Kiley M.P., McCormick J.B.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "2718390", "url": "https://glygen.org/publication/PubMed/2718390" } ] }, { "title": "The Ebola Virus VP30-NP Interaction Is a Regulator of Viral RNA Synthesis.", "journal": "PLoS pathogens", "date": "2016-10", "authors": "Kirchdoerfer Robert N, Moyer Crystal L, Abelson Dafna M, Saphire Erica Ollmann", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "27755595", "url": "https://glygen.org/publication/PubMed/27755595" } ] }, { "title": "Ebola virus VP24 interacts with NP to facilitate nucleocapsid assembly and genome packaging.", "journal": "Scientific reports", "date": "2017-08-09", "authors": "Banadyga Logan, Hoenen Thomas, Ambroggio Xavier, Dunham Eric, Groseth Allison, Ebihara Hideki", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "28794491", "url": "https://glygen.org/publication/PubMed/28794491" } ] }, { "title": "Structure and assembly of the Ebola virus nucleocapsid.", "journal": "Nature", "date": "2017-11-16", "authors": "Wan William, Kolesnikova Larissa, Clarke Mairi, Koehler Alexander, Noda Takeshi, Becker Stephan, Briggs John A G", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "29144446", "url": "https://glygen.org/publication/PubMed/29144446" } ] }, { "title": "The Ebola Virus Nucleoprotein Recruits the Host PP2A-B56 Phosphatase to Activate Transcriptional Support Activity of VP30.", "journal": "Molecular cell", "date": "2018-01-04", "authors": "Kruse Thomas, Biedenkopf Nadine, Hertz Emil Peter Thrane, Dietzel Erik, Stalmann Gertrud, L\u00f3pez-M\u00e9ndez Blanca, Davey Norman E, Nilsson Jakob, Becker Stephan", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "29290611", "url": "https://glygen.org/publication/PubMed/29290611" } ] }, { "title": "Ebola virus proteins NP, VP35, and VP24 are essential and sufficient to mediate nucleocapsid transport.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2018", "authors": "Becker S., Takamatsu Y., Kolesnikova L.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "29339477", "url": "https://glygen.org/publication/PubMed/29339477" } ] }, { "title": "Electron Cryo-microscopy Structure of Ebola Virus Nucleoprotein Reveals a Mechanism for Nucleocapsid-like Assembly.", "journal": "Cell", "date": "2018", "authors": "Liu G., Wu C., Shi L., Leung D.W., Chen M., Su Z., Johnson B., Basler C.F., Chiu W., Luthra P., Ge P., Zhou Z.H., Gross M.L., Amarasinghe G.K., Bowman G.R., Porter J.R., Pintilie G.D., Binning J.M., Frederick T.E.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "29474922", "url": "https://glygen.org/publication/PubMed/29474922" } ] }, { "title": "Acetylation of lysine residues in the recombinant nucleoprotein and VP40 matrix protein of Zaire Ebolavirus by eukaryotic histone acetyltransferases.", "journal": "Biochemical and biophysical research communications", "date": "2018", "authors": "Hatakeyama D, Ohmi N, Saitoh A, Makiyama K, Morioka M, Okazaki H, Kuzuhara T", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "30205953", "url": "https://glygen.org/publication/PubMed/30205953" } ] }, { "title": "Staufen1 Interacts with Multiple Components of the Ebola Virus Ribonucleoprotein and Enhances Viral RNA Synthesis.", "journal": "mBio", "date": "2018", "authors": "Fang J, Pietzsch C, Ramanathan P, Santos RI, Ilinykh PA, Garcia-Blanco MA, Bukreyev A, Bradrick SS", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "30301857", "url": "https://glygen.org/publication/PubMed/30301857" } ] }, { "title": "Cryo-EM structure of the Ebola virus nucleoprotein-RNA complex at 3.6\u00a0\u00c5 resolution.", "journal": "Nature", "date": "2018-11", "authors": "Sugita Yukihiko, Matsunami Hideyuki, Kawaoka Yoshihiro, Noda Takeshi, Wolf Matthias", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "30333622", "url": "https://glygen.org/publication/PubMed/30333622" } ] }, { "title": "Identification of interferon-stimulated genes that attenuate Ebola virus infection.", "journal": "Nat. Commun.", "date": "2020", "authors": "Kuroda Makoto, Halfmann Peter J, Hill-Batorski Lindsay, Ozawa Makoto, Lopes Tiago J S, Neumann Gabriele, Schoggins John W, Rice Charles M, Kawaoka Yoshihiro", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "32528005", "url": "https://glygen.org/publication/PubMed/32528005" } ] }, { "title": "Sequence analysis of the Ebola virus genome: organization, genetic elements, and comparison with the genome of Marburg virus.", "journal": "Virus Res.", "date": "1993", "authors": "Sanchez A., Auperin D.D., Holloway B.P., Kiley M.P.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "reference": [ { "type": "PubMed", "id": "8237108", "url": "https://glygen.org/publication/PubMed/8237108" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "viral RNA genome packaging", "id": "GO:0019074", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019074", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "pmid": "" }, { "name": "viral nucleocapsid", "id": "GO:0019013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019013", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "pmid": "" }, { "name": "helical viral capsid", "id": "GO:0019029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019029", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 301, "end_pos": 303, "annotation": "n_glycosylation_sequon" }, { "start_pos": 500, "end_pos": 502, "annotation": "n_glycosylation_sequon" }, { "start_pos": 599, "end_pos": 601, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Acetylated by host EP300 in vitro.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" }, { "database": "PubMed", "id": "30205953", "url": "https://glygen.org/publication/PubMed/30205953" } ] }, { "annotation": "O-glycosylated by host.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" }, { "database": "PubMed", "id": "16571791", "url": "https://glygen.org/publication/PubMed/16571791" } ] }, { "annotation": "Phosphorylated by host.", "evidence": [ { "database": "UniProtKB", "id": "P18272", "url": "https://www.uniprot.org/uniprotkb/P18272" }, { "database": "PubMed", "id": "16571791", "url": "https://glygen.org/publication/PubMed/16571791" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "P18272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P18272" }, { "id": "29290611", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29290611" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "Host PPP2R5C-binding motif", "eco_id": "ECO_0000269", "start_pos": 562, "end_pos": 567, "start_aa": "Leu", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "P18272", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P18272" }, { "id": "29290611", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29290611" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "VP30-binding motif", "eco_id": "ECO_0000269", "start_pos": 606, "end_pos": 611, "start_aa": "Pro", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 301, "end_pos": 303 }, { "start_pos": 500, "end_pos": 502 }, { "start_pos": 599, "end_pos": 601 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 24 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "P60170-1", "uniprot_ac": "P60170", "uniprot_id": "VSGP_EBOZM", "mass": { "chemical_mass": 41175.0, "monoisotopic_mass": 41175.0 }, "refseq": { "ac": "NP_066247", "name": "small secreted glycoprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066247" }, "gene_names": [ { "name": "GP", "type": "recommended", "evidence": [ { "id": "P60170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P60170" } ] } ], "protein_names": [ { "name": "Pre-small/secreted glycoprotein", "type": "recommended", "evidence": [ { "id": "P60170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P60170/entry#names_and_taxonomy" } ] }, { "name": "pre-sGP", "type": "synonym", "evidence": [ { "id": "P60170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P60170/entry#names_and_taxonomy" } ] }, { "name": "sGP", "type": "synonym", "evidence": [ { "id": "NP_066247", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066247" } ] }, { "name": "small non-structural secreted glycoprotein", "type": "synonym", "evidence": [ { "id": "NP_066247", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066247" } ] }, { "name": "small secreted glycoprotein", "type": "synonym", "evidence": [ { "id": "NP_066247", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066247" } ] } ], "function": [ { "annotation": "Seems to possess an anti-inflammatory activity as it can reverse the barrier-decreasing effects of TNF alpha. Might therefore contribute to the lack of inflammatory reaction seen during infection in spite the of extensive necrosis and massive virus production. Does not seem to be involved in activation of primary macrophages. Does not seem to interact specifically with neutrophils.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170#function" }, { "database": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" }, { "database": "PubMed", "id": "16051836", "url": "https://glygen.org/publication/PubMed/16051836" }, { "database": "PubMed", "id": "12482654", "url": "https://glygen.org/publication/PubMed/12482654" } ] }, { "annotation": "Viroporin that permeabilizes mammalian cell plasma membranes. It acts by altering permeation of ionic compounds and small molecules. This activity may lead to viral enterotoxic activity.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170#function" }, { "database": "PubMed", "id": "25609303", "url": "https://glygen.org/publication/PubMed/25609303" }, { "database": "PubMed", "id": "28539454", "url": "https://glygen.org/publication/PubMed/28539454" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 324, "end_pos": 324, "sequence_org": "R", "sequence_mut": "S", "comment": "Loss of cleavage.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" }, { "database": "PubMed", "id": "10603327", "url": "https://glygen.org/publication/PubMed/10603327" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Zaire ebolavirus (strain Mayinga-76)", "taxid": 128952, "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "common_name": "Zaire ebolavirus", "glygen_name": "Ebola (EBOV)", "reference_species": "Zaire ebolavirus (strain Mayinga-76) [128952]" } ], "gene": [ { "name": "GP", "url": "https://www.uniprot.org/uniprotkb/P60170", "locus": {} } ], "crossref": [ { "id": "911829", "url": "https://www.ncbi.nlm.nih.gov/gene/911829", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002561", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002561", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014625", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014625", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF01611", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01611", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_066247", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066247", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "P60170-1", "url": "https://www.uniprot.org/uniprotkb/P60170-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKTSLEKFAVKSCLSQLYQTEPKTSVVRVRRELLPTQGPTQQLKTTKSWLQKIPLQWFKCTVKEGKLQCRI", "length": 364, "header": "sp|P60170-1|VSGP_EBOZM Isoform 1 of Pre-small/secreted glycoprotein OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=GP PE=1 SV=1 CANONICAL=P60170-1" }, "isoforms": [ { "isoform_ac": "P60170-1", "url": "https://www.uniprot.org/uniprotkb/P60170/entry#P60170-1", "sequence": { "sequence": "MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKTSLEKFAVKSCLSQLYQTEPKTSVVRVRRELLPTQGPTQQLKTTKSWLQKIPLQWFKCTVKEGKLQCRI", "length": 364, "header": "sp|P60170-1|VSGP_EBOZM Isoform 1 of Pre-small/secreted glycoprotein OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=GP PE=1 SV=1 CANONICAL=P60170-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "P60170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P60170#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "P60170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P60170#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "P60170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P60170#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "P60170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P60170#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "P60170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P60170#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "P60170", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P60170#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Delta-peptide is the carboxy-terminal cleavage fragment of the nonstructural small glycoprotein sGP of Ebola virus.", "journal": "Virology", "date": "1999-12-05", "authors": "Volchkova V A, Klenk H D, Volchkov V E", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "10603327", "url": "https://glygen.org/publication/PubMed/10603327" } ] }, { "title": "Molecular characterization of guinea pig-adapted variants of Ebola virus.", "journal": "Virology", "date": "2000", "authors": "Volchkov V.E., Klenk H.D., Chepurnov A.A., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "11062045", "url": "https://glygen.org/publication/PubMed/11062045" } ] }, { "title": "Ebola virus glycoprotein: proteolytic processing, acylation, cell tropism, and detection of neutralizing antibodies.", "journal": "Journal of virology", "date": "2001-02", "authors": "Ito H, Watanabe S, Takada A, Kawaoka Y", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" } ] }, { "title": "Evidence against Ebola virus sGP binding to human neutrophils by a specific receptor.", "journal": "Virology", "date": "2002-11-10", "authors": "Sui Jianhua, Marasco Wayne A", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "12482654", "url": "https://glygen.org/publication/PubMed/12482654" } ] }, { "title": "Disulfide bond assignment of the Ebola virus secreted glycoprotein SGP.", "journal": "Biochemical and biophysical research communications", "date": "2004-10-15", "authors": "Barrientos Laura G, Martin Amy M, Rollin Pierre E, Sanchez Anthony", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "15369806", "url": "https://glygen.org/publication/PubMed/15369806" } ] }, { "title": "Role of Ebola virus secreted glycoproteins and virus-like particles in activation of human macrophages.", "journal": "J. Virol.", "date": "2005", "authors": "Feldmann H., Burton D.R., Hazelton P.R., Kurz S.K., Schnittler H.J., Stroeher U., Wahl-Jensen V.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "15681442", "url": "https://glygen.org/publication/PubMed/15681442" } ] }, { "title": "Effects of Ebola virus glycoproteins on endothelial cell activation and barrier function.", "journal": "Journal of virology", "date": "2005-08", "authors": "Wahl-Jensen Victoria M, Afanasieva Tatiana A, Seebach Jochen, Str\u00f6her Ute, Feldmann Heinz, Schnittler Hans-Joachim", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "16051836", "url": "https://glygen.org/publication/PubMed/16051836" } ] }, { "title": "Modeling of the Ebola virus delta peptide reveals a potential lytic sequence motif.", "journal": "Viruses", "date": "2015-01-20", "authors": "Gallaher William R, Garry Robert F", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "25609303", "url": "https://glygen.org/publication/PubMed/25609303" } ] }, { "title": "Ebola Virus Delta Peptide Is a Viroporin.", "journal": "Journal of virology", "date": "2017-08-15", "authors": "He Jing, Melnik Lilia I, Komin Alexander, Wiedman Gregory, Fuselier Taylor, Morris Cameron F, Starr Charles G, Searson Peter C, Gallaher William R, Hristova Kalina, Garry Robert F, Wimley William C", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "28539454", "url": "https://glygen.org/publication/PubMed/28539454" } ] }, { "title": "GP mRNA of Ebola virus is edited by the Ebola virus polymerase and by T7 and vaccinia virus polymerases.", "journal": "Virology", "date": "1995", "authors": "Becker S., Volchkov V.E., Klenk H.-D., Kotov A.N., Netesov S.V., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "8553543", "url": "https://glygen.org/publication/PubMed/8553543" } ] }, { "title": "The virion glycoproteins of Ebola viruses are encoded in two reading frames and are expressed through transcriptional editing.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Sanchez A., Nichol S.T., Peters C.J., Mahy B.W.J., Trappier S.G.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "8622982", "url": "https://glygen.org/publication/PubMed/8622982" } ] }, { "title": "The nonstructural small glycoprotein sGP of Ebola virus is secreted as an antiparallel-orientated homodimer.", "journal": "Virology", "date": "1998-10-25", "authors": "Volchkova V A, Feldmann H, Klenk H D, Volchkov V E", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "reference": [ { "type": "PubMed", "id": "9792851", "url": "https://glygen.org/publication/PubMed/9792851" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "pmid": "" }, { "name": "host cell membrane", "id": "GO:0033644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033644", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "monoatomic ion transmembrane transport", "id": "GO:0034220", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034220", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "channel activity", "id": "GO:0015267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015267", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 228, "end_pos": 230, "annotation": "n_glycosylation_sequon" }, { "start_pos": 238, "end_pos": 240, "annotation": "n_glycosylation_sequon" }, { "start_pos": 257, "end_pos": 259, "annotation": "n_glycosylation_sequon" }, { "start_pos": 268, "end_pos": 270, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" }, { "database": "PubMed", "id": "10603327", "url": "https://glygen.org/publication/PubMed/10603327" } ] }, { "annotation": "O-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" }, { "database": "PubMed", "id": "10603327", "url": "https://glygen.org/publication/PubMed/10603327" } ] }, { "annotation": "This precursor is processed into mature sGP and delta-peptide by host furin or furin-like proteases. The cleavage site corresponds to the furin optimal cleavage sequence [KR]-X-[KR]-R.", "evidence": [ { "database": "UniProtKB", "id": "P60170", "url": "https://www.uniprot.org/uniprotkb/P60170" }, { "database": "PubMed", "id": "10603327", "url": "https://glygen.org/publication/PubMed/10603327" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 40, 204, 228, 238, 257, 268 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 204, "end_pos": 206 }, { "start_pos": 228, "end_pos": 230 }, { "start_pos": 238, "end_pos": 240 }, { "start_pos": 257, "end_pos": 259 }, { "start_pos": 268, "end_pos": 270 }, { "start_pos": 40, "end_pos": 42 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 12 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q05127-1", "uniprot_ac": "Q05127", "uniprot_id": "VP35_EBOZM", "mass": { "chemical_mass": 37362.0, "monoisotopic_mass": 37362.0 }, "refseq": { "ac": "NP_066244", "name": "polymerase complex protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066244" }, "gene_names": [ { "name": "VP35", "type": "recommended", "evidence": [ { "id": "Q05127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ] } ], "protein_names": [ { "name": "Polymerase cofactor VP35", "type": "recommended", "evidence": [ { "id": "Q05127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05127/entry#names_and_taxonomy" } ] }, { "name": "Ebola VP35", "type": "synonym", "evidence": [ { "id": "Q05127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05127/entry#names_and_taxonomy" } ] }, { "name": "eVP35", "type": "synonym", "evidence": [ { "id": "Q05127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05127/entry#names_and_taxonomy" } ] }, { "name": "polymerase complex protein", "type": "synonym", "evidence": [ { "id": "NP_066244", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066244" } ] } ], "function": [ { "annotation": "Plays an essential role in viral RNA synthesis and also a role in suppressing innate immune signaling (PubMed:11027311, PubMed:35533195). Acts as a polymerase cofactor in the RNA polymerase transcription and replication complexes (PubMed:16495261, PubMed:24495995, PubMed:9971816). Serves as nucleoprotein/NP monomer chaperone prior to the formation of the large oligomeric RNA-bound complexes (By similarity). Part of the external layer of the nucleocapsid, likely tethering the nucleocapsid to the matrix and membrane (PubMed:39293445). Regulates RNA synthesis by modulating NP-RNA interactions and interacting with DYNLL1 (PubMed:25741013). VP35-NP interaction controls the switch between RNA-bound NP and free NP and thus the switch between genome replication and genome packaging into the nucleocapsid (PubMed:25865894). Prevents establishment of cellular antiviral state, thereby suppressing host DC maturation (PubMed:26962215). Acts by inhibiting host RIGI activation both by shielding dsRNA from detection and by preventing PRKRA binding to RIGI (PubMed:23870315). Blocks virus-induced phosphorylation and activation of interferon regulatory factor 3/IRF3, a transcription factor critical for the induction of interferons alpha and beta (PubMed:12829834). This blockage is produced through the interaction with and inhibition of host IKBKE and TBK1, producing a strong inhibition of the phosphorylation and activation of IRF3 (PubMed:12829834). Also inhibits the antiviral effect mediated by the host interferon-induced, double-stranded RNA-activated protein kinase EIF2AK2/PKR (PubMed:17065211). Increases PIAS1-mediated SUMOylation of IRF7, thereby repressing interferon transcription (PubMed:19557165). Also acts as a suppressor of RNA silencing by interacting with host DICER1, TARBP2/TRBP and PRKRA/PACT (By similarity). As a dimer, binds and sequesters dsRNA contributing to the inhibition of interferon production (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127#function" }, { "database": "PubMed", "id": "39293445", "url": "https://glygen.org/publication/PubMed/39293445" }, { "database": "PubMed", "id": "35533195", "url": "https://glygen.org/publication/PubMed/35533195" }, { "database": "PubMed", "id": "17065211", "url": "https://glygen.org/publication/PubMed/17065211" }, { "database": "PubMed", "id": "25865894", "url": "https://glygen.org/publication/PubMed/25865894" }, { "database": "PubMed", "id": "19557165", "url": "https://glygen.org/publication/PubMed/19557165" }, { "database": "PubMed", "id": "26962215", "url": "https://glygen.org/publication/PubMed/26962215" }, { "database": "UniProtKB", "id": "Q8JPY0", "url": "https://www.uniprot.org/uniprotkb/Q8JPY0#function" }, { "database": "PubMed", "id": "16495261", "url": "https://glygen.org/publication/PubMed/16495261" }, { "database": "PubMed", "id": "12829834", "url": "https://glygen.org/publication/PubMed/12829834" }, { "database": "PubMed", "id": "24495995", "url": "https://glygen.org/publication/PubMed/24495995" }, { "database": "PubMed", "id": "9971816", "url": "https://glygen.org/publication/PubMed/9971816" }, { "database": "PubMed", "id": "11027311", "url": "https://glygen.org/publication/PubMed/11027311" }, { "database": "PubMed", "id": "25741013", "url": "https://glygen.org/publication/PubMed/25741013" }, { "database": "UniProtKB", "id": "Q5XX07", "url": "https://www.uniprot.org/uniprotkb/Q5XX07#function" }, { "database": "UniProtKB", "id": "Q6V1Q9", "url": "https://www.uniprot.org/uniprotkb/Q6V1Q9#function" }, { "database": "PubMed", "id": "23870315", "url": "https://glygen.org/publication/PubMed/23870315" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 107, "end_pos": 107, "sequence_org": "L", "sequence_mut": "A", "comment": "Complete loss of homotrimerization; when associated with 90-AASA-93.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "16095644", "url": "https://glygen.org/publication/PubMed/16095644" } ] }, { "start_pos": 187, "end_pos": 187, "sequence_org": "S", "sequence_mut": "A", "comment": "Impaired viral replication.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "31694758", "url": "https://glygen.org/publication/PubMed/31694758" } ] }, { "start_pos": 187, "end_pos": 187, "sequence_org": "S", "sequence_mut": "D", "comment": "No effect on viral replication.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "31694758", "url": "https://glygen.org/publication/PubMed/31694758" } ] }, { "start_pos": 210, "end_pos": 210, "sequence_org": "T", "sequence_mut": "A", "comment": "Loss of viral transcription and reduced binding to the nucleoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "31562565", "url": "https://glygen.org/publication/PubMed/31562565" } ] }, { "start_pos": 210, "end_pos": 210, "sequence_org": "T", "sequence_mut": "D", "comment": "No effect on viral transcription and binding to the nucleoprotein.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "31562565", "url": "https://glygen.org/publication/PubMed/31562565" } ] }, { "start_pos": 239, "end_pos": 239, "sequence_org": "F", "sequence_mut": "A", "comment": "Complete loss of interaction with host PRKRA and subsequent immune response inhibition.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "23870315", "url": "https://glygen.org/publication/PubMed/23870315" } ] }, { "start_pos": 305, "end_pos": 305, "sequence_org": "R", "sequence_mut": "A", "comment": "No effect on IRF3 promoter inhibition.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "15464838", "url": "https://glygen.org/publication/PubMed/15464838" } ] }, { "start_pos": 309, "end_pos": 309, "sequence_org": "K", "sequence_mut": "A", "comment": "Partial loss of IRF3 promoter inhibition. Complete loss of dsRNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "16698997", "url": "https://glygen.org/publication/PubMed/16698997" }, { "database": "PubMed", "id": "15464838", "url": "https://glygen.org/publication/PubMed/15464838" } ] }, { "start_pos": 309, "end_pos": 309, "sequence_org": "K", "sequence_mut": "R", "comment": "Partial loss of the ability to efficiently antagonize the type IIFN response.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "35533195", "url": "https://glygen.org/publication/PubMed/35533195" } ] }, { "start_pos": 312, "end_pos": 312, "sequence_org": "R", "sequence_mut": "A", "comment": "Complete loss of IRF3 promoter inhibition; dsRNA-binding and interaction with host PRKRA.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "16698997", "url": "https://glygen.org/publication/PubMed/16698997" }, { "database": "PubMed", "id": "15464838", "url": "https://glygen.org/publication/PubMed/15464838" }, { "database": "PubMed", "id": "23870315", "url": "https://glygen.org/publication/PubMed/23870315" } ] }, { "start_pos": 317, "end_pos": 317, "sequence_org": "S", "sequence_mut": "A", "comment": "Impaired viral replication.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "31694758", "url": "https://glygen.org/publication/PubMed/31694758" } ] }, { "start_pos": 317, "end_pos": 317, "sequence_org": "S", "sequence_mut": "D", "comment": "No effect on viral replication.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "31694758", "url": "https://glygen.org/publication/PubMed/31694758" } ] }, { "start_pos": 319, "end_pos": 319, "sequence_org": "K", "sequence_mut": "A", "comment": "Complete loss of dsRNA binding activity; when associated with A-322.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "20071589", "url": "https://glygen.org/publication/PubMed/20071589" } ] }, { "start_pos": 322, "end_pos": 322, "sequence_org": "R", "sequence_mut": "A", "comment": "Complete loss of dsRNA binding activity; when associated with A-319.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "20071589", "url": "https://glygen.org/publication/PubMed/20071589" } ] }, { "start_pos": 90, "end_pos": 93, "sequence_org": "LASL", "sequence_mut": "AASA", "comment": "Complete loss of homotrimerization; when associated with A-107.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "16095644", "url": "https://glygen.org/publication/PubMed/16095644" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Zaire ebolavirus (strain Mayinga-76)", "taxid": 128952, "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "common_name": "Zaire ebolavirus", "glygen_name": "Ebola (EBOV)", "reference_species": "Zaire ebolavirus (strain Mayinga-76) [128952]" } ], "gene": [ { "name": "VP35", "url": "https://www.uniprot.org/uniprotkb/Q05127", "locus": {} } ], "crossref": [ { "id": "911827", "url": "https://www.ncbi.nlm.nih.gov/gene/911827", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3FKE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3FKE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3L25", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3L25&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3L26", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3L26&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3L27", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3L27&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3L28", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3L28&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3L29", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3L29&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IBB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IBB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IBC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IBC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IBD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IBD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IBE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IBE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IBF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IBF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IBG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IBG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IBI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IBI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IBJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IBJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IBK", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IBK&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IJE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IJE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4IJF", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4IJF&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4YPI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4YPI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4ZTA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4ZTA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4ZTG", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4ZTG&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4ZTI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4ZTI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6GBO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6GBO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6GBP", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6GBP&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8USN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8USN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8UST", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8UST&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9IP3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9IP3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "IPR002953", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002953", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031163", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031163", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043060", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043060", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043061", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043061", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00003fke", "url": "https://www.rcsb.org/structure/pdb_00003fke", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003l25", "url": "https://www.rcsb.org/structure/pdb_00003l25", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003l26", "url": "https://www.rcsb.org/structure/pdb_00003l26", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003l27", "url": "https://www.rcsb.org/structure/pdb_00003l27", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003l28", "url": "https://www.rcsb.org/structure/pdb_00003l28", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003l29", "url": "https://www.rcsb.org/structure/pdb_00003l29", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ibb", "url": "https://www.rcsb.org/structure/pdb_00004ibb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ibc", "url": "https://www.rcsb.org/structure/pdb_00004ibc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ibd", "url": "https://www.rcsb.org/structure/pdb_00004ibd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ibe", "url": "https://www.rcsb.org/structure/pdb_00004ibe", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ibf", "url": "https://www.rcsb.org/structure/pdb_00004ibf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ibg", "url": "https://www.rcsb.org/structure/pdb_00004ibg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ibi", "url": "https://www.rcsb.org/structure/pdb_00004ibi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ibj", "url": "https://www.rcsb.org/structure/pdb_00004ibj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ibk", "url": "https://www.rcsb.org/structure/pdb_00004ibk", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ije", "url": "https://www.rcsb.org/structure/pdb_00004ije", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ijf", "url": "https://www.rcsb.org/structure/pdb_00004ijf", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ypi", "url": "https://www.rcsb.org/structure/pdb_00004ypi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004zta", "url": "https://www.rcsb.org/structure/pdb_00004zta", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ztg", "url": "https://www.rcsb.org/structure/pdb_00004ztg", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004zti", "url": "https://www.rcsb.org/structure/pdb_00004zti", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006gbo", "url": "https://www.rcsb.org/structure/pdb_00006gbo", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006gbp", "url": "https://www.rcsb.org/structure/pdb_00006gbp", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008usn", "url": "https://www.rcsb.org/structure/pdb_00008usn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ust", "url": "https://www.rcsb.org/structure/pdb_00008ust", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009ip3", "url": "https://www.rcsb.org/structure/pdb_00009ip3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FKE", "url": "https://www.rcsb.org/structure/3FKE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L25", "url": "https://www.rcsb.org/structure/3L25", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L26", "url": "https://www.rcsb.org/structure/3L26", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L27", "url": "https://www.rcsb.org/structure/3L27", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L28", "url": "https://www.rcsb.org/structure/3L28", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3L29", "url": "https://www.rcsb.org/structure/3L29", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IBB", "url": "https://www.rcsb.org/structure/4IBB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IBC", "url": "https://www.rcsb.org/structure/4IBC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IBD", "url": "https://www.rcsb.org/structure/4IBD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IBE", "url": "https://www.rcsb.org/structure/4IBE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IBF", "url": "https://www.rcsb.org/structure/4IBF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IBG", "url": "https://www.rcsb.org/structure/4IBG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IBI", "url": "https://www.rcsb.org/structure/4IBI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IBJ", "url": "https://www.rcsb.org/structure/4IBJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IBK", "url": "https://www.rcsb.org/structure/4IBK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IJE", "url": "https://www.rcsb.org/structure/4IJE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4IJF", "url": "https://www.rcsb.org/structure/4IJF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YPI", "url": "https://www.rcsb.org/structure/4YPI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZTA", "url": "https://www.rcsb.org/structure/4ZTA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZTG", "url": "https://www.rcsb.org/structure/4ZTG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZTI", "url": "https://www.rcsb.org/structure/4ZTI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6GBO", "url": "https://www.rcsb.org/structure/6GBO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6GBP", "url": "https://www.rcsb.org/structure/6GBP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8USN", "url": "https://www.rcsb.org/structure/8USN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8UST", "url": "https://www.rcsb.org/structure/8UST", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9IP3", "url": "https://www.rcsb.org/structure/9IP3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF02097", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02097", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_066244", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066244", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q05127-1", "url": "https://www.uniprot.org/uniprotkb/Q05127-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTTRTKGRGHTAATTQNDRMPGPELSGWISEQLMTGRIPVSDIFCDIENNPGLCYASQMQQTKPNPKTRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATEAYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLNSTTSLTEENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI", "length": 340, "header": "sp|Q05127-1|VP35_EBOZM Isoform 1 of Polymerase cofactor VP35 OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=VP35 PE=1 SV=1 CANONICAL=Q05127-1" }, "isoforms": [ { "isoform_ac": "Q05127-1", "url": "https://www.uniprot.org/uniprotkb/Q05127/entry#Q05127-1", "sequence": { "sequence": "MTTRTKGRGHTAATTQNDRMPGPELSGWISEQLMTGRIPVSDIFCDIENNPGLCYASQMQQTKPNPKTRNSQTQTDPICNHSFEEVVQTLASLATVVQQQTIASESLEQRITSLENGLKPVYDMAKTISSLNRVCAEMVAKYDLLVMTTGRATATAAATEAYWAEHGQPPPGPSLYEESAIRGKIESRDETVPQSVREAFNNLNSTTSLTEENFGKPDISAKDLRNIMYDHLPGFGTAFHQLVQVICKLGKDSNSLDIIHAEFQASLAEGDSPQCALIQITKRVPIFQDAAPPVIHIRSRGDIPRACQKSLRPVPPSPKIDRGWVCVFQLQDGKTLGLKI", "length": 340, "header": "sp|Q05127-1|VP35_EBOZM Isoform 1 of Polymerase cofactor VP35 OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=VP35 PE=1 SV=1 CANONICAL=Q05127-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 187, "end_pos": 187, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by host", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "site_lbl": "Ser187" }, { "start_pos": 205, "end_pos": 205, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by host", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "site_lbl": "Ser205" }, { "start_pos": 206, "end_pos": 206, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by host", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "site_lbl": "Thr206" }, { "start_pos": 207, "end_pos": 207, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by host", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "site_lbl": "Thr207" }, { "start_pos": 208, "end_pos": 208, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by host", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "site_lbl": "Ser208" }, { "start_pos": 210, "end_pos": 210, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by host", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "site_lbl": "Thr210" }, { "start_pos": 310, "end_pos": 310, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by host", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "site_lbl": "Ser310" }, { "start_pos": 317, "end_pos": 317, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by host", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "site_lbl": "Ser317" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of the L gene and 5' trailer region of Ebola virus.", "journal": "J. Gen. Virol.", "date": "1999", "authors": "Feldmann H., Volchkov V.E., Blinov V.M., Chepurnov A.A., Netesov S.V., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "10073695", "url": "https://glygen.org/publication/PubMed/10073695" } ] }, { "title": "The Ebola virus VP35 protein functions as a type I IFN antagonist.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000-10-24", "authors": "Basler C F, Wang X, M\u00fchlberger E, Volchkov V, Paragas J, Klenk H D, Garc\u00eda-Sastre A, Palese P", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "11027311", "url": "https://glygen.org/publication/PubMed/11027311" } ] }, { "title": "Molecular characterization of guinea pig-adapted variants of Ebola virus.", "journal": "Virology", "date": "2000", "authors": "Volchkov V.E., Klenk H.D., Chepurnov A.A., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "11062045", "url": "https://glygen.org/publication/PubMed/11062045" } ] }, { "title": "The assembly of Ebola virus nucleocapsid requires virion-associated proteins 35 and 24 and posttranslational modification of nucleoprotein.", "journal": "Mol. Cell", "date": "2002", "authors": "Huang Yue, Xu Ling, Sun Yongnian, Nabel Gary J", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "12191476", "url": "https://glygen.org/publication/PubMed/12191476" } ] }, { "title": "The Ebola virus VP35 protein inhibits activation of interferon regulatory factor 3.", "journal": "Journal of virology", "date": "2003-07", "authors": "Basler Christopher F, Mikulasova Andrea, Martinez-Sobrido Luis, Paragas Jason, M\u00fchlberger Elke, Bray Mike, Klenk Hans-Dieter, Palese Peter, Garc\u00eda-Sastre Adolfo", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "12829834", "url": "https://glygen.org/publication/PubMed/12829834" } ] }, { "title": "A C-terminal basic amino acid motif of Zaire ebolavirus VP35 is essential for type I interferon antagonism and displays high identity with the RNA-binding domain of another interferon antagonist, the NS1 protein of influenza A virus.", "journal": "Virology", "date": "2004-10-25", "authors": "Hartman Amy L, Towner Jonathan S, Nichol Stuart T", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "15464838", "url": "https://glygen.org/publication/PubMed/15464838" } ] }, { "title": "Homo-oligomerization facilitates the interferon-antagonist activity of the ebolavirus VP35 protein.", "journal": "Virology", "date": "2005-10-25", "authors": "Reid St Patrick, C\u00e1rdenas Washington B, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "16095644", "url": "https://glygen.org/publication/PubMed/16095644" } ] }, { "title": "VP35 knockdown inhibits Ebola virus amplification and protects against lethal infection in mice.", "journal": "Antimicrobial agents and chemotherapy", "date": "2006-03", "authors": "Enterlein Sven, Warfield Kelly L, Swenson Dana L, Stein David A, Smith Jeffery L, Gamble C Scott, Kroeker Andrew D, Iversen Patrick L, Bavari Sina, M\u00fchlberger Elke", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "16495261", "url": "https://glygen.org/publication/PubMed/16495261" } ] }, { "title": "Ebola virus VP35-VP40 interaction is sufficient for packaging 3E-5E minigenome RNA into virus-like particles.", "journal": "J. Virol.", "date": "2006", "authors": "Harty R.N., Godlewski P.J., Johnson R.F., McCarthy S.E.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "16698994", "url": "https://glygen.org/publication/PubMed/16698994" } ] }, { "title": "Ebola virus VP35 protein binds double-stranded RNA and inhibits alpha/beta interferon production induced by RIG-I signaling.", "journal": "Journal of virology", "date": "2006-06", "authors": "C\u00e1rdenas Washington B, Loo Yueh-Ming, Gale Michael, Hartman Amy L, Kimberlin Christopher R, Mart\u00ednez-Sobrido Luis, Saphire Erica Ollmann, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "16698997", "url": "https://glygen.org/publication/PubMed/16698997" } ] }, { "title": "The VP35 protein of Ebola virus inhibits the antiviral effect mediated by double-stranded RNA-dependent protein kinase PKR.", "journal": "Journal of virology", "date": "2007-01", "authors": "Feng Zongdi, Cerveny Melissa, Yan Zhipeng, He Bin", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "17065211", "url": "https://glygen.org/publication/PubMed/17065211" } ] }, { "title": "Structure of the Ebola VP35 interferon inhibitory domain.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2009", "authors": "Leung D.W., Basler C.F., Nix J., Fulton D.B., Honzatko R.B., Amarasinghe G.K., Ginder N.D.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "19122151", "url": "https://glygen.org/publication/PubMed/19122151" } ] }, { "title": "Ebola virus protein VP35 impairs the function of interferon regulatory factor-activating kinases IKKepsilon and TBK-1.", "journal": "Journal of virology", "date": "2009-04", "authors": "Prins Kathleen C, C\u00e1rdenas Washington B, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "19153231", "url": "https://glygen.org/publication/PubMed/19153231" } ] }, { "title": "Ebolavirus VP35 interacts with the cytoplasmic dynein light chain 8.", "journal": "J. Virol.", "date": "2009", "authors": "Kubota Toru, Matsuoka Mayumi, Chang Tsung-Hsien, Bray Mike, Jones Steven, Tashiro Masato, Kato Atsushi, Ozato Keiko", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "19403681", "url": "https://glygen.org/publication/PubMed/19403681" } ] }, { "title": "Ebola Zaire virus blocks type I interferon production by exploiting the host SUMO modification machinery.", "journal": "PLoS pathogens", "date": "2009-06", "authors": "Chang Tsung-Hsien, Kubota Toru, Matsuoka Mayumi, Jones Steven, Bradfute Steven B, Bray Mike, Ozato Keiko", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "19557165", "url": "https://glygen.org/publication/PubMed/19557165" } ] }, { "title": "Mutations abrogating VP35 interaction with double-stranded RNA render Ebola virus avirulent in guinea pigs.", "journal": "Journal of virology", "date": "2010-03", "authors": "Prins Kathleen C, Delpeut Sebastien, Leung Daisy W, Reynard Olivier, Volchkova Valentina A, Reid St Patrick, Ramanan Parameshwaran, C\u00e1rdenas Washington B, Amarasinghe Gaya K, Volchkov Viktor E, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "20071589", "url": "https://glygen.org/publication/PubMed/20071589" } ] }, { "title": "Structural basis for dsRNA recognition and interferon antagonism by Ebola VP35.", "journal": "Nat. Struct. Mol. Biol.", "date": "2010", "authors": "Otwinowski Z., Leung D.W., Basler C.F., Prins K.C., Honzatko R.B., Nix J.C., Borek D.M., Amarasinghe G.K., Ramanan P., Helgeson L.A., Farahbakhsh M., Tufariello J.M.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "20081868", "url": "https://glygen.org/publication/PubMed/20081868" } ] }, { "title": "Phosphorylation of Ebola virus VP30 influences the composition of the viral nucleocapsid complex: impact on viral transcription and replication.", "journal": "J. Biol. Chem.", "date": "2013", "authors": "Hartlieb B., Becker S., Biedenkopf N., Hoenen T.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "23493393", "url": "https://glygen.org/publication/PubMed/23493393" } ] }, { "title": "Mutual antagonism between the Ebola virus VP35 protein and the RIG-I activator PACT determines infection outcome.", "journal": "Cell host & microbe", "date": "2013-07-17", "authors": "Luthra Priya, Ramanan Parameshwaran, Mire Chad E, Weisend Carla, Tsuda Yoshimi, Yen Benjamin, Liu Gai, Leung Daisy W, Geisbert Thomas W, Ebihara Hideki, Amarasinghe Gaya K, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "23870315", "url": "https://glygen.org/publication/PubMed/23870315" } ] }, { "title": "Development of RNA aptamers targeting Ebola virus VP35.", "journal": "Biochemistry", "date": "2013", "authors": "Liu G., Xu W., Leung D.W., Wang T., Basler C.F., Luthra P., Borek D.M., Amarasinghe G.K., Shabman R.S., Binning J.M.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "24067086", "url": "https://glygen.org/publication/PubMed/24067086" } ] }, { "title": "In silico derived small molecules bind the filovirus VP35 protein and inhibit its polymerase cofactor activity.", "journal": "Journal of molecular biology", "date": "2014-05-15", "authors": "Brown Craig S, Lee Michael S, Leung Daisy W, Wang Tianjiao, Xu Wei, Luthra Priya, Anantpadma Manu, Shabman Reed S, Melito Lisa M, MacMillan Karen S, Borek Dominika M, Otwinowski Zbyszek, Ramanan Parameshwaran, Stubbs Alisha J, Peterson Dayna S, Binning Jennifer M, Tonelli Marco, Olson Mark A, Davey Robert A, Ready Joseph M, Basler Christopher F, Amarasinghe Gaya K", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "24495995", "url": "https://glygen.org/publication/PubMed/24495995" } ] }, { "title": "Ebola virus VP35 interaction with dynein LC8 regulates viral RNA synthesis.", "journal": "Journal of virology", "date": "2015-05", "authors": "Luthra Priya, Jordan David S, Leung Daisy W, Amarasinghe Gaya K, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "25741013", "url": "https://glygen.org/publication/PubMed/25741013" } ] }, { "title": "An Intrinsically Disordered Peptide from Ebola Virus VP35 Controls Viral RNA Synthesis by Modulating Nucleoprotein-RNA Interactions.", "journal": "Cell reports", "date": "2015-04-21", "authors": "Leung Daisy W, Borek Dominika, Luthra Priya, Binning Jennifer M, Anantpadma Manu, Liu Gai, Harvey Ian B, Su Zhaoming, Endlich-Frazier Ariel, Pan Juanli, Shabman Reed S, Chiu Wah, Davey Robert A, Otwinowski Zbyszek, Basler Christopher F, Amarasinghe Gaya K", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "25865894", "url": "https://glygen.org/publication/PubMed/25865894" } ] }, { "title": "Effects of Filovirus Interferon Antagonists on Responses of Human Monocyte-Derived Dendritic Cells to RNA Virus Infection.", "journal": "Journal of virology", "date": "2016-05-15", "authors": "Yen Benjamin C, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "26962215", "url": "https://glygen.org/publication/PubMed/26962215" } ] }, { "title": "Ebola virus VP24 interacts with NP to facilitate nucleocapsid assembly and genome packaging.", "journal": "Sci. Rep.", "date": "2017", "authors": "Banadyga Logan, Hoenen Thomas, Ambroggio Xavier, Dunham Eric, Groseth Allison, Ebihara Hideki", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "28794491", "url": "https://glygen.org/publication/PubMed/28794491" } ] }, { "title": "Structures of Ebola and Reston Virus VP35 Oligomerization Domains and Comparative Biophysical Characterization in All Ebolavirus Species.", "journal": "Structure", "date": "2019", "authors": "Bracher A., Nagy I., Baumeister W., Orsini M., Weyher-Stingl E., Zinzula L.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "30482729", "url": "https://glygen.org/publication/PubMed/30482729" } ] }, { "title": "Global phosphoproteomic analysis of Ebola virions reveals a novel role for VP35 phosphorylation-dependent regulation of genome transcription.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2020-07", "authors": "Ivanov Andrey, Ramanathan Palaniappan, Parry Christian, Ilinykh Philipp A, Lin Xionghao, Petukhov Michael, Obukhov Yuri, Ammosova Tatiana, Amarasinghe Gaya K, Bukreyev Alexander, Nekhai Sergei", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "31562565", "url": "https://glygen.org/publication/PubMed/31562565" } ] }, { "title": "Ebola virus replication is regulated by the phosphorylation of viral protein VP35.", "journal": "Biochemical and biophysical research communications", "date": "2020-01-15", "authors": "Zhu Lin, Gao Ting, Yang Weihong, Liu Yaoning, Liu Xuan, Hu Yong, Jin Yanwen, Li Ping, Xu Ke, Zou Gang, Zhao Lei, Cao Ruiyuan, Zhong Wu, Xia Xianzhu, Cao Cheng", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "31694758", "url": "https://glygen.org/publication/PubMed/31694758" } ] }, { "title": "Ubiquitination of Ebola virus VP35 at lysine 309 regulates viral transcription and assembly.", "journal": "PLoS pathogens", "date": "2022-05", "authors": "van Tol Sarah, Kalveram Birte, Ilinykh Philipp A, Ronk Adam, Huang Kai, Aguilera-Aguirre Leopoldo, Bharaj Preeti, Hage Adam, Atkins Colm, Giraldo Maria I, Wakamiya Maki, Gonzalez-Orozco Maria, Warren Abbey N, Bukreyev Alexander, Freiberg Alexander N, Rajsbaum Ricardo", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "35533195", "url": "https://glygen.org/publication/PubMed/35533195" } ] }, { "title": "Intracellular Ebola virus nucleocapsid assembly revealed by in situ cryo-electron tomography.", "journal": "Cell", "date": "2024-10-03", "authors": "Watanabe Reika, Zyla Dawid, Parekh Diptiben, Hong Connor, Jones Ying, Schendel Sharon L, Wan William, Castillon Guillaume, Saphire Erica Ollmann", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "39293445", "url": "https://glygen.org/publication/PubMed/39293445" } ] }, { "title": "Structural insights into the RNA-dependent RNA polymerase complexes from highly pathogenic Marburg and Ebola viruses.", "journal": "Nat. Commun.", "date": "2025", "authors": "Wang J., Wu S., Zhang L., Zhang X., Li G., Du T., Ren Z., Ru H., Jie K.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "40164610", "url": "https://glygen.org/publication/PubMed/40164610" } ] }, { "title": "Sequence analysis of the Ebola virus genome: organization, genetic elements, and comparison with the genome of Marburg virus.", "journal": "Virus Res.", "date": "1993", "authors": "Sanchez A., Auperin D.D., Holloway B.P., Kiley M.P.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "8237108", "url": "https://glygen.org/publication/PubMed/8237108" } ] }, { "title": "The VP35 and VP40 proteins of filoviruses. Homology between Marburg and Ebola viruses.", "journal": "FEBS Lett.", "date": "1993", "authors": "Volchkov V.E., Blinov V.M., Bukreyev A.A., Netesov S.V.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "8482365", "url": "https://glygen.org/publication/PubMed/8482365" } ] }, { "title": "Comparison of the transcription and replication strategies of marburg virus and Ebola virus by using artificial replication systems.", "journal": "Journal of virology", "date": "1999-03", "authors": "M\u00fchlberger E, Weik M, Volchkov V E, Klenk H D, Becker S", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "reference": [ { "type": "PubMed", "id": "9971816", "url": "https://glygen.org/publication/PubMed/9971816" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "negative regulation of miRNA-mediated gene silencing", "id": "GO:0060965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060965", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "negative regulation of gene expression", "id": "GO:0010629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010629", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "viral transcription", "id": "GO:0019083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019083", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "viral genome replication", "id": "GO:0019079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019079", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "positive regulation of protein sumoylation", "id": "GO:0033235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033235", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host type I interferon-mediated signaling pathway", "id": "GO:0039502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039502", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host PKR/eIFalpha signaling", "id": "GO:0039580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039580", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host toll-like receptor signaling pathway", "id": "GO:0039722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039722", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of TBK1 activity", "id": "GO:0039723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039723", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host RNAi-mediated antiviral immune response", "id": "GO:0140533", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140533", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host innate immune response", "id": "GO:0052170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052170", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host antigen processing and presentation of peptide antigen via MHC class II", "id": "GO:0039505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039505", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IRF7 activity", "id": "GO:0039557", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039557", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host cytoplasmic pattern recognition receptor signaling pathway via inhibition of IKBKE activity", "id": "GO:0039724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039724", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host immune response", "id": "GO:0052562", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052562", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "molecular sequestering activity", "id": "GO:0140313", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140313", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "viral nucleocapsid", "id": "GO:0019013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019013", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 80, "end_pos": 82, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by host IKBKE (PubMed:19153231). Phosphorylation contributes to efficient viral replication and transcription (PubMed:31562565, PubMed:31694758).", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "19153231", "url": "https://glygen.org/publication/PubMed/19153231" }, { "database": "PubMed", "id": "31562565", "url": "https://glygen.org/publication/PubMed/31562565" }, { "database": "PubMed", "id": "31694758", "url": "https://glygen.org/publication/PubMed/31694758" } ] }, { "annotation": "Ubiquitinated by host TRIM6 to facilitate virus replication.", "evidence": [ { "database": "UniProtKB", "id": "Q05127", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "database": "PubMed", "id": "35533195", "url": "https://glygen.org/publication/PubMed/35533195" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "Q05127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "id": "19403681", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19403681" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "Required for host DYNLL1 interaction", "eco_id": "ECO_0000269", "start_pos": 71, "end_pos": 75, "start_aa": "Ser", "end_aa": "Thr", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05127", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05127" }, { "id": "PRU01071", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU01071" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "VP35 IID", "eco_id": "ECO_0000255", "start_pos": 215, "end_pos": 340, "start_aa": "Gly", "end_aa": "Ile", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 187, 205, 206, 207, 208, 210, 310, 317 ], "sequon_annotation_sites": [ { "start_pos": 204, "end_pos": 206 }, { "start_pos": 80, "end_pos": 82 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q05128-1", "uniprot_ac": "Q05128", "uniprot_id": "VP40_EBOZM", "mass": { "chemical_mass": 35183.0, "monoisotopic_mass": 35183.0 }, "refseq": { "ac": "NP_066245", "name": "matrix protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066245" }, "gene_names": [ { "name": "VP40", "type": "recommended", "evidence": [ { "id": "Q05128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ] } ], "protein_names": [ { "name": "Matrix protein VP40", "type": "recommended", "evidence": [ { "id": "Q05128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05128/entry#names_and_taxonomy" } ] }, { "name": "Ebola VP40", "type": "synonym", "evidence": [ { "id": "Q05128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05128/entry#names_and_taxonomy" } ] }, { "name": "Membrane-associated protein VP40", "type": "synonym", "evidence": [ { "id": "Q05128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05128/entry#names_and_taxonomy" } ] }, { "name": "eVP40", "type": "synonym", "evidence": [ { "id": "Q05128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05128/entry#names_and_taxonomy" } ] }, { "name": "matrix protein", "type": "synonym", "evidence": [ { "id": "NP_066245", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066245" } ] } ], "function": [ { "annotation": "Plays an essential role virus particle assembly and budding (PubMed:16719918, PubMed:33673144). Acts by interacting with viral ribonucleocapsid and host members of the ESCRT (endosomal sorting complex required for transport) system such as host VPS4, PDCD6IP/ALIX, NEDD4 or TGS101 (PubMed:15892969, PubMed:16719918, PubMed:23637409, PubMed:25786915, PubMed:26753796, PubMed:27489272). The interaction with host E3 ubiquitin ligase SMURF2 also facilitates virus budding (PubMed:33673144). May play a role in immune cell dysfunction by being packaged into exosomes that can decrease the viability of recipient cells (via RNAi suppression and exosome-bystander apoptosis) (PubMed:27872619).", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128#function" }, { "database": "PubMed", "id": "15892969", "url": "https://glygen.org/publication/PubMed/15892969" }, { "database": "PubMed", "id": "23637409", "url": "https://glygen.org/publication/PubMed/23637409" }, { "database": "PubMed", "id": "33673144", "url": "https://glygen.org/publication/PubMed/33673144" }, { "database": "PubMed", "id": "16719918", "url": "https://glygen.org/publication/PubMed/16719918" }, { "database": "PubMed", "id": "26753796", "url": "https://glygen.org/publication/PubMed/26753796" }, { "database": "PubMed", "id": "25786915", "url": "https://glygen.org/publication/PubMed/25786915" }, { "database": "PubMed", "id": "27872619", "url": "https://glygen.org/publication/PubMed/27872619" }, { "database": "PubMed", "id": "27489272", "url": "https://glygen.org/publication/PubMed/27489272" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 10, "end_pos": 11, "sequence_org": "PP", "sequence_mut": "AA", "comment": "90% loss of budding.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "16051823", "url": "https://glygen.org/publication/PubMed/16051823" } ] }, { "start_pos": 10, "end_pos": 13, "sequence_org": "PPEY", "sequence_mut": "AAEA", "comment": "Abolishes interaction with host SMURF2.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "33673144", "url": "https://glygen.org/publication/PubMed/33673144" } ] }, { "start_pos": 11, "end_pos": 11, "sequence_org": "P", "sequence_mut": "A", "comment": "Complete loss of budding.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ] }, { "start_pos": 125, "end_pos": 125, "sequence_org": "F", "sequence_mut": "A", "comment": "Partial loss of RNA-binding. Complete loss of virus infectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "15650213", "url": "https://glygen.org/publication/PubMed/15650213" } ] }, { "start_pos": 134, "end_pos": 134, "sequence_org": "R", "sequence_mut": "A", "comment": "Complete loss of RNA-binding. Complete loss of virus infectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "15650213", "url": "https://glygen.org/publication/PubMed/15650213" } ] }, { "start_pos": 13, "end_pos": 13, "sequence_org": "Y", "sequence_mut": "A", "comment": "Complete loss of interaction with WW domain containing proteins.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "11095724", "url": "https://glygen.org/publication/PubMed/11095724" } ] }, { "start_pos": 212, "end_pos": 212, "sequence_org": "K", "sequence_mut": "A", "comment": "40% loss of budding efficiency. No effect on oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ] }, { "start_pos": 212, "end_pos": 213, "sequence_org": "KL", "sequence_mut": "AA", "comment": "84% loss of budding efficiency. Impaired oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ] }, { "start_pos": 212, "end_pos": 214, "sequence_org": "KLR", "sequence_mut": "AAA", "comment": "85% loss of budding efficiency. Impaired oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "17699576", "url": "https://glygen.org/publication/PubMed/17699576" } ] }, { "start_pos": 212, "end_pos": 214, "sequence_org": "KLR", "sequence_mut": "ALA", "comment": "80% loss of budding efficiency. No effect on oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "17699576", "url": "https://glygen.org/publication/PubMed/17699576" } ] }, { "start_pos": 213, "end_pos": 213, "sequence_org": "L", "sequence_mut": "A", "comment": "87% loss of budding efficiency. Impaired oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ] }, { "start_pos": 213, "end_pos": 213, "sequence_org": "L", "sequence_mut": "I", "comment": "40% loss of budding efficiency.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ] }, { "start_pos": 213, "end_pos": 214, "sequence_org": "LR", "sequence_mut": "AA", "comment": "84% loss of budding efficiency. Impaired oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ] }, { "start_pos": 214, "end_pos": 214, "sequence_org": "R", "sequence_mut": "A", "comment": "65% loss of budding efficiency. No effect on oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ] }, { "start_pos": 326, "end_pos": 326, "sequence_org": "K", "sequence_mut": "R", "comment": "Complete loss of sumoylation.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "27849047", "url": "https://glygen.org/publication/PubMed/27849047" } ] }, { "start_pos": 7, "end_pos": 7, "sequence_org": "P", "sequence_mut": "A", "comment": "Partial loss of budding.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "16051823", "url": "https://glygen.org/publication/PubMed/16051823" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Zaire ebolavirus (strain Mayinga-76)", "taxid": 128952, "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "common_name": "Zaire ebolavirus", "glygen_name": "Ebola (EBOV)", "reference_species": "Zaire ebolavirus (strain Mayinga-76) [128952]" } ], "gene": [ { "name": "VP40", "url": "https://www.uniprot.org/uniprotkb/Q05128", "locus": {} } ], "crossref": [ { "id": "911825", "url": "https://www.ncbi.nlm.nih.gov/gene/911825", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1H2C", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1H2C&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "1H2D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=1H2D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2KQ0", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2KQ0&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4EJE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4EJE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4LDB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4LDB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4LDD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4LDD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4LDI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4LDI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4LDM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4LDM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7JZJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7JZJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7JZT", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7JZT&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7K5D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7K5D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7K5L", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7K5L&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "IPR008986", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008986", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035092", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035092", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00001h2c", "url": "https://www.rcsb.org/structure/pdb_00001h2c", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00001h2d", "url": "https://www.rcsb.org/structure/pdb_00001h2d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002kq0", "url": "https://www.rcsb.org/structure/pdb_00002kq0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004eje", "url": "https://www.rcsb.org/structure/pdb_00004eje", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ldb", "url": "https://www.rcsb.org/structure/pdb_00004ldb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ldd", "url": "https://www.rcsb.org/structure/pdb_00004ldd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ldi", "url": "https://www.rcsb.org/structure/pdb_00004ldi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004ldm", "url": "https://www.rcsb.org/structure/pdb_00004ldm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007jzj", "url": "https://www.rcsb.org/structure/pdb_00007jzj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007jzt", "url": "https://www.rcsb.org/structure/pdb_00007jzt", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007k5d", "url": "https://www.rcsb.org/structure/pdb_00007k5d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007k5l", "url": "https://www.rcsb.org/structure/pdb_00007k5l", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H2C", "url": "https://www.rcsb.org/structure/1H2C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "1H2D", "url": "https://www.rcsb.org/structure/1H2D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2KQ0", "url": "https://www.rcsb.org/structure/2KQ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4EJE", "url": "https://www.rcsb.org/structure/4EJE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LDB", "url": "https://www.rcsb.org/structure/4LDB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LDD", "url": "https://www.rcsb.org/structure/4LDD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LDI", "url": "https://www.rcsb.org/structure/4LDI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4LDM", "url": "https://www.rcsb.org/structure/4LDM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JZJ", "url": "https://www.rcsb.org/structure/7JZJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JZT", "url": "https://www.rcsb.org/structure/7JZT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K5D", "url": "https://www.rcsb.org/structure/7K5D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7K5L", "url": "https://www.rcsb.org/structure/7K5L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF07447", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07447", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_066245", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066245", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q05128-1", "url": "https://www.uniprot.org/uniprotkb/Q05128-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK", "length": 326, "header": "sp|Q05128-1|VP40_EBOZM Isoform 1 of Matrix protein VP40 OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=VP40 PE=1 SV=1 CANONICAL=Q05128-1" }, "isoforms": [ { "isoform_ac": "Q05128-1", "url": "https://www.uniprot.org/uniprotkb/Q05128/entry#Q05128-1", "sequence": { "sequence": "MRRVILPTAPPEYMEAIYPVRSNSTIARGGNSNTGFLTPESVNGDTPSNPLRPIADDTIDHASHTPGSVSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLASYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQLPQYFTFDLTALKLITQPLPAATWTDDTPTGSNGALRPGISFHPKLRPILLPNKSGKKGNSADLTSPEKIQAIMTSLQDFKIVPIDPTKNIMGIEVPETLVHKLTGKKVTSKNGQPIIPVLLPKYIGLDPVAPGDLTMVITQDCDTCHSPASLPAVIEK", "length": 326, "header": "sp|Q05128-1|VP40_EBOZM Isoform 1 of Matrix protein VP40 OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=VP40 PE=1 SV=1 CANONICAL=Q05128-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of the L gene and 5' trailer region of Ebola virus.", "journal": "J. Gen. Virol.", "date": "1999", "authors": "Feldmann H., Volchkov V.E., Blinov V.M., Chepurnov A.A., Netesov S.V., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "10073695", "url": "https://glygen.org/publication/PubMed/10073695" } ] }, { "title": "Molecular characterization of guinea pig-adapted variants of Ebola virus.", "journal": "Virology", "date": "2000", "authors": "Volchkov V.E., Klenk H.D., Chepurnov A.A., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "11062045", "url": "https://glygen.org/publication/PubMed/11062045" } ] }, { "title": "A PPxY motif within the VP40 protein of Ebola virus interacts physically and functionally with a ubiquitin ligase: implications for filovirus budding.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Harty RN, Brown ME, Wang G, Huibregtse J, Hayes FP", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "11095724", "url": "https://glygen.org/publication/PubMed/11095724" } ] }, { "title": "Membrane association induces a conformational change in the Ebola virus matrix protein.", "journal": "EMBO J.", "date": "2000", "authors": "Weissenhorn W., Schoehn G., Scianimanico S., Timmins J., Klenk H.D., Ruigrok R.H.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "11118208", "url": "https://glygen.org/publication/PubMed/11118208" } ] }, { "title": "Ebola virus matrix protein VP40 interaction with human cellular factors Tsg101 and Nedd4.", "journal": "J. Mol. Biol.", "date": "2003", "authors": "Timmins Joanna, Schoehn Guy, Ricard-Blum Sylvie, Scianimanico Sandra, Vernet Thierry, Ruigrok Rob W H, Weissenhorn Winfried", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "12559917", "url": "https://glygen.org/publication/PubMed/12559917" } ] }, { "title": "The matrix protein VP40 from Ebola virus octamerizes into pore-like structures with specific RNA binding properties.", "journal": "Structure", "date": "2003", "authors": "Dessen A., Weissenhorn W., Gomis-Ruth F.X., Becker S., Bracher A., Timmins J., Klenk H.D., Kolesnikowa L.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "12679020", "url": "https://glygen.org/publication/PubMed/12679020" } ] }, { "title": "Oligomerization and polymerization of the filovirus matrix protein VP40.", "journal": "Virology", "date": "2003", "authors": "Weissenhorn W., Schoehn G., Ruigrok R.W., Timmins J., Klenk H.D., Kohlhaas C.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "12919741", "url": "https://glygen.org/publication/PubMed/12919741" } ] }, { "title": "VP40 octamers are essential for Ebola virus replication.", "journal": "Journal of virology", "date": "2005-02", "authors": "Hoenen Thomas, Volchkov Viktor, Kolesnikova Larissa, Mittler Eva, Timmins Joanna, Ottmann Michelle, Reynard Olivier, Becker Stephan, Weissenhorn Winfried", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "15650213", "url": "https://glygen.org/publication/PubMed/15650213" } ] }, { "title": "Functional characterization of Ebola virus L-domains using VSV recombinants.", "journal": "Virology", "date": "2005-06-05", "authors": "Irie Takashi, Licata Jillian M, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "15892969", "url": "https://glygen.org/publication/PubMed/15892969" } ] }, { "title": "An all-atom model of the pore-like structure of hexameric VP40 from Ebola: structural insights into the monomer-hexamer transition.", "journal": "J. Struct. Biol.", "date": "2005", "authors": "Bavari S., Weissenhorn W., Schoehn G., Panchal R.G., Aman M.J., Nguyen T.L., Burnett J.C., Gussio R., Hermone A.R., McGrath C., Zaharevitz D.W.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "15908231", "url": "https://glygen.org/publication/PubMed/15908231" } ] }, { "title": "Ebola virus VP40 late domains are not essential for viral replication in cell culture.", "journal": "Journal of virology", "date": "2005-08", "authors": "Neumann Gabriele, Ebihara Hideki, Takada Ayato, Noda Takeshi, Kobasa Darwyn, Jasenosky Luke D, Watanabe Shinji, Kim Jin H, Feldmann Heinz, Kawaoka Yoshihiro", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "16051823", "url": "https://glygen.org/publication/PubMed/16051823" } ] }, { "title": "Ebola virus VP35-VP40 interaction is sufficient for packaging 3E-5E minigenome RNA into virus-like particles.", "journal": "J. Virol.", "date": "2006", "authors": "Harty R.N., Godlewski P.J., Johnson R.F., McCarthy S.E.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "16698994", "url": "https://glygen.org/publication/PubMed/16698994" } ] }, { "title": "Effect of Ebola virus proteins GP, NP and VP35 on VP40 VLP morphology.", "journal": "Virology journal", "date": "2006-05-23", "authors": "Johnson Reed F, Bell Peter, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "16719918", "url": "https://glygen.org/publication/PubMed/16719918" } ] }, { "title": "Mapping of the VP40-binding regions of the nucleoprotein of Ebola virus.", "journal": "J. Virol.", "date": "2007", "authors": "Watanabe S., Noda T., Kawaoka Y., Sagara H.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "17229682", "url": "https://glygen.org/publication/PubMed/17229682" } ] }, { "title": "Role for amino acids 212KLR214 of Ebola virus VP40 in assembly and budding.", "journal": "Journal of virology", "date": "2007-10", "authors": "McCarthy Sarah E, Johnson Reed F, Zhang Yong-An, Sunyer J Oriol, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "17699576", "url": "https://glygen.org/publication/PubMed/17699576" } ] }, { "title": "Characterization of filovirus protein-protein interactions in mammalian cells using bimolecular complementation.", "journal": "J. Infect. Dis.", "date": "2011", "authors": "Liu Y., Stone S., Harty R.N.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "21987757", "url": "https://glygen.org/publication/PubMed/21987757" } ] }, { "title": "Host IQGAP1 and Ebola virus VP40 interactions facilitate virus-like particle egress.", "journal": "Journal of virology", "date": "2013-07", "authors": "Lu Jianhong, Qu Yonggang, Liu Yuliang, Jambusaria Rakesh, Han Ziying, Ruthel Gordon, Freedman Bruce D, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "23637409", "url": "https://glygen.org/publication/PubMed/23637409" } ] }, { "title": "Structural rearrangement of ebola virus VP40 begets multiple functions in the virus life cycle.", "journal": "Cell", "date": "2013", "authors": "Noda T., Kawaoka Y., Wood M.R., Abelson D.M., Bornholdt Z.A., Saphire E.O., Halfmann P.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "23953110", "url": "https://glygen.org/publication/PubMed/23953110" } ] }, { "title": "Conformational plasticity of the Ebola virus matrix protein.", "journal": "Protein Sci.", "date": "2014", "authors": "Radzimanowski J., Weissenhorn W., Effantin G.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "25159197", "url": "https://glygen.org/publication/PubMed/25159197" } ] }, { "title": "ALIX Rescues Budding of a Double PTAP/PPEY L-Domain Deletion Mutant of Ebola VP40: A Role for ALIX in Ebola Virus Egress.", "journal": "The Journal of infectious diseases", "date": "2015-10-01", "authors": "Han Ziying, Madara Jonathan J, Liu Yuliang, Liu Wenbo, Ruthel Gordon, Freedman Bruce D, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "25786915", "url": "https://glygen.org/publication/PubMed/25786915" } ] }, { "title": "The Ebola Virus matrix protein, VP40, requires phosphatidylinositol 4,5-bisphosphate (PI(4,5)P2) for extensive oligomerization at the plasma membrane and viral egress.", "journal": "Scientific reports", "date": "2016-01-12", "authors": "Johnson Kristen A, Taghon Geoffrey J F, Scott Jordan L, Stahelin Robert V", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "26753796", "url": "https://glygen.org/publication/PubMed/26753796" } ] }, { "title": "ITCH E3 Ubiquitin Ligase Interacts with Ebola Virus VP40 To Regulate Budding.", "journal": "Journal of virology", "date": "2016-10-15", "authors": "Han Ziying, Sagum Cari A, Bedford Mark T, Sidhu Sachdev S, Sudol Marius, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "27489272", "url": "https://glygen.org/publication/PubMed/27489272" } ] }, { "title": "Regulation of Ebola virus VP40 matrix protein by SUMO.", "journal": "Scientific reports", "date": "2016-11-16", "authors": "Baz-Mart\u00ednez Maite, El Motiam Ahmed, Ruibal Paula, Condezo Gabriela N, de la Cruz-Herrera Carlos F, Lang Valerie, Collado Manuel, San Mart\u00edn Carmen, Rodr\u00edguez Manuel S, Mu\u00f1oz-Fontela Cesar, Rivas Carmen", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "27849047", "url": "https://glygen.org/publication/PubMed/27849047" } ] }, { "title": "Ebola VP40 in Exosomes Can Cause Immune Cell Dysfunction.", "journal": "Frontiers in microbiology", "date": "2016", "authors": "Pleet Michelle L, Mathiesen Allison, DeMarino Catherine, Akpamagbo Yao A, Barclay Robert A, Schwab Angela, Iordanskiy Sergey, Sampey Gavin C, Lepene Benjamin, Nekhai Sergei, Aman M J, Kashanchi Fatah", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "27872619", "url": "https://glygen.org/publication/PubMed/27872619" } ] }, { "title": "The Role of Exosomal VP40 in Ebola Virus Disease.", "journal": "DNA Cell Biol.", "date": "2017", "authors": "Kashanchi F., Aman M.J., DeMarino C., Lepene B., Pleet M.L.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "28177658", "url": "https://glygen.org/publication/PubMed/28177658" } ] }, { "title": "Ubiquitin Ligase WWP1 Interacts with Ebola Virus VP40 To Regulate Egress.", "journal": "Journal of virology", "date": "2017", "authors": "Han Z, Sagum CA, Takizawa F, Ruthel G, Berry CT, Kong J, Sunyer JO, Freedman BD, Bedford MT, Sidhu SS, Sudol M, Harty RN", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "28768865", "url": "https://glygen.org/publication/PubMed/28768865" } ] }, { "title": "Ebola virus proteins NP, VP35, and VP24 are essential and sufficient to mediate nucleocapsid transport.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2018", "authors": "Becker S., Takamatsu Y., Kolesnikova L.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "29339477", "url": "https://glygen.org/publication/PubMed/29339477" } ] }, { "title": "A cylindrical assembly model and dynamics of the Ebola virus VP40 structural matrix.", "journal": "Sci. Rep.", "date": "2018", "authors": "Chapagain P.P., Pavadai E., Gerstman B.S.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "29950600", "url": "https://glygen.org/publication/PubMed/29950600" } ] }, { "title": "Acetylation of lysine residues in the recombinant nucleoprotein and VP40 matrix protein of Zaire Ebolavirus by eukaryotic histone acetyltransferases.", "journal": "Biochemical and biophysical research communications", "date": "2018", "authors": "Hatakeyama D, Ohmi N, Saitoh A, Makiyama K, Morioka M, Okazaki H, Kuzuhara T", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "30205953", "url": "https://glygen.org/publication/PubMed/30205953" } ] }, { "title": "Ubiquitin Ligase SMURF2 Interacts with Filovirus VP40 and Promotes Egress of VP40 VLPs.", "journal": "Viruses", "date": "2021", "authors": "Shepley-McTaggart A, Schwoerer MP, Sagum CA, Bedford MT, Jaladanki CK, Fan H, Cassel J, Harty RN", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "33673144", "url": "https://glygen.org/publication/PubMed/33673144" } ] }, { "title": "Sequence analysis of the Ebola virus genome: organization, genetic elements, and comparison with the genome of Marburg virus.", "journal": "Virus Res.", "date": "1993", "authors": "Sanchez A., Auperin D.D., Holloway B.P., Kiley M.P.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "8237108", "url": "https://glygen.org/publication/PubMed/8237108" } ] }, { "title": "The VP35 and VP40 proteins of filoviruses. Homology between Marburg and Ebola viruses.", "journal": "FEBS Lett.", "date": "1993", "authors": "Volchkov V.E., Blinov V.M., Bukreyev A.A., Netesov S.V.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "reference": [ { "type": "PubMed", "id": "8482365", "url": "https://glygen.org/publication/PubMed/8482365" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "viral budding via host ESCRT complex", "id": "GO:0039702", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039702", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "intracellular transport of virus", "id": "GO:0075733", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0075733", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "viral budding", "id": "GO:0046755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046755", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "viral budding from plasma membrane", "id": "GO:0046761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046761", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host RNAi-mediated antiviral immune response", "id": "GO:0140533", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140533", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "symbiont-mediated perturbation of host cell cycle progression", "id": "GO:0044071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044071", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "structural constituent of virion", "id": "GO:0039660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039660", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "host cell", "id": "GO:0043657", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043657", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "host cell plasma membrane", "id": "GO:0020002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020002", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "host cell membrane", "id": "GO:0033644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033644", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "host cell endomembrane system", "id": "GO:0033645", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033645", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" }, { "name": "host cell late endosome membrane", "id": "GO:0044185", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044185", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 220, "end_pos": 222, "annotation": "n_glycosylation_sequon" }, { "start_pos": 23, "end_pos": 25, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Sumoylated with host SUMO1, SUMO2. Sumoylation provides stability to VP40 (PubMed:27849047). Acetylated by host EP300 in vitro (PubMed:30205953).", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "30205953", "url": "https://glygen.org/publication/PubMed/30205953" }, { "database": "PubMed", "id": "27849047", "url": "https://glygen.org/publication/PubMed/27849047" } ] }, { "annotation": "Ubiquitinated by host WWP1. This modification mediates efficient viral budding.", "evidence": [ { "database": "UniProtKB", "id": "Q05128", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "database": "PubMed", "id": "28768865", "url": "https://glygen.org/publication/PubMed/28768865" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "Q05128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "id": "25786915", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25786915" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "Essential for interaction with host PDCD6IP/ALIX", "eco_id": "ECO_0000269", "start_pos": 18, "end_pos": 26, "start_aa": "Tyr", "end_aa": "Ile", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "id": "15892969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15892969" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "PPXY motif", "eco_id": "ECO_0000269", "start_pos": 10, "end_pos": 13, "start_aa": "Pro", "end_aa": "Tyr", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05128" }, { "id": "15892969", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15892969" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "PTAP/PSAP motif", "eco_id": "ECO_0000269", "start_pos": 7, "end_pos": 10, "start_aa": "Pro", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 220, "end_pos": 222 }, { "start_pos": 23, "end_pos": 25 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 32 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q05318-1", "uniprot_ac": "Q05318", "uniprot_id": "L_EBOZM", "mass": { "chemical_mass": 252724.0, "monoisotopic_mass": 252724.0 }, "refseq": { "ac": "NP_066251", "name": "RNA-dependent RNA polymerase", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066251" }, "gene_names": [ { "name": "L", "type": "recommended", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ] } ], "protein_names": [ { "name": "RNA-directed RNA polymerase L", "type": "recommended", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] }, { "name": "G-N7-MTase", "type": "synonym", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] }, { "name": "Large structural protein", "type": "synonym", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] }, { "name": "N1-2'-O-MTase", "type": "synonym", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] }, { "name": "PRNTase", "type": "synonym", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] }, { "name": "Protein L", "type": "synonym", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] }, { "name": "RNA-dependent RNA polymerase", "type": "synonym", "evidence": [ { "id": "NP_066251", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066251" } ] }, { "name": "Replicase", "type": "synonym", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] }, { "name": "Transcriptase", "type": "synonym", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] }, { "name": "mRNA (guanine-N(7)-)-methyltransferase", "type": "synonym", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] }, { "name": "mRNA (nucleoside-2'-O-)-methyltransferase", "type": "synonym", "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "RNA-directed RNA polymerase that catalyzes the replication of viral genomic RNA. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The replicase mode is dependent on intracellular N protein concentration. In this mode, the polymerase replicates the whole viral genome without recognizing transcriptional signals, and the replicated genome is not caped or polyadenylated.", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "database": "PubMed", "id": "23582637", "url": "https://glygen.org/publication/PubMed/23582637" }, { "database": "PubMed", "id": "28991917", "url": "https://glygen.org/publication/PubMed/28991917" }, { "database": "PubMed", "id": "29507309", "url": "https://glygen.org/publication/PubMed/29507309" }, { "database": "UniProtKB", "id": "P03523", "url": "https://www.uniprot.org/uniprotkb/P03523#function" } ] }, { "annotation": "RNA-directed RNA polymerase that catalyzes the transcription of viral mRNAs, their capping and polyadenylation. The template is composed of the viral RNA tightly encapsidated by the nucleoprotein (N). The viral polymerase binds to the genomic RNA at the 3' leader promoter, and transcribes subsequently all viral mRNAs with a decreasing efficiency. The first gene is the most transcribed, and the last the least transcribed. The viral phosphoprotein acts as a processivity factor. Capping is concomitant with initiation of mRNA transcription. Indeed, a GDP polyribonucleotidyl transferase (PRNTase) adds the cap structure when the nascent RNA chain length has reached few nucleotides. Ribose 2'-O methylation of viral mRNA cap precedes and facilitates subsequent guanine-N-7 methylation, both activities being carried by the viral polymerase. Polyadenylation of mRNAs occur by a stuttering mechanism at a slipery stop site present at the end viral genes. After finishing transcription of a mRNA, the polymerase can resume transcription of the downstream gene.", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "database": "PubMed", "id": "23582637", "url": "https://glygen.org/publication/PubMed/23582637" }, { "database": "PubMed", "id": "28991917", "url": "https://glygen.org/publication/PubMed/28991917" }, { "database": "PubMed", "id": "29507309", "url": "https://glygen.org/publication/PubMed/29507309" }, { "database": "UniProtKB", "id": "P03523", "url": "https://www.uniprot.org/uniprotkb/P03523#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 742, "end_pos": 742, "sequence_org": "D", "sequence_mut": "A", "comment": "Complete loss OFRNA synthesis.", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" }, { "database": "PubMed", "id": "29507309", "url": "https://glygen.org/publication/PubMed/29507309" } ] }, { "start_pos": 742, "end_pos": 744, "sequence_org": "DNQ", "sequence_mut": "AAA", "comment": "Complete loss of replication and transcription.", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" }, { "database": "PubMed", "id": "28991917", "url": "https://glygen.org/publication/PubMed/28991917" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Zaire ebolavirus (strain Mayinga-76)", "taxid": 128952, "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "common_name": "Zaire ebolavirus", "glygen_name": "Ebola (EBOV)", "reference_species": "Zaire ebolavirus (strain Mayinga-76) [128952]" } ], "gene": [ { "name": "L", "url": "https://www.uniprot.org/uniprotkb/Q05318", "locus": {} } ], "crossref": [ { "id": "911824", "url": "https://www.ncbi.nlm.nih.gov/gene/911824", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9IP3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9IP3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "IPR014023", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014023", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017235", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017235", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025786", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025786", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026890", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026890", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039736", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039736", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00009ip3", "url": "https://www.rcsb.org/structure/pdb_00009ip3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9IP3", "url": "https://www.rcsb.org/structure/9IP3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00946", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00946", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF14318", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF14318", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_066251", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066251", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q05318-1", "url": "https://www.uniprot.org/uniprotkb/Q05318-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLRNCKLPKHIYRLKYDVTVTKFLSDVPVATLPIDFIVPVLLKALSGNGFCPVEPRCQQFLDEIIKYTMQDALFLKYYLKNVGAQEDCVDEHFQEKILSSIQGNEFLHQMFFWYDLAILTRRGRLNRGNSRSTWFVHDDLIDILGYGDYVFWKIPISMLPLNTQGIPHAAMDWYQASVFKEAVQGHTHIVSVSTADVLIMCKDLITCRFNTTLISKIAEIEDPVCSDYPNFKIVSMLYQSGDYLLSILGSDGYKIIKFLEPLCLAKIQLCSKYTERKGRFLTQMHLAVNHTLEEITEMRALKPSQAQKIREFHRTLIRLEMTPQQLCELFSIQKHWGHPVLHSETAIQKVKKHATVLKALRPIVIFETYCVFKYSIAKHYFDSQGSWYSVTSDRNLTPGLNSYIKRNQFPPLPMIKELLWEFYHLDHPPLFSTKIISDLSIFIKDRATAVERTCWDAVFEPNVLGYNPPHKFSTKRVPEQFLEQENFSIENVLSYAQKLEYLLPQYRNFSFSLKEKELNVGRTFGKLPYPTRNVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNGVQLPQSLKTATRMAPLSDAIFDDLQGTLASIGTAFERSISETRHIFPCRITAAFHTFFSVRILQYHHLGFNKGFDLGQLTLGKPLDFGTISLALAVPQVLGGLSFLNPEKCFYRNLGDPVTSGLFQLKTYLRMIEMDDLFLPLIAKNPGNCTAIDFVLNPSGLNVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHASADFEDEMVCKWLLSSTPVMSRFAADIFSRTPSGKRLQILGYLEGTRTLLASKIINNNTETPVLDRLRKITLQRWSLWFSYLDHCDNILAEALTQITCTVDLAQILREYSWAHILEGRPLIGATLPCMIEQFKVFWLKPYEQCPQCSNAKQPGGKPFVSVAVKKHIVSAWPNASRISWTIGDGIPYIGSRTEDKIGQPAIKPKCPSAALREAIELASRLTWVTQGSSNSDLLIKPFLEARVNLSVQEILQMTPSHYSGNIVHRYNDQYSPHSFMANRMSNSATRLIVSTNTLGEFSGGGQSARDSNIIFQNVINYAVALFDIKFRNTEATDIQYNRAHLHLTKCCTREVPAQYLTYTSTLDLDLTRYRENELIYDSNPLKGGLNCNISFDNPFFQGKRLNIIEDDLIRLPHLSGWELAKTIMQSIISDSNNSSTDPISSGETRSFTTHFLTYPKIGLLYSFGAFVSYYLGNTILRTKKLTLDNFLYYLTTQIHNLPHRSLRILKPTFKHASVMSRLMSIDPHFSIYIGGAAGDRGLSDAARLFLRTSISSFLTFVKEWIINRGTIVPLWIVYPLEGQNPTPVNNFLYQIVELLVHDSSRQQAFKTTISDHVHPHDNLVYTCKSTASNFFHASLAYWRSRHRNSNRKYLARDSSTGSSTNNSDGHIERSQEQTTRDPHDGTERNLVLQMSHEIKRTTIPQENTHQGPSFQSFLSDSACGTANPKLNFDRSRHNVKFQDHNSASKREGHQIISHRLVLPFFTLSQGTRQLTSSNESQTQDEISKYLRQLRSVIDTTVYCRFTGIVSSMHYKLDEVLWEIESFKSAVTLAEGEGAGALLLIQKYQVKTLFFNTLATESSIESEIVSGMTTPRMLLPVMSKFHNDQIEIILNNSASQITDITNPTWFKDQRARLPKQVEVITMDAETTENINRSKLYEAVYKLILHHIDPSVLKAVVLKVFLSDTEGMLWLNDNLAPFFATGYLIKPITSSARSSEWYLCLTNFLSTTRKMPHQNHLSCKQVILTALQLQIQRSPYWLSHLTQYADCELHLSYIRLGFPSLEKVLYHRYNLVDSKRGPLVSITQHLAHLRAEIRELTNDYNQQRQSRTQTYHFIRTAKGRITKLVNDYLKFFLIVQALKHNGTWQAEFKKLPELISVCNRFYHIRDCNCEERFLVQTLYLHRMQDSEVKLIERLTGLLSLFPDGLYRFD", "length": 2212, "header": "sp|Q05318-1|L_EBOZM Isoform 1 of RNA-directed RNA polymerase L OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=L PE=1 SV=2 CANONICAL=Q05318-1" }, "isoforms": [ { "isoform_ac": "Q05318-1", "url": "https://www.uniprot.org/uniprotkb/Q05318/entry#Q05318-1", "sequence": { "sequence": "MATQHTQYPDARLSSPIVLDQCDLVTRACGLYSSYSLNPQLRNCKLPKHIYRLKYDVTVTKFLSDVPVATLPIDFIVPVLLKALSGNGFCPVEPRCQQFLDEIIKYTMQDALFLKYYLKNVGAQEDCVDEHFQEKILSSIQGNEFLHQMFFWYDLAILTRRGRLNRGNSRSTWFVHDDLIDILGYGDYVFWKIPISMLPLNTQGIPHAAMDWYQASVFKEAVQGHTHIVSVSTADVLIMCKDLITCRFNTTLISKIAEIEDPVCSDYPNFKIVSMLYQSGDYLLSILGSDGYKIIKFLEPLCLAKIQLCSKYTERKGRFLTQMHLAVNHTLEEITEMRALKPSQAQKIREFHRTLIRLEMTPQQLCELFSIQKHWGHPVLHSETAIQKVKKHATVLKALRPIVIFETYCVFKYSIAKHYFDSQGSWYSVTSDRNLTPGLNSYIKRNQFPPLPMIKELLWEFYHLDHPPLFSTKIISDLSIFIKDRATAVERTCWDAVFEPNVLGYNPPHKFSTKRVPEQFLEQENFSIENVLSYAQKLEYLLPQYRNFSFSLKEKELNVGRTFGKLPYPTRNVQTLCEALLADGLAKAFPSNMMVVTEREQKESLLHQASWHHTSDDFGEHATVRGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNGVQLPQSLKTATRMAPLSDAIFDDLQGTLASIGTAFERSISETRHIFPCRITAAFHTFFSVRILQYHHLGFNKGFDLGQLTLGKPLDFGTISLALAVPQVLGGLSFLNPEKCFYRNLGDPVTSGLFQLKTYLRMIEMDDLFLPLIAKNPGNCTAIDFVLNPSGLNVPGSQDLTSFLRQIVRRTITLSAKNKLINTLFHASADFEDEMVCKWLLSSTPVMSRFAADIFSRTPSGKRLQILGYLEGTRTLLASKIINNNTETPVLDRLRKITLQRWSLWFSYLDHCDNILAEALTQITCTVDLAQILREYSWAHILEGRPLIGATLPCMIEQFKVFWLKPYEQCPQCSNAKQPGGKPFVSVAVKKHIVSAWPNASRISWTIGDGIPYIGSRTEDKIGQPAIKPKCPSAALREAIELASRLTWVTQGSSNSDLLIKPFLEARVNLSVQEILQMTPSHYSGNIVHRYNDQYSPHSFMANRMSNSATRLIVSTNTLGEFSGGGQSARDSNIIFQNVINYAVALFDIKFRNTEATDIQYNRAHLHLTKCCTREVPAQYLTYTSTLDLDLTRYRENELIYDSNPLKGGLNCNISFDNPFFQGKRLNIIEDDLIRLPHLSGWELAKTIMQSIISDSNNSSTDPISSGETRSFTTHFLTYPKIGLLYSFGAFVSYYLGNTILRTKKLTLDNFLYYLTTQIHNLPHRSLRILKPTFKHASVMSRLMSIDPHFSIYIGGAAGDRGLSDAARLFLRTSISSFLTFVKEWIINRGTIVPLWIVYPLEGQNPTPVNNFLYQIVELLVHDSSRQQAFKTTISDHVHPHDNLVYTCKSTASNFFHASLAYWRSRHRNSNRKYLARDSSTGSSTNNSDGHIERSQEQTTRDPHDGTERNLVLQMSHEIKRTTIPQENTHQGPSFQSFLSDSACGTANPKLNFDRSRHNVKFQDHNSASKREGHQIISHRLVLPFFTLSQGTRQLTSSNESQTQDEISKYLRQLRSVIDTTVYCRFTGIVSSMHYKLDEVLWEIESFKSAVTLAEGEGAGALLLIQKYQVKTLFFNTLATESSIESEIVSGMTTPRMLLPVMSKFHNDQIEIILNNSASQITDITNPTWFKDQRARLPKQVEVITMDAETTENINRSKLYEAVYKLILHHIDPSVLKAVVLKVFLSDTEGMLWLNDNLAPFFATGYLIKPITSSARSSEWYLCLTNFLSTTRKMPHQNHLSCKQVILTALQLQIQRSPYWLSHLTQYADCELHLSYIRLGFPSLEKVLYHRYNLVDSKRGPLVSITQHLAHLRAEIRELTNDYNQQRQSRTQTYHFIRTAKGRITKLVNDYLKFFLIVQALKHNGTWQAEFKKLPELISVCNRFYHIRDCNCEERFLVQTLYLHRMQDSEVKLIERLTGLLSLFPDGLYRFD", "length": 2212, "header": "sp|Q05318-1|L_EBOZM Isoform 1 of RNA-directed RNA polymerase L OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=L PE=1 SV=2 CANONICAL=Q05318-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Characterization of the L gene and 5' trailer region of Ebola virus.", "journal": "J. Gen. Virol.", "date": "1999", "authors": "Feldmann H., Volchkov V.E., Blinov V.M., Chepurnov A.A., Netesov S.V., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "reference": [ { "type": "PubMed", "id": "10073695", "url": "https://glygen.org/publication/PubMed/10073695" } ] }, { "title": "The L-VP35 and L-L interaction domains reside in the amino terminus of the Ebola virus L protein and are potential targets for antivirals.", "journal": "Virology", "date": "2013-07-05", "authors": "Trunschke Martina, Conrad Dominik, Enterlein Sven, Olejnik Judith, Brauburger Kristina, M\u00fchlberger Elke", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "reference": [ { "type": "PubMed", "id": "23582637", "url": "https://glygen.org/publication/PubMed/23582637" } ] }, { "title": "Characterization of the catalytic center of the Ebola virus L polymerase.", "journal": "PLoS neglected tropical diseases", "date": "2017-10", "authors": "Schmidt Marie Luisa, Hoenen Thomas", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "reference": [ { "type": "PubMed", "id": "28991917", "url": "https://glygen.org/publication/PubMed/28991917" } ] }, { "title": "Recombinant RNA-Dependent RNA Polymerase Complex of Ebola Virus.", "journal": "Scientific reports", "date": "2018-03-05", "authors": "Tchesnokov Egor P, Raeisimakiani Parisa, Ngure Marianne, Marchant David, G\u00f6tte Matthias", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "reference": [ { "type": "PubMed", "id": "29507309", "url": "https://glygen.org/publication/PubMed/29507309" } ] }, { "title": "Structural insights into the RNA-dependent RNA polymerase complexes from highly pathogenic Marburg and Ebola viruses.", "journal": "Nat. Commun.", "date": "2025", "authors": "Wang J., Wu S., Zhang L., Zhang X., Li G., Du T., Ren Z., Ru H., Jie K.", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "reference": [ { "type": "PubMed", "id": "40164610", "url": "https://glygen.org/publication/PubMed/40164610" } ] }, { "title": "Sequence analysis of the Ebola virus genome: organization, genetic elements, and comparison with the genome of Marburg virus.", "journal": "Virus Res.", "date": "1993", "authors": "Sanchez A., Auperin D.D., Holloway B.P., Kiley M.P.", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "reference": [ { "type": "PubMed", "id": "8237108", "url": "https://glygen.org/publication/PubMed/8237108" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "RNA-directed RNA polymerase activity", "id": "GO:0003968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003968", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" }, { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" }, { "name": "mRNA 5'-cap (guanine-N7-)-methyltransferase activity", "id": "GO:0004482", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004482", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" }, { "name": "RNA polymerase activity", "id": "GO:0097747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097747", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "negative stranded viral RNA replication", "id": "GO:0039689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039689", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" }, { "name": "negative stranded viral RNA transcription", "id": "GO:0039697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039697", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "virion component", "id": "GO:0044423", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044423", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "Q05318", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1064, "end_pos": 1066, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1179, "end_pos": 1181, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1249, "end_pos": 1251, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1393, "end_pos": 1395, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1437, "end_pos": 1439, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1438, "end_pos": 1440, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1666, "end_pos": 1668, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1779, "end_pos": 1781, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1895, "end_pos": 1897, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1935, "end_pos": 1937, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2144, "end_pos": 2146, "annotation": "n_glycosylation_sequon" }, { "start_pos": 249, "end_pos": 251, "annotation": "n_glycosylation_sequon" }, { "start_pos": 328, "end_pos": 330, "annotation": "n_glycosylation_sequon" }, { "start_pos": 434, "end_pos": 436, "annotation": "n_glycosylation_sequon" }, { "start_pos": 525, "end_pos": 527, "annotation": "n_glycosylation_sequon" }, { "start_pos": 547, "end_pos": 549, "annotation": "n_glycosylation_sequon" }, { "start_pos": 685, "end_pos": 687, "annotation": "n_glycosylation_sequon" }, { "start_pos": 959, "end_pos": 961, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" }, { "id": "28991917", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28991917" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "Essential for both viral transcription and replication", "eco_id": "ECO_0000269", "start_pos": 741, "end_pos": 744, "start_aa": "Gly", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" }, { "id": "PRU00923", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00923" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Mononegavirus-type SAM-dependent 2'-O-MTase", "eco_id": "ECO_0000255", "start_pos": 1805, "end_pos": 2003, "start_aa": "Arg", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" }, { "id": "PRU00539", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00539" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "RdRp catalytic", "eco_id": "ECO_0000255", "start_pos": 625, "end_pos": 809, "start_aa": "Arg", "end_aa": "Gly", "glycosite_overlap": "" } ], "binding_sites": [ { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "binding_site_uniprot": 1105, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "structural", "eco_id": "ECO_0000250", "start_pos": 1105, "end_pos": 1105, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "binding_site_uniprot": 1137, "amino_acid": "Glu", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "structural", "eco_id": "ECO_0000250", "start_pos": 1137, "end_pos": 1137, "start_aa": "Glu", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" }, { "id": "40164610", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40164610" } ], "binding_site_uniprot": 1150, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "structural", "eco_id": "ECO_0000269", "start_pos": 1150, "end_pos": 1150, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" }, { "id": "40164610", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40164610" } ], "binding_site_uniprot": 1153, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "structural", "eco_id": "ECO_0000269", "start_pos": 1153, "end_pos": 1153, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" }, { "id": "40164610", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40164610" } ], "binding_site_uniprot": 1345, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "structural", "eco_id": "ECO_0000269", "start_pos": 1345, "end_pos": 1345, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" }, { "id": "40164610", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/40164610" } ], "binding_site_uniprot": 1347, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "2", "uniprotkb_ligand_comment": "structural", "eco_id": "ECO_0000269", "start_pos": 1347, "end_pos": 1347, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "binding_site_uniprot": 1351, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "structural", "eco_id": "ECO_0000250", "start_pos": 1351, "end_pos": 1351, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "binding_site_uniprot": 1352, "amino_acid": "Cys", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "1", "uniprotkb_ligand_comment": "structural", "eco_id": "ECO_0000250", "start_pos": 1352, "end_pos": 1352, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "binding_site_uniprot": 632, "amino_acid": "Asp", "chebi_lig_id": "CHEBI_18420", "ligand": "Mg(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "catalytic; for RNA-directed RNA polymerase activity", "eco_id": "ECO_0000250", "start_pos": 632, "end_pos": 632, "start_aa": "Asp", "end_aa": "Asp", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318#function" }, { "id": "Q05318", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05318" } ], "binding_site_uniprot": 742, "amino_acid": "Asp", "chebi_lig_id": "CHEBI_18420", "ligand": "Mg(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "catalytic; for RNA-directed RNA polymerase activity", "eco_id": "ECO_0000250", "start_pos": 742, "end_pos": 742, "start_aa": "Asp", "end_aa": "Asp", "glycosite_overlap": "" } ], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "2.7.7.48", "ec_name": "RNA(n) + a ribonucleoside 5'-triphosphate = RNA(n+1) + diphosphate.", "evidence": [ { "id": "2.7.7.48", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.7.7.48" }, { "id": "2.7.7.48", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.7.48" } ] }, { "ec_number": "2.7.7.88", "ec_name": "a 5'-end triphospho-adenylyl-adenylyl-cytidylyl-adenosine in mRNA + GDP + H(+) = a 5'-end (5'-triphosphoguanosine)-adenylyl-adenylyl-cytidylyl-adenosine in mRNA + diphosphate.", "evidence": [ { "id": "2.7.7.88", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.7.7.88" } ] } ], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1064, "end_pos": 1066 }, { "start_pos": 1179, "end_pos": 1181 }, { "start_pos": 1249, "end_pos": 1251 }, { "start_pos": 1393, "end_pos": 1395 }, { "start_pos": 1437, "end_pos": 1439 }, { "start_pos": 1438, "end_pos": 1440 }, { "start_pos": 1666, "end_pos": 1668 }, { "start_pos": 1779, "end_pos": 1781 }, { "start_pos": 1895, "end_pos": 1897 }, { "start_pos": 1935, "end_pos": 1937 }, { "start_pos": 2144, "end_pos": 2146 }, { "start_pos": 249, "end_pos": 251 }, { "start_pos": 328, "end_pos": 330 }, { "start_pos": 434, "end_pos": 436 }, { "start_pos": 525, "end_pos": 527 }, { "start_pos": 547, "end_pos": 549 }, { "start_pos": 685, "end_pos": 687 }, { "start_pos": 959, "end_pos": 961 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q05320-1", "uniprot_ac": "Q05320", "uniprot_id": "VGP_EBOZM", "mass": { "chemical_mass": 74464.0, "monoisotopic_mass": 74464.0 }, "refseq": { "ac": "NP_066246", "name": "spike glycoprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066246" }, "gene_names": [ { "name": "GP", "type": "recommended", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] } ], "protein_names": [ { "name": "Envelope glycoprotein", "type": "recommended", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320/entry#names_and_taxonomy" } ] }, { "name": "GP1,2-delta", "type": "synonym", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320/entry#names_and_taxonomy" } ] }, { "name": "GP1,2", "type": "synonym", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320/entry#names_and_taxonomy" } ] }, { "name": "GP", "type": "synonym", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320/entry#names_and_taxonomy" } ] }, { "name": "spike glycoprotein", "type": "synonym", "evidence": [ { "id": "NP_066246", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066246" } ] } ], "function": [ { "annotation": "Acts as a class I viral fusion protein. Under the current model, the protein has at least 3 conformational states: pre-fusion native state, pre-hairpin intermediate state, and post-fusion hairpin state. During viral and target cell membrane fusion, the coiled coil regions (heptad repeats) assume a trimer-of-hairpins structure, positioning the fusion peptide in close proximity to the C-terminal region of the ectodomain. The formation of this structure appears to drive apposition and subsequent fusion of viral and target cell membranes. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induces an irreversible conformational change in GP2, releasing the fusion hydrophobic peptide.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320#function" } ] }, { "annotation": "Functions as a decoy for anti-GP1,2 antibodies thereby contributing to viral immune evasion. Interacts and activates host macrophages and dendritic cells inducing up-regulation of cytokine transcription. This effect is mediated throught activation of host TLR4.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320#function" }, { "database": "PubMed", "id": "26092855", "url": "https://glygen.org/publication/PubMed/26092855" }, { "database": "PubMed", "id": "25412102", "url": "https://glygen.org/publication/PubMed/25412102" }, { "database": "PubMed", "id": "30085081", "url": "https://glygen.org/publication/PubMed/30085081" } ] }, { "annotation": "Responsible for binding to the receptor(s) on target cells. Interacts with CD209/DC-SIGN and CLEC4M/DC-SIGNR which act as cofactors for virus entry into dendritic cells (DCs) and endothelial cells (PubMed:16051836). Binding to the macrophage specific lectin CLEC10A also seems to enhance virus infectivity (By similarity). Interaction with FOLR1/folate receptor alpha may be a cofactor for virus entry in some cell types, although results are contradictory. Members of the Tyro3 receptor tyrosine kinase family also seem to be cell entry factors in filovirus infection (By similarity). Once attached, the virions are internalized through clathrin-dependent endocytosis and/or macropinocytosis. After internalization of the virus into the endosomes of the host cell, proteolysis of GP1 by two cysteine proteases, CTSB/cathepsin B and CTSL/cathepsin L removes the glycan cap and allows GP1 binding to the host entry receptor NPC1 (PubMed:21866103, PubMed:32040508). NPC1-binding, Ca(2+) and acidic pH induce a conformational change of GP2, which unmasks its fusion peptide and permit membranes fusion (PubMed:21866103, PubMed:22031933, PubMed:32040508).", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320#function" }, { "database": "PubMed", "id": "32040508", "url": "https://glygen.org/publication/PubMed/32040508" }, { "database": "PubMed", "id": "16051836", "url": "https://glygen.org/publication/PubMed/16051836" }, { "database": "PubMed", "id": "21866103", "url": "https://glygen.org/publication/PubMed/21866103" }, { "database": "UniProtKB", "id": "Q66814", "url": "https://www.uniprot.org/uniprotkb/Q66814#function" }, { "database": "PubMed", "id": "22031933", "url": "https://glygen.org/publication/PubMed/22031933" }, { "database": "UniProtKB", "id": "O11457", "url": "https://www.uniprot.org/uniprotkb/O11457#function" } ] }, { "annotation": "Trimeric GP1,2 complexes form the virion surface spikes and mediate the viral entry processes, with GP1 acting as the receptor-binding subunit and GP2 as the membrane fusion subunit. At later times of infection, down-regulates the expression of various host cell surface molecules that are essential for immune surveillance and cell adhesion (PubMed:11836430). Down-modulates several integrins including ITGA1, ITGA2, ITGA3, ITGA4, ITGA5, ITGA6, ITGAV and ITGB1 (PubMed:11112476). This decrease in cell adhesion molecules may lead to cell detachment, contributing to the disruption of blood vessel integrity and hemorrhages developed during infection (cytotoxicity) (Probable). Interacts with host TLR4 and thereby stimulates the differentiation and activation of monocytes leading to bystander death of T-lymphocytes (PubMed:28542576). Down-regulates as well the function of host natural killer cells (PubMed:30013549). Counteracts the antiviral effect of host BST2/tetherin that restricts release of progeny virions from infected cells (PubMed:26516900, PubMed:27707924, PubMed:29669839). However, cooperates with VP40 and host BST2 to activate canonical NF-kappa-B pathway in a manner dependent on neddylation (PubMed:28878074).", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320#function" }, { "database": "PubMed", "id": "28878074", "url": "https://glygen.org/publication/PubMed/28878074" }, { "database": "PubMed", "id": "11112476", "url": "https://glygen.org/publication/PubMed/11112476" }, { "database": "PubMed", "id": "29669839", "url": "https://glygen.org/publication/PubMed/29669839" }, { "database": "PubMed", "id": "30013549", "url": "https://glygen.org/publication/PubMed/30013549" }, { "database": "PubMed", "id": "26516900", "url": "https://glygen.org/publication/PubMed/26516900" }, { "database": "PubMed", "id": "27707924", "url": "https://glygen.org/publication/PubMed/27707924" }, { "database": "PubMed", "id": "11836430", "url": "https://glygen.org/publication/PubMed/11836430" }, { "database": "PubMed", "id": "28542576", "url": "https://glygen.org/publication/PubMed/28542576" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 108, "end_pos": 108, "sequence_org": "C", "sequence_mut": "G", "comment": "Almost complete loss of expression of GP1 and GP2. Almost complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 111, "end_pos": 111, "sequence_org": "L", "sequence_mut": "A", "comment": "About 60% loss of ability to counteract host BST2.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "27707924", "url": "https://glygen.org/publication/PubMed/27707924" } ] }, { "start_pos": 121, "end_pos": 121, "sequence_org": "C", "sequence_mut": "G", "comment": "Reduced levels of expression of GP1 and GP2. 50% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 122, "end_pos": 122, "sequence_org": "L", "sequence_mut": "A", "comment": "About 60% loss of ability to counteract host BST2.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "27707924", "url": "https://glygen.org/publication/PubMed/27707924" } ] }, { "start_pos": 135, "end_pos": 135, "sequence_org": "C", "sequence_mut": "S", "comment": "Almost complete loss of expression of GP1 and GP2. Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 147, "end_pos": 147, "sequence_org": "C", "sequence_mut": "S", "comment": "Reduced levels of expression of GP1 and GP2. Almost complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 170, "end_pos": 170, "sequence_org": "I", "sequence_mut": "A", "comment": "90% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 170, "end_pos": 170, "sequence_org": "I", "sequence_mut": "E", "comment": "Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 170, "end_pos": 170, "sequence_org": "I", "sequence_mut": "F", "comment": "50% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 204, "end_pos": 204, "sequence_org": "N", "sequence_mut": "D", "comment": "No effect on GP1 and GP2 expression. No loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 238, "end_pos": 238, "sequence_org": "N", "sequence_mut": "Y", "comment": "No effect on GP1 and GP2 expression. 12% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 257, "end_pos": 257, "sequence_org": "N", "sequence_mut": "D", "comment": "No effect on GP1 and GP2 expression. 12% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 296, "end_pos": 296, "sequence_org": "N", "sequence_mut": "D", "comment": "No effect on GP1 and GP2 expression. 18% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 40, "end_pos": 40, "sequence_org": "N", "sequence_mut": "D", "comment": "Induces GP1 secretion. Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 497, "end_pos": 501, "sequence_org": "RRTRR", "sequence_mut": "AGTAA", "comment": "Almost complete loss of cleavage between GP1 and GP2. No loss of infectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" } ] }, { "start_pos": 498, "end_pos": 501, "sequence_org": "RTRR", "sequence_mut": "ATAA", "comment": "No effect on cleavage between GP1 and GP2.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "9882347", "url": "https://glygen.org/publication/PubMed/9882347" } ] }, { "start_pos": 511, "end_pos": 511, "sequence_org": "C", "sequence_mut": "G", "comment": "Induces GP1 secretion. Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 528, "end_pos": 528, "sequence_org": "G", "sequence_mut": "R", "comment": "Reduced infectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "start_pos": 529, "end_pos": 529, "sequence_org": "L", "sequence_mut": "A", "comment": "Reduced infectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "start_pos": 529, "end_pos": 529, "sequence_org": "L", "sequence_mut": "R", "comment": "Reduced infectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "start_pos": 532, "end_pos": 532, "sequence_org": "I", "sequence_mut": "A", "comment": "Reduced infectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "start_pos": 532, "end_pos": 532, "sequence_org": "I", "sequence_mut": "R", "comment": "Almost complete loss of infectivity. No effect on transport of GP to the cell surface and incorporation onto virions.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "start_pos": 535, "end_pos": 535, "sequence_org": "F", "sequence_mut": "A", "comment": "Reduced infectivity.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "start_pos": 535, "end_pos": 535, "sequence_org": "F", "sequence_mut": "R", "comment": "Almost complete loss of infectivity. No effect on transport of GP to the cell surface and incorporation onto virions.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "start_pos": 536, "end_pos": 536, "sequence_org": "G", "sequence_mut": "A", "comment": "Almost complete loss of infectivity. No effect on transport of GP to the cell surface and incorporation onto virions.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "start_pos": 537, "end_pos": 537, "sequence_org": "P", "sequence_mut": "R", "comment": "Almost complete loss of infectivity. No effect on transport of GP to the cell surface and incorporation onto virions.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "C", "sequence_mut": "G", "comment": "Induces GP1 secretion. Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 556, "end_pos": 556, "sequence_org": "C", "sequence_mut": "S", "comment": "Induces GP1 secretion. Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 55, "end_pos": 55, "sequence_org": "D", "sequence_mut": "A", "comment": "80% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 55, "end_pos": 55, "sequence_org": "D", "sequence_mut": "E", "comment": "No effect on viral entry.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 55, "end_pos": 55, "sequence_org": "D", "sequence_mut": "K", "comment": "No effect on viral entry.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 563, "end_pos": 563, "sequence_org": "N", "sequence_mut": "D", "comment": "Reduced levels of expression of GP, GP1 and GP2. 20% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 57, "end_pos": 57, "sequence_org": "L", "sequence_mut": "A", "comment": "Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 57, "end_pos": 57, "sequence_org": "L", "sequence_mut": "F", "comment": "90% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 57, "end_pos": 57, "sequence_org": "L", "sequence_mut": "I", "comment": "90% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 57, "end_pos": 57, "sequence_org": "L", "sequence_mut": "K", "comment": "90% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 601, "end_pos": 601, "sequence_org": "C", "sequence_mut": "S", "comment": "Induces GP1 secretion. Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 608, "end_pos": 608, "sequence_org": "C", "sequence_mut": "G", "comment": "Induces GP1 secretion. Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 609, "end_pos": 609, "sequence_org": "C", "sequence_mut": "G", "comment": "Induces GP1 secretion. Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 618, "end_pos": 618, "sequence_org": "N", "sequence_mut": "D", "comment": "Slightly reduced levels of expression of GP1 and GP2. No loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 632, "end_pos": 632, "sequence_org": "D", "sequence_mut": "V", "comment": "No effect on release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 633, "end_pos": 633, "sequence_org": "K", "sequence_mut": "R", "comment": "No effect on release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 633, "end_pos": 633, "sequence_org": "K", "sequence_mut": "V", "comment": "No effect on release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 634, "end_pos": 634, "sequence_org": "T", "sequence_mut": "I", "comment": "50% loss of release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 635, "end_pos": 635, "sequence_org": "L", "sequence_mut": "V", "comment": "60% loss of release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 635, "end_pos": 635, "sequence_org": "L", "sequence_mut": "V", "comment": "Increased GP shedding.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "26092855", "url": "https://glygen.org/publication/PubMed/26092855" } ] }, { "start_pos": 636, "end_pos": 636, "sequence_org": "P", "sequence_mut": "A", "comment": "60% loss of release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 637, "end_pos": 637, "sequence_org": "D", "sequence_mut": "E", "comment": "No effect on release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 637, "end_pos": 637, "sequence_org": "D", "sequence_mut": "L", "comment": "Increased release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 637, "end_pos": 637, "sequence_org": "D", "sequence_mut": "V", "comment": "Decreased GP shedding.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "26092855", "url": "https://glygen.org/publication/PubMed/26092855" } ] }, { "start_pos": 637, "end_pos": 637, "sequence_org": "D", "sequence_mut": "V", "comment": "Increased release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 638, "end_pos": 638, "sequence_org": "Q", "sequence_mut": "V", "comment": "No effect on release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 639, "end_pos": 639, "sequence_org": "G", "sequence_mut": "V", "comment": "40% loss of release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "L", "sequence_mut": "A", "comment": "90% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "L", "sequence_mut": "F", "comment": "Almost complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "L", "sequence_mut": "K", "comment": "Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 640, "end_pos": 640, "sequence_org": "D", "sequence_mut": "V", "comment": "No effect on release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 641, "end_pos": 641, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 642, "end_pos": 642, "sequence_org": "D", "sequence_mut": "V", "comment": "No effect on release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 643, "end_pos": 643, "sequence_org": "N", "sequence_mut": "A", "comment": "No effect on release of soluble GP1,2delta.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "start_pos": 64, "end_pos": 64, "sequence_org": "R", "sequence_mut": "A", "comment": "Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 64, "end_pos": 64, "sequence_org": "R", "sequence_mut": "E", "comment": "Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 64, "end_pos": 64, "sequence_org": "R", "sequence_mut": "K", "comment": "No loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 660, "end_pos": 660, "sequence_org": "G", "sequence_mut": "L", "comment": "About 60% loss of viral release; when associated with L-664.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "29669839", "url": "https://glygen.org/publication/PubMed/29669839" } ] }, { "start_pos": 664, "end_pos": 664, "sequence_org": "A", "sequence_mut": "L", "comment": "About 60% loss of viral release; when associated with L-660.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "29669839", "url": "https://glygen.org/publication/PubMed/29669839" } ] }, { "start_pos": 670, "end_pos": 670, "sequence_org": "C", "sequence_mut": "A", "comment": "Reduced palmitoylation. No effect on GP processing and association with retrovirus particle. No loss of virus capability to enter into host cell. Loss of localization to the rafts; when associated with A-670.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "11877482", "url": "https://glygen.org/publication/PubMed/11877482" }, { "database": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 670, "end_pos": 670, "sequence_org": "C", "sequence_mut": "F", "comment": "Slightly reduced levels of expression of GP1 and GP2. Greatly reduced GP processing and association with retrovirus particle. 43% loss of virus capability to enter into host cell. Loss of localization to the rafts; when associated with A-672.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "11877482", "url": "https://glygen.org/publication/PubMed/11877482" }, { "database": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 672, "end_pos": 672, "sequence_org": "C", "sequence_mut": "A", "comment": "Reduced palmitoylation. No effect on GP processing and association with retrovirus particle. No loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 672, "end_pos": 672, "sequence_org": "C", "sequence_mut": "F", "comment": "Slightly reduced levels of expression of GP1 and GP2. Almost no effect on GP processing and association with retrovirus particle. 24% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "F", "sequence_mut": "A", "comment": "About 50% loss of ability to counteract host BST2.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "27707924", "url": "https://glygen.org/publication/PubMed/27707924" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "F", "sequence_mut": "A", "comment": "Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "F", "sequence_mut": "E", "comment": "Complete loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 88, "end_pos": 88, "sequence_org": "F", "sequence_mut": "I", "comment": "No loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 95, "end_pos": 95, "sequence_org": "K", "sequence_mut": "A", "comment": "80% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 95, "end_pos": 95, "sequence_org": "K", "sequence_mut": "E", "comment": "80% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] }, { "start_pos": 95, "end_pos": 95, "sequence_org": "K", "sequence_mut": "R", "comment": "20% loss of virus capability to enter into host cell.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Zaire ebolavirus (strain Mayinga-76)", "taxid": 128952, "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "common_name": "Zaire ebolavirus", "glygen_name": "Ebola (EBOV)", "reference_species": "Zaire ebolavirus (strain Mayinga-76) [128952]" } ], "gene": [ { "name": "GP", "url": "https://www.uniprot.org/uniprotkb/Q05320", "locus": {} } ], "crossref": [ { "id": "911829", "url": "https://www.ncbi.nlm.nih.gov/gene/911829", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2EBO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2EBO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "2RLJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=2RLJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "3CSY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=3CSY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5FHC", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5FHC&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5HJ3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5HJ3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5JQ3", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5JQ3&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5JQ7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5JQ7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5JQB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5JQB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5KEL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5KEL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5KEM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5KEM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5KEN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5KEN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6EA7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6EA7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6EAY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6EAY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6F5U", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6F5U&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6F6I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6F6I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6F6N", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6F6N&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6F6S", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6F6S&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6G95", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6G95&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6G9B", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6G9B&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6G9I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6G9I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6HRO", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6HRO&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6HS4", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6HS4&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6MAM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6MAM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6NAE", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6NAE&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6OZ9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6OZ9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6QD7", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6QD7&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6QD8", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6QD8&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6S8D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6S8D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6S8I", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6S8I&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6S8J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6S8J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6VKM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6VKM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7JPH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7JPH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7JPI", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7JPI&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7KEJ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7KEJ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7KEX", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7KEX&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7KF9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7KF9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7KFB", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7KFB&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7KFH", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7KFH&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LYD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LYD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7LYY", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7LYY&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7M2D", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7M2D&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7M8L", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7M8L&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7SSQ", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7SSQ&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7SSR", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7SSR&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7SWD", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7SWD&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "7TN9", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=7TN9&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8DPL", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8DPL&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8DPM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8DPM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8F87", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8F87&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9BSU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9BSU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9BSV", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9BSV&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9MHA", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9MHA&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "9NNU", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=9NNU&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "68320", "url": "https://www.iedb.org/epitope/68320", "database": "IEDB", "categories": [ "Other" ] }, { "id": "IPR002561", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002561", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014625", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014625", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR054584", "url": "https://www.ebi.ac.uk/interpro/entry/IPR054584", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00002ebo", "url": "https://www.rcsb.org/structure/pdb_00002ebo", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00002rlj", "url": "https://www.rcsb.org/structure/pdb_00002rlj", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00003csy", "url": "https://www.rcsb.org/structure/pdb_00003csy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005fhc", "url": "https://www.rcsb.org/structure/pdb_00005fhc", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005hj3", "url": "https://www.rcsb.org/structure/pdb_00005hj3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005jq3", "url": "https://www.rcsb.org/structure/pdb_00005jq3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005jq7", "url": "https://www.rcsb.org/structure/pdb_00005jq7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005jqb", "url": "https://www.rcsb.org/structure/pdb_00005jqb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005kel", "url": "https://www.rcsb.org/structure/pdb_00005kel", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005kem", "url": "https://www.rcsb.org/structure/pdb_00005kem", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005ken", "url": "https://www.rcsb.org/structure/pdb_00005ken", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ea7", "url": "https://www.rcsb.org/structure/pdb_00006ea7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006eay", "url": "https://www.rcsb.org/structure/pdb_00006eay", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006f5u", "url": "https://www.rcsb.org/structure/pdb_00006f5u", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006f6i", "url": "https://www.rcsb.org/structure/pdb_00006f6i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006f6n", "url": "https://www.rcsb.org/structure/pdb_00006f6n", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006f6s", "url": "https://www.rcsb.org/structure/pdb_00006f6s", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006g95", "url": "https://www.rcsb.org/structure/pdb_00006g95", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006g9b", "url": "https://www.rcsb.org/structure/pdb_00006g9b", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006g9i", "url": "https://www.rcsb.org/structure/pdb_00006g9i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006hro", "url": "https://www.rcsb.org/structure/pdb_00006hro", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006hs4", "url": "https://www.rcsb.org/structure/pdb_00006hs4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006mam", "url": "https://www.rcsb.org/structure/pdb_00006mam", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006nae", "url": "https://www.rcsb.org/structure/pdb_00006nae", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006oz9", "url": "https://www.rcsb.org/structure/pdb_00006oz9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006qd7", "url": "https://www.rcsb.org/structure/pdb_00006qd7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006qd8", "url": "https://www.rcsb.org/structure/pdb_00006qd8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006s8d", "url": "https://www.rcsb.org/structure/pdb_00006s8d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006s8i", "url": "https://www.rcsb.org/structure/pdb_00006s8i", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006s8j", "url": "https://www.rcsb.org/structure/pdb_00006s8j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006vkm", "url": "https://www.rcsb.org/structure/pdb_00006vkm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007jph", "url": "https://www.rcsb.org/structure/pdb_00007jph", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007jpi", "url": "https://www.rcsb.org/structure/pdb_00007jpi", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007kej", "url": "https://www.rcsb.org/structure/pdb_00007kej", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007kex", "url": "https://www.rcsb.org/structure/pdb_00007kex", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007kf9", "url": "https://www.rcsb.org/structure/pdb_00007kf9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007kfb", "url": "https://www.rcsb.org/structure/pdb_00007kfb", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007kfh", "url": "https://www.rcsb.org/structure/pdb_00007kfh", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lyd", "url": "https://www.rcsb.org/structure/pdb_00007lyd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007lyy", "url": "https://www.rcsb.org/structure/pdb_00007lyy", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007m2d", "url": "https://www.rcsb.org/structure/pdb_00007m2d", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007m8l", "url": "https://www.rcsb.org/structure/pdb_00007m8l", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007ssq", "url": "https://www.rcsb.org/structure/pdb_00007ssq", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007ssr", "url": "https://www.rcsb.org/structure/pdb_00007ssr", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007swd", "url": "https://www.rcsb.org/structure/pdb_00007swd", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00007tn9", "url": "https://www.rcsb.org/structure/pdb_00007tn9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008dpl", "url": "https://www.rcsb.org/structure/pdb_00008dpl", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008dpm", "url": "https://www.rcsb.org/structure/pdb_00008dpm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008f87", "url": "https://www.rcsb.org/structure/pdb_00008f87", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009bsu", "url": "https://www.rcsb.org/structure/pdb_00009bsu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009bsv", "url": "https://www.rcsb.org/structure/pdb_00009bsv", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009mha", "url": "https://www.rcsb.org/structure/pdb_00009mha", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00009nnu", "url": "https://www.rcsb.org/structure/pdb_00009nnu", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2EBO", "url": "https://www.rcsb.org/structure/2EBO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RLJ", "url": "https://www.rcsb.org/structure/2RLJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3CSY", "url": "https://www.rcsb.org/structure/3CSY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FHC", "url": "https://www.rcsb.org/structure/5FHC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5HJ3", "url": "https://www.rcsb.org/structure/5HJ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JQ3", "url": "https://www.rcsb.org/structure/5JQ3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JQ7", "url": "https://www.rcsb.org/structure/5JQ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JQB", "url": "https://www.rcsb.org/structure/5JQB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KEL", "url": "https://www.rcsb.org/structure/5KEL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KEM", "url": "https://www.rcsb.org/structure/5KEM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KEN", "url": "https://www.rcsb.org/structure/5KEN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EA7", "url": "https://www.rcsb.org/structure/6EA7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EAY", "url": "https://www.rcsb.org/structure/6EAY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F5U", "url": "https://www.rcsb.org/structure/6F5U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F6I", "url": "https://www.rcsb.org/structure/6F6I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F6N", "url": "https://www.rcsb.org/structure/6F6N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6F6S", "url": "https://www.rcsb.org/structure/6F6S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6G95", "url": "https://www.rcsb.org/structure/6G95", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6G9B", "url": "https://www.rcsb.org/structure/6G9B", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6G9I", "url": "https://www.rcsb.org/structure/6G9I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HRO", "url": "https://www.rcsb.org/structure/6HRO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6HS4", "url": "https://www.rcsb.org/structure/6HS4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6MAM", "url": "https://www.rcsb.org/structure/6MAM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6NAE", "url": "https://www.rcsb.org/structure/6NAE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6OZ9", "url": "https://www.rcsb.org/structure/6OZ9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QD7", "url": "https://www.rcsb.org/structure/6QD7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QD8", "url": "https://www.rcsb.org/structure/6QD8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6S8D", "url": "https://www.rcsb.org/structure/6S8D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6S8I", "url": "https://www.rcsb.org/structure/6S8I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6S8J", "url": "https://www.rcsb.org/structure/6S8J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VKM", "url": "https://www.rcsb.org/structure/6VKM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JPH", "url": "https://www.rcsb.org/structure/7JPH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JPI", "url": "https://www.rcsb.org/structure/7JPI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KEJ", "url": "https://www.rcsb.org/structure/7KEJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KEX", "url": "https://www.rcsb.org/structure/7KEX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KF9", "url": "https://www.rcsb.org/structure/7KF9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KFB", "url": "https://www.rcsb.org/structure/7KFB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7KFH", "url": "https://www.rcsb.org/structure/7KFH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LYD", "url": "https://www.rcsb.org/structure/7LYD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LYY", "url": "https://www.rcsb.org/structure/7LYY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7M2D", "url": "https://www.rcsb.org/structure/7M2D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7M8L", "url": "https://www.rcsb.org/structure/7M8L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SSQ", "url": "https://www.rcsb.org/structure/7SSQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SSR", "url": "https://www.rcsb.org/structure/7SSR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7SWD", "url": "https://www.rcsb.org/structure/7SWD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7TN9", "url": "https://www.rcsb.org/structure/7TN9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8DPL", "url": "https://www.rcsb.org/structure/8DPL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8DPM", "url": "https://www.rcsb.org/structure/8DPM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8F87", "url": "https://www.rcsb.org/structure/8F87", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9BSU", "url": "https://www.rcsb.org/structure/9BSU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9BSV", "url": "https://www.rcsb.org/structure/9BSV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9MHA", "url": "https://www.rcsb.org/structure/9MHA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "9NNU", "url": "https://www.rcsb.org/structure/9NNU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01611", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01611", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF22307", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF22307", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_066246", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066246", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q05320-1", "url": "https://www.uniprot.org/uniprotkb/Q05320-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTVVSNGAKNISGQSPARTSSDPGTNTTTEDHKIMASENSSAMVQVHSQGREAAVSHLTTLATISTSPQSLTTKPGPDNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDTPSATTAAGPPKAENTNTSKSTDFLDPATTTSPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRREAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF", "length": 676, "header": "sp|Q05320-1|VGP_EBOZM Isoform 1 of Envelope glycoprotein OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=GP PE=1 SV=1 CANONICAL=Q05320-1" }, "isoforms": [ { "isoform_ac": "Q05320-1", "url": "https://www.uniprot.org/uniprotkb/Q05320/entry#Q05320-1", "sequence": { "sequence": "MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTVVSNGAKNISGQSPARTSSDPGTNTTTEDHKIMASENSSAMVQVHSQGREAAVSHLTTLATISTSPQSLTTKPGPDNSTHNTPVYKLDISEATQVEQHHRRTDNDSTASDTPSATTAAGPPKAENTNTSKSTDFLDPATTTSPQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRREAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQLANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPHDWTKNITDKIDQIIHDFVDKTLPDQGDNDNWWTGWRQWIPAGIGVTGVIIAVIALFCICKFVF", "length": 676, "header": "sp|Q05320-1|VGP_EBOZM Isoform 1 of Envelope glycoprotein OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=GP PE=1 SV=1 CANONICAL=Q05320-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G07166XN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11499BM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11917LX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G12793SR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14470GL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G16017RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G18340YI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G20729IA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24517ZG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G34200SQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40024DP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40066BA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40177UP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G45876TX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G49980AO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G51890WS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64543AR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64574OS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G67419ZC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G68094RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G75630ZE", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G76592TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G77885VH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G97915FA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15908WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G17255FP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G20425TQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40066BA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G47012YE", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G67419ZC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G71059MG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G91373PO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G00825HN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24103VF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G45876TX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G46312WW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G54678CA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G56645JG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G67419ZC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G68094RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79421NO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G04062KZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11499BM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15908WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G38025GO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40024DP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40177UP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G42032NU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G45876TX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G49980AO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G54678CA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64574OS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G67419ZC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G68094RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G71059MG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G75607BQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G86855CI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G97915FA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G99966GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 296, "start_aa": "Asn", "end_pos": 296, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn296", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11499BM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40024DP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44437FL", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G54678CA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G57471MV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G67419ZC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G76329LA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79421NO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 317, "start_aa": "Asn", "end_pos": 317, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn317", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 333, "start_aa": "Asn", "end_pos": 333, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn333", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G02315DX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G24377DY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31936TA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40177UP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G48584BU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66760KM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G72398FA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78790NZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78977TF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G79568CQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 346, "start_aa": "Asn", "end_pos": 346, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn346", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11499BM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14260UH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23432EQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G23453IV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39619TI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G51890WS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G67419ZC", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G78977TF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G97915FA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 386, "start_aa": "Asn", "end_pos": 386, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn386", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G02281EI", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G04062KZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G05622OS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G11499BM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15294CB", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G15908WF", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G22267GY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G26403SG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31916IQ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G56134FA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64574OS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G73291XG", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G76329LA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G83813WM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G98147MD", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 413, "start_aa": "Asn", "end_pos": 413, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn413", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 413, "start_aa": "Asn", "end_pos": 413, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn413", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 413, "start_aa": "Asn", "end_pos": 413, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn413", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G27336AY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 413, "start_aa": "Asn", "end_pos": 413, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn413", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G31040BO", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 413, "start_aa": "Asn", "end_pos": 413, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn413", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 413, "start_aa": "Asn", "end_pos": 413, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn413", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 436, "start_aa": "Asn", "end_pos": 436, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn436", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 436, "start_aa": "Asn", "end_pos": 436, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn436", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 436, "start_aa": "Asn", "end_pos": 436, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn436", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G13749ZZ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 454, "start_aa": "Asn", "end_pos": 454, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn454", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G44231RW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 454, "start_aa": "Asn", "end_pos": 454, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn454", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 454, "start_aa": "Asn", "end_pos": 454, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn454", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64741TN", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 454, "start_aa": "Asn", "end_pos": 454, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn454", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G81295CK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 454, "start_aa": "Asn", "end_pos": 454, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn454", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 454, "start_aa": "Asn", "end_pos": 454, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn454", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 462, "start_aa": "Asn", "end_pos": 462, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn462", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 462, "start_aa": "Asn", "end_pos": 462, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn462", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 462, "start_aa": "Asn", "end_pos": 462, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn462", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 462, "start_aa": "Asn", "end_pos": 462, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn462", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G06110VR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G17255FP", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G33609NS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G34495VW", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G40066BA", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G50045TK", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G51890WS", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G65092SV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G66538GV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G72735IY", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 563, "start_aa": "Asn", "end_pos": 563, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn563", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] }, { "glytoucan_ac": "G08249BH", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G60145BJ", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G68094RR", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "G91344EV", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported_with_glycan", "site_category_dict": { "reported_with_glycan": true }, "site_seq": "N", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "35927436", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35927436" }, { "id": "TP3222006", "database": "GlyTableMaker", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "reported", "site_category_dict": { "reported": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 618, "start_aa": "Asn", "end_pos": 618, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn618", "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Glycan shield of the ebolavirus envelope glycoprotein GP.", "journal": "Communications biology", "date": "2022-08-04", "authors": "Peng Weiwei, Rayaprolu Vamseedhar, Parvate Amar D, Pronker Matti F, Hui Sean, Parekh Diptiben, Shaffer Kelly, Yu Xiaoying, Saphire Erica O, Snijder Joost", "evidence": [ { "database": "GlyTableMaker", "id": "TP3222006", "url": "https://glygen.ccrc.uga.edu/tablemaker/data/TP3222006" } ], "reference": [ { "type": "PubMed", "id": "35927436", "url": "https://glygen.org/publication/PubMed/35927436" } ] }, { "title": "Core structure of the envelope glycoprotein GP2 from Ebola virus at 1.9-A resolution.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1999", "authors": "Malashkevich V.N., Kim P.S., McNally M.L., Milhollen M.A., Pang J.X., Schneider B.J.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "10077567", "url": "https://glygen.org/publication/PubMed/10077567" } ] }, { "title": "Mutational analysis of the putative fusion domain of Ebola virus glycoprotein.", "journal": "Journal of virology", "date": "1999-10", "authors": "Ito H, Watanabe S, Sanchez A, Whitt M A, Kawaoka Y", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "10482652", "url": "https://glygen.org/publication/PubMed/10482652" } ] }, { "title": "Identification of the Ebola virus glycoprotein as the main viral determinant of vascular cell cytotoxicity and injury.", "journal": "Nat. Med.", "date": "2000", "authors": "Sanchez A., Nabel E.G., Nabel G.J., Duckers H.J., Yang Z.-Y., Sullivan N.J.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "10932225", "url": "https://glygen.org/publication/PubMed/10932225" } ] }, { "title": "Functional importance of the coiled-coil of the Ebola virus glycoprotein.", "journal": "J. Virol.", "date": "2000", "authors": "Ito H., Watanabe S., Watanabe T., Kawaoka Y., Takada A., Kida H.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "11024148", "url": "https://glygen.org/publication/PubMed/11024148" } ] }, { "title": "Molecular characterization of guinea pig-adapted variants of Ebola virus.", "journal": "Virology", "date": "2000", "authors": "Volchkov V.E., Klenk H.D., Chepurnov A.A., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "11062045", "url": "https://glygen.org/publication/PubMed/11062045" } ] }, { "title": "Downregulation of beta1 integrins by Ebola virus glycoprotein: implication for virus entry.", "journal": "Virology", "date": "2000-12-05", "authors": "Takada A, Watanabe S, Ito H, Okazaki K, Kida H, Kawaoka Y", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "11112476", "url": "https://glygen.org/publication/PubMed/11112476" } ] }, { "title": "Ebola virus glycoprotein: proteolytic processing, acylation, cell tropism, and detection of neutralizing antibodies.", "journal": "Journal of virology", "date": "2001-02", "authors": "Ito H, Watanabe S, Takada A, Kawaoka Y", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" } ] }, { "title": "Folate receptor-alpha is a cofactor for cellular entry by Marburg and Ebola viruses.", "journal": "Cell", "date": "2001", "authors": "Chan S.Y., Goldsmith M.A., Empig C.J., Kreisberg J.F., Schmaljohn A., Speck R.F., Welte F.J.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "11461707", "url": "https://glygen.org/publication/PubMed/11461707" } ] }, { "title": "Ebola virus glycoproteins induce global surface protein down-modulation and loss of cell adherence.", "journal": "Journal of virology", "date": "2002-03", "authors": "Simmons Graham, Wool-Lewis Rouven J, Baribaud Fr\u00e9d\u00e9ric, Netter Robert C, Bates Paul", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "11836430", "url": "https://glygen.org/publication/PubMed/11836430" } ] }, { "title": "Lipid raft microdomains: a gateway for compartmentalized trafficking of Ebola and Marburg viruses.", "journal": "The Journal of experimental medicine", "date": "2002-03-04", "authors": "Bavari Sina, Bosio Catharine M, Wiegand Elizabeth, Ruthel Gordon, Will Amy B, Geisbert Thomas W, Hevey Michael, Schmaljohn Connie, Schmaljohn Alan, Aman M Javad", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "11877482", "url": "https://glygen.org/publication/PubMed/11877482" } ] }, { "title": "C-type lectins DC-SIGN and L-SIGN mediate cellular entry by Ebola virus in cis and in trans.", "journal": "J. Virol.", "date": "2002", "authors": "Alvarez Carmen P, Lasala F\u00e1tima, Carrillo Jaime, Mu\u00f1iz Oscar, Corb\u00ed Angel L, Delgado Rafael", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "12050398", "url": "https://glygen.org/publication/PubMed/12050398" } ] }, { "title": "Covalent modifications of the ebola virus glycoprotein.", "journal": "Journal of virology", "date": "2002-12", "authors": "Jeffers Scott A, Sanders David Avram, Sanchez Anthony", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "title": "DC-SIGN and DC-SIGNR bind ebola glycoproteins and enhance infection of macrophages and endothelial cells.", "journal": "Virology", "date": "2003", "authors": "Simmons Graham, Reeves Jacqueline D, Grogan Case C, Vandenberghe Luk H, Baribaud Fr\u00e9d\u00e9ric, Whitbeck J Charles, Burke Emily, Buchmeier Michael J, Soilleux Elizabeth J, Riley James L, Doms Robert W, Bates Paul, P\u00f6hlmann Stefan", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "12504546", "url": "https://glygen.org/publication/PubMed/12504546" } ] }, { "title": "The envelope glycoprotein of Ebola virus contains an immunosuppressive-like domain similar to oncogenic retroviruses.", "journal": "FEBS Lett.", "date": "1992", "authors": "Volchkov V.E., Blinov V.M., Netesov S.V.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "1299611", "url": "https://glygen.org/publication/PubMed/1299611" } ] }, { "title": "Folate receptor alpha and caveolae are not required for Ebola virus glycoprotein-mediated viral infection.", "journal": "J. Virol.", "date": "2003", "authors": "Riley J.L., Bates P., Rennekamp A.J., Simmons G., Vandenberghe L.H., Chai N.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "14645601", "url": "https://glygen.org/publication/PubMed/14645601" } ] }, { "title": "Human macrophage C-type lectin specific for galactose and N-acetylgalactosamine promotes filovirus entry.", "journal": "J. Virol.", "date": "2004", "authors": "Irimura T., Tsuiji M., Ebihara H., Feldmann H., Kawaoka Y., Morikawa A., Fujioka K., Takada A., Higashi N., Kobasa D.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "14990712", "url": "https://glygen.org/publication/PubMed/14990712" } ] }, { "title": "Ectodomain shedding of the glycoprotein GP of Ebola virus.", "journal": "The EMBO journal", "date": "2004-05-19", "authors": "Dolnik Olga, Volchkova Valentina, Garten Wolfgang, Carbonnelle Caroline, Becker Stephan, Kahnt J\u00f6rg, Str\u00f6her Ute, Klenk Hans-Dieter, Volchkov Viktor", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" } ] }, { "title": "Ebola virus glycoprotein toxicity is mediated by a dynamin-dependent protein-trafficking pathway.", "journal": "J. Virol.", "date": "2005", "authors": "Nabel G.J., Yang Z.-Y., Peterson M., Sullivan N.J., Duckers H., Kong W.-P., Nabel E.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "15596847", "url": "https://glygen.org/publication/PubMed/15596847" } ] }, { "title": "Role of Ebola virus secreted glycoproteins and virus-like particles in activation of human macrophages.", "journal": "J. Virol.", "date": "2005", "authors": "Feldmann H., Burton D.R., Hazelton P.R., Kurz S.K., Schnittler H.J., Stroeher U., Wahl-Jensen V.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "15681442", "url": "https://glygen.org/publication/PubMed/15681442" } ] }, { "title": "Endosomal proteolysis of the Ebola virus glycoprotein is necessary for infection.", "journal": "Science", "date": "2005", "authors": "Cunningham J.M., Whelan S.P., Felbor U., Chandran K., Sullivan N.J.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "15831716", "url": "https://glygen.org/publication/PubMed/15831716" } ] }, { "title": "Effects of Ebola virus glycoproteins on endothelial cell activation and barrier function.", "journal": "Journal of virology", "date": "2005-08", "authors": "Wahl-Jensen Victoria M, Afanasieva Tatiana A, Seebach Jochen, Str\u00f6her Ute, Feldmann Heinz, Schnittler Hans-Joachim", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "16051836", "url": "https://glygen.org/publication/PubMed/16051836" } ] }, { "title": "Role of endosomal cathepsins in entry mediated by the Ebola virus glycoprotein.", "journal": "Journal of virology", "date": "2006-04", "authors": "Schornberg Kathryn, Matsuyama Shutoku, Kabsch Kirsten, Delos Sue, Bouton Amy, White Judith", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "16571833", "url": "https://glygen.org/publication/PubMed/16571833" } ] }, { "title": "Conserved receptor-binding domains of Lake Victoria marburgvirus and Zaire ebolavirus bind a common receptor.", "journal": "J. Biol. Chem.", "date": "2006", "authors": "Li W., Choe H., Farzan M., Kuhn J.H., Bavari S., Radoshitzky S.R., Aman M.J., Nichol S.T., Warfield K.L., Guth A.C., Towner J.S., Vincent M.J.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "16595665", "url": "https://glygen.org/publication/PubMed/16595665" } ] }, { "title": "Ebola virus glycoprotein GP is not cytotoxic when expressed constitutively at a moderate level.", "journal": "J. Gen. Virol.", "date": "2006", "authors": "Carbonnelle C., Volchkov V.E., Khromykh A., Dolnik O., Alazard-Dany N., Ottmann M., Reynard O., Volchkova V.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "16603527", "url": "https://glygen.org/publication/PubMed/16603527" } ] }, { "title": "The signal peptide of the ebolavirus glycoprotein influences interaction with the cellular lectins DC-SIGN and DC-SIGNR.", "journal": "J. Virol.", "date": "2006", "authors": "Hofmann H., Poehlmann S., Bates P., Gramberg T., Marzi A., Simmons G., Akhavan A., Lingappa V.R.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "16775318", "url": "https://glygen.org/publication/PubMed/16775318" } ] }, { "title": "Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.", "journal": "Journal of molecular biology", "date": "2008-01-04", "authors": "Lee Jeffrey E, Kuehne Ana, Abelson Dafna M, Fusco Marnie L, Hart Mary Kate, Saphire Erica Ollmann", "evidence": [ { "database": "IEDB", "id": "68320", "url": "https://www.iedb.org/epitope/68320" } ], "reference": [ { "type": "PubMed", "id": "18005986", "url": "https://glygen.org/publication/PubMed/18005986" } ] }, { "title": "Interaction between Ebola virus glycoprotein and host toll-like receptor 4 leads to induction of proinflammatory cytokines and SOCS1.", "journal": "J. Virol.", "date": "2010", "authors": "Okumura Atsushi, Pitha Paula M, Yoshimura Akihiko, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "19846529", "url": "https://glygen.org/publication/PubMed/19846529" } ] }, { "title": "Ebola virus uses clathrin-mediated endocytosis as an entry pathway.", "journal": "Virology", "date": "2010", "authors": "Bhattacharyya S., Bavari S., Ruthel G., Hope T.J., Aman M.J., Warfield K.L.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "20202662", "url": "https://glygen.org/publication/PubMed/20202662" } ] }, { "title": "Ebola virus entry requires the cholesterol transporter Niemann-Pick C1.", "journal": "Nature", "date": "2011-08-24", "authors": "Carette Jan E, Raaben Matthijs, Wong Anthony C, Herbert Andrew S, Obernosterer Gregor, Mulherkar Nirupama, Kuehne Ana I, Kranzusch Philip J, Griffin April M, Ruthel Gordon, Dal Cin Paola, Dye John M, Whelan Sean P, Chandran Kartik, Brummelkamp Thijn R", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "21866103", "url": "https://glygen.org/publication/PubMed/21866103" } ] }, { "title": "Cathepsin cleavage potentiates the Ebola virus glycoprotein to undergo a subsequent fusion-relevant conformational change.", "journal": "Journal of virology", "date": "2012-01", "authors": "Brecher Matthew, Schornberg Kathryn L, Delos Sue E, Fusco Marnie L, Saphire Erica Ollmann, White Judith M", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "22031933", "url": "https://glygen.org/publication/PubMed/22031933" } ] }, { "title": "Shed GP of Ebola virus triggers immune activation and increased vascular permeability.", "journal": "PLoS pathogens", "date": "2014-11", "authors": "Escudero-P\u00e9rez Beatriz, Volchkova Valentina A, Dolnik Olga, Lawrence Philip, Volchkov Viktor E", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "25412102", "url": "https://glygen.org/publication/PubMed/25412102" } ] }, { "title": "Shedding of Ebola Virus Surface Glycoprotein Is a Mechanism of Self-regulation of Cellular Cytotoxicity and Has a Direct Effect on Virus Infectivity.", "journal": "The Journal of infectious diseases", "date": "2015-10-01", "authors": "Dolnik Olga, Volchkova Valentina A, Escudero-Perez Beatriz, Lawrence Philip, Klenk Hans-Dieter, Volchkov Viktor E", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "26092855", "url": "https://glygen.org/publication/PubMed/26092855" } ] }, { "title": "Requirements within the Ebola Viral Glycoprotein for Tetherin Antagonism.", "journal": "Viruses", "date": "2015-10-26", "authors": "Vande Burgt Nathan H, Kaletsky Rachel L, Bates Paul", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "26516900", "url": "https://glygen.org/publication/PubMed/26516900" } ] }, { "title": "Enhancement of Ebola Virus Infection via Ficolin-1 Interaction with the Mucin Domain of GP Glycoprotein.", "journal": "J. Virol.", "date": "2016", "authors": "Kleman J.P., Thielens N.M., Gout E., Favier A.L., Ferraris O., Peyrefitte C., Reynard O., Volchkov V.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "26984723", "url": "https://glygen.org/publication/PubMed/26984723" } ] }, { "title": "The Tetherin Antagonism of the Ebola Virus Glycoprotein Requires an Intact Receptor-Binding Domain and Can Be Blocked by GP1-Specific Antibodies.", "journal": "Journal of virology", "date": "2016-12-15", "authors": "Brinkmann Constantin, Nehlmeier Inga, Walendy-Gnir\u00df Kerstin, Nehls Julia, Gonz\u00e1lez Hern\u00e1ndez Mariana, Hoffmann Markus, Qiu Xiangguo, Takada Ayato, Schindler Michael, P\u00f6hlmann Stefan", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "27707924", "url": "https://glygen.org/publication/PubMed/27707924" } ] }, { "title": "Ebola virus glycoprotein directly triggers T lymphocyte death despite of the lack of infection.", "journal": "PLoS pathogens", "date": "2017-05", "authors": "Iampietro Mathieu, Younan Patrick, Nishida Andrew, Dutta Mukta, Lubaki Ndongala Michel, Santos Rodrigo I, Koup Richard A, Katze Michael G, Bukreyev Alexander", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "28542576", "url": "https://glygen.org/publication/PubMed/28542576" } ] }, { "title": "Cooperation of the Ebola Virus Proteins VP40 and GP1,2 with BST2 To Activate NF-\u03baB Independently of Virus-Like Particle Trapping.", "journal": "Journal of virology", "date": "2017-11-15", "authors": "Rizk Maryan G, Basler Christopher F, Guatelli John", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "28878074", "url": "https://glygen.org/publication/PubMed/28878074" } ] }, { "title": "A GXXXA Motif in the Transmembrane Domain of the Ebola Virus Glycoprotein Is Required for Tetherin Antagonism.", "journal": "Journal of virology", "date": "2018-07-01", "authors": "Gonz\u00e1lez-Hern\u00e1ndez Mariana, Hoffmann Markus, Brinkmann Constantin, Nehls Julia, Winkler Michael, Schindler Michael, P\u00f6hlmann Stefan", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "29669839", "url": "https://glygen.org/publication/PubMed/29669839" } ] }, { "title": "The Ebola-Glycoprotein Modulates the Function of Natural Killer Cells.", "journal": "Frontiers in immunology", "date": "2018", "authors": "Edri Avishay, Shemesh Avishai, Iraqi Muhammed, Matalon Omri, Brusilovsky Michael, Hadad Uzi, Radinsky Olga, Gershoni-Yahalom Orly, Dye John M, Mandelboim Ofer, Barda-Saad Mira, Lobel Leslie, Porgador Angel", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "30013549", "url": "https://glygen.org/publication/PubMed/30013549" } ] }, { "title": "Ebola Virus Shed Glycoprotein Triggers Differentiation, Infection, and Death of Monocytes Through Toll-Like Receptor 4 Activation.", "journal": "The Journal of infectious diseases", "date": "2018-11-22", "authors": "Iampietro Mathieu, Santos Rodrigo I, Lubaki Ndongala Michel, Bukreyev Alexander", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "30085081", "url": "https://glygen.org/publication/PubMed/30085081" } ] }, { "title": "Conformational changes in the Ebola virus membrane fusion machine induced by pH, Ca2+, and receptor binding.", "journal": "PLoS biology", "date": "2020-02", "authors": "Das Dibyendu Kumar, Bulow Uriel, Diehl William E, Durham Natasha D, Senjobe Fernando, Chandran Kartik, Luban Jeremy, Munro James B", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "32040508", "url": "https://glygen.org/publication/PubMed/32040508" } ] }, { "title": "Asymmetric and non-stoichiometric glycoprotein recognition by two distinct antibodies results in broad protection against ebolaviruses.", "journal": "Cell", "date": "2022", "authors": "Milligan Jacob C, Davis Carl W, Yu Xiaoying, Ilinykh Philipp A, Huang Kai, Halfmann Peter J, Cross Robert W, Borisevich Viktoriya, Agans Krystle N, Geisbert Joan B, Chennareddy Chakravarthy, Goff Arthur J, Piper Ashley E, Hui Sean, Shaffer Kelly C L, Buck Tierra, Heinrich Megan L, Branco Luis M, Crozier Ian, Holbrook Michael R, Kuhn Jens H, Kawaoka Yoshihiro, Glass Pamela J, Bukreyev Alexander, Geisbert Thomas W, Worwa Gabriella, Ahmed Rafi, Saphire Erica Ollmann", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "35303429", "url": "https://glygen.org/publication/PubMed/35303429" } ] }, { "title": "Sequence analysis of the Ebola virus genome: organization, genetic elements, and comparison with the genome of Marburg virus.", "journal": "Virus Res.", "date": "1993", "authors": "Sanchez A., Auperin D.D., Holloway B.P., Kiley M.P.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "8237108", "url": "https://glygen.org/publication/PubMed/8237108" } ] }, { "title": "GP mRNA of Ebola virus is edited by the Ebola virus polymerase and by T7 and vaccinia virus polymerases.", "journal": "Virology", "date": "1995", "authors": "Becker S., Volchkov V.E., Klenk H.-D., Kotov A.N., Netesov S.V., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "8553543", "url": "https://glygen.org/publication/PubMed/8553543" } ] }, { "title": "The virion glycoproteins of Ebola viruses are encoded in two reading frames and are expressed through transcriptional editing.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Sanchez A., Nichol S.T., Peters C.J., Mahy B.W.J., Trappier S.G.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "8622982", "url": "https://glygen.org/publication/PubMed/8622982" } ] }, { "title": "Phosphatidylinositol-dependent membrane fusion induced by a putative fusogenic sequence of Ebola virus.", "journal": "J. Virol.", "date": "1998", "authors": "Goni F.M., Nieva J.L., Pereira F.B., Ruiz-Arguello M.B.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "9499027", "url": "https://glygen.org/publication/PubMed/9499027" } ] }, { "title": "Processing of the Ebola virus glycoprotein by the proprotein convertase furin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998-05-12", "authors": "Volchkov V E, Feldmann H, Volchkova V A, Klenk H D", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "9576958", "url": "https://glygen.org/publication/PubMed/9576958" } ] }, { "title": "Release of viral glycoproteins during Ebola virus infection.", "journal": "Virology", "date": "1998-05-25", "authors": "Volchkov V E, Volchkova V A, Slenczka W, Klenk H D, Feldmann H", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "9614872", "url": "https://glygen.org/publication/PubMed/9614872" } ] }, { "title": "Endoproteolytic processing of the ebola virus envelope glycoprotein: cleavage is not required for function.", "journal": "Journal of virology", "date": "1999-02", "authors": "Wool-Lewis R J, Bates P", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "reference": [ { "type": "PubMed", "id": "9882347", "url": "https://glygen.org/publication/PubMed/9882347" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "viral envelope", "id": "GO:0019031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019031", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "host cell plasma membrane", "id": "GO:0020002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020002", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "host cell endoplasmic reticulum", "id": "GO:0044165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044165", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "symbiont entry into host cell", "id": "GO:0046718", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046718", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "viral budding from plasma membrane", "id": "GO:0046761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046761", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "symbiont-mediated-mediated suppression of host tetherin activity", "id": "GO:0039587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039587", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "fusion of virus membrane with host endosome membrane", "id": "GO:0039654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039654", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "clathrin-dependent endocytosis of virus by host cell", "id": "GO:0075512", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0075512", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "entry receptor-mediated virion attachment to host cell", "id": "GO:0098670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098670", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "symbiont-mediated killing of host cell", "id": "GO:0001907", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001907", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host innate immune response", "id": "GO:0052170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052170", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 228, "end_pos": 230, "annotation": "n_glycosylation_sequon" }, { "start_pos": 238, "end_pos": 240, "annotation": "n_glycosylation_sequon" }, { "start_pos": 257, "end_pos": 259, "annotation": "n_glycosylation_sequon" }, { "start_pos": 268, "end_pos": 270, "annotation": "n_glycosylation_sequon" }, { "start_pos": 296, "end_pos": 298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 317, "end_pos": 319, "annotation": "n_glycosylation_sequon" }, { "start_pos": 333, "end_pos": 335, "annotation": "n_glycosylation_sequon" }, { "start_pos": 346, "end_pos": 348, "annotation": "n_glycosylation_sequon" }, { "start_pos": 386, "end_pos": 388, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 413, "end_pos": 415, "annotation": "n_glycosylation_sequon" }, { "start_pos": 436, "end_pos": 438, "annotation": "n_glycosylation_sequon" }, { "start_pos": 454, "end_pos": 456, "annotation": "n_glycosylation_sequon" }, { "start_pos": 462, "end_pos": 464, "annotation": "n_glycosylation_sequon" }, { "start_pos": 563, "end_pos": 565, "annotation": "n_glycosylation_sequon" }, { "start_pos": 618, "end_pos": 620, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Glycosylated; glycosylation is essential for the activation of dendritic cells and macrophages.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "25412102", "url": "https://glygen.org/publication/PubMed/25412102" } ] }, { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "annotation": "O-glycosylated in the mucin-like region.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] }, { "annotation": "Palmitoylation is not required for its function.", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" } ] }, { "annotation": "Specific enzymatic cleavages in vivo yield mature proteins. The precursor is processed into GP1 and GP2 by host cell furin in the trans Golgi, and maybe by other host proteases, to yield the mature GP1 and GP2 proteins (PubMed:9576958, PubMed:9614872, PubMed:9882347). The cleavage site corresponds to the furin optimal cleavage sequence [KR]-X-[KR]-R (PubMed:9576958). This cleavage does not seem to be required for function (PubMed:9576958). After the internalization of the virus into cell endosomes, GP1 C-terminus is removed by the endosomal proteases cathepsin B, cathepsin L, or both, leaving a 19-kDa N-terminal fragment which is further digested by cathepsin B (PubMed:16571833). This cleaved 19-kDa GP1 can then bind to the host entry receptor NPC1 (PubMed:21866103). Proteolytic processing of GP1,2 by host ADAM17 can remove the transmembrane anchor of GP2 and leads to shedding of complexes consisting in GP1 and truncated GP2 (GP1,2delta) (PubMed:15103332).", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "11152533", "url": "https://glygen.org/publication/PubMed/11152533" }, { "database": "PubMed", "id": "21866103", "url": "https://glygen.org/publication/PubMed/21866103" }, { "database": "PubMed", "id": "9576958", "url": "https://glygen.org/publication/PubMed/9576958" }, { "database": "PubMed", "id": "9882347", "url": "https://glygen.org/publication/PubMed/9882347" }, { "database": "PubMed", "id": "16571833", "url": "https://glygen.org/publication/PubMed/16571833" }, { "database": "PubMed", "id": "15103332", "url": "https://glygen.org/publication/PubMed/15103332" }, { "database": "PubMed", "id": "9614872", "url": "https://glygen.org/publication/PubMed/9614872" } ] }, { "annotation": "The signal peptide region modulates GP's high mannose glycosylation, thereby determining the efficiency of the interactions with DC-SIGN(R).", "evidence": [ { "database": "UniProtKB", "id": "Q05320", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "database": "PubMed", "id": "12438572", "url": "https://glygen.org/publication/PubMed/12438572" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "Q05320", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05320" }, { "id": "27707924", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27707924" } ], "ann_type": "Motif_Annotation", "uniprotkb_annotation": "Important role for host BST2/tetherin antagonism", "eco_id": "ECO_0000269", "start_pos": 660, "end_pos": 664, "start_aa": "Gly", "end_aa": "Ala", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 40, 204, 228, 238, 257, 268, 296, 317, 333, 346, 386, 413, 436, 454, 462, 563, 618 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 204, "end_pos": 206 }, { "start_pos": 228, "end_pos": 230 }, { "start_pos": 238, "end_pos": 240 }, { "start_pos": 257, "end_pos": 259 }, { "start_pos": 268, "end_pos": 270 }, { "start_pos": 296, "end_pos": 298 }, { "start_pos": 317, "end_pos": 319 }, { "start_pos": 333, "end_pos": 335 }, { "start_pos": 346, "end_pos": 348 }, { "start_pos": 386, "end_pos": 388 }, { "start_pos": 40, "end_pos": 42 }, { "start_pos": 413, "end_pos": 415 }, { "start_pos": 436, "end_pos": 438 }, { "start_pos": 454, "end_pos": 456 }, { "start_pos": 462, "end_pos": 464 }, { "start_pos": 563, "end_pos": 565 }, { "start_pos": 618, "end_pos": 620 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 294 }, { "field": "total_sites", "count": 17 }, { "field": "n_linked_sites", "count": 17 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 17 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 93 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 17 }, { "field": "exact_n_linked_sites", "count": 17 }, { "field": "exact_n_linked_glycan_sites", "count": 17 }, { "field": "exact_n_linked_glycans", "count": 93 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 17 }, { "field": "n_linked_sites", "count": 17 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 17 }, { "field": "exact_n_linked_sites", "count": 17 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 277 }, { "field": "total_sites", "count": 17 }, { "field": "n_linked_sites", "count": 17 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 17 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 93 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 17 }, { "field": "exact_n_linked_sites", "count": 17 }, { "field": "exact_n_linked_glycan_sites", "count": 17 }, { "field": "exact_n_linked_glycans", "count": 93 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 50 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q05322-1", "uniprot_ac": "Q05322", "uniprot_id": "VP24_EBOZM", "mass": { "chemical_mass": 28219.0, "monoisotopic_mass": 28219.0 }, "refseq": { "ac": "NP_066250", "name": "membrane-associated protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066250" }, "gene_names": [ { "name": "VP24", "type": "recommended", "evidence": [ { "id": "Q05322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ] } ], "protein_names": [ { "name": "Membrane-associated protein VP24", "type": "recommended", "evidence": [ { "id": "Q05322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05322/entry#names_and_taxonomy" } ] }, { "name": "Ebola VP24", "type": "synonym", "evidence": [ { "id": "Q05322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05322/entry#names_and_taxonomy" } ] }, { "name": "eVP24", "type": "synonym", "evidence": [ { "id": "Q05322", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05322/entry#names_and_taxonomy" } ] }, { "name": "membrane-associated protein", "type": "synonym", "evidence": [ { "id": "NP_066250", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066250" } ] } ], "function": [ { "annotation": "Prevents the establishment of cellular antiviral state by blocking the interferon-alpha/beta (IFN-alpha/beta) and IFN-gamma signaling pathways. Blocks the IFN-induced nuclear accumulation of host phosphorylated STAT1 by interacting with the STAT1-binding region of host importins. Alternatively also interacts directly with host STAT1 and may additionally inhibit its non-phosphorylated form. Plays a role in assembly of viral nucleocapsid and virion budding. May act as a minor matrix protein that plays a role in assembly of viral nucleocapsid and virion budding.", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322#function" }, { "database": "PubMed", "id": "25121748", "url": "https://glygen.org/publication/PubMed/25121748" }, { "database": "PubMed", "id": "12191476", "url": "https://glygen.org/publication/PubMed/12191476" }, { "database": "PubMed", "id": "12525613", "url": "https://glygen.org/publication/PubMed/12525613" }, { "database": "PubMed", "id": "15220407", "url": "https://glygen.org/publication/PubMed/15220407" }, { "database": "PubMed", "id": "17928350", "url": "https://glygen.org/publication/PubMed/17928350" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 137, "end_pos": 137, "sequence_org": "R", "sequence_mut": "A", "comment": "More than 90% loss of interaction with host KPNA5.", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" }, { "database": "PubMed", "id": "25121748", "url": "https://glygen.org/publication/PubMed/25121748" } ] }, { "start_pos": 170, "end_pos": 170, "sequence_org": "V", "sequence_mut": "A", "comment": "Complete loss of interaction with NP.", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" }, { "database": "PubMed", "id": "28794491", "url": "https://glygen.org/publication/PubMed/28794491" } ] }, { "start_pos": 171, "end_pos": 171, "sequence_org": "N", "sequence_mut": "A", "comment": "Complete loss of interaction with NP.", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" }, { "database": "PubMed", "id": "28794491", "url": "https://glygen.org/publication/PubMed/28794491" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Zaire ebolavirus (strain Mayinga-76)", "taxid": 128952, "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "common_name": "Zaire ebolavirus", "glygen_name": "Ebola (EBOV)", "reference_species": "Zaire ebolavirus (strain Mayinga-76) [128952]" } ], "gene": [ { "name": "VP24", "url": "https://www.uniprot.org/uniprotkb/Q05322", "locus": {} } ], "crossref": [ { "id": "911828", "url": "https://www.ncbi.nlm.nih.gov/gene/911828", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4M0Q", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4M0Q&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "4U2X", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=4U2X&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "6EHM", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=6EHM&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8USN", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8USN&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8UST", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8UST&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "8Y9J", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=8Y9J&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "IPR009433", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009433", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00004m0q", "url": "https://www.rcsb.org/structure/pdb_00004m0q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00004u2x", "url": "https://www.rcsb.org/structure/pdb_00004u2x", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00006ehm", "url": "https://www.rcsb.org/structure/pdb_00006ehm", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008usn", "url": "https://www.rcsb.org/structure/pdb_00008usn", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008ust", "url": "https://www.rcsb.org/structure/pdb_00008ust", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00008y9j", "url": "https://www.rcsb.org/structure/pdb_00008y9j", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4M0Q", "url": "https://www.rcsb.org/structure/4M0Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4U2X", "url": "https://www.rcsb.org/structure/4U2X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EHM", "url": "https://www.rcsb.org/structure/6EHM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8USN", "url": "https://www.rcsb.org/structure/8USN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8UST", "url": "https://www.rcsb.org/structure/8UST", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8Y9J", "url": "https://www.rcsb.org/structure/8Y9J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF06389", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF06389", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_066250", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066250", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q05322-1", "url": "https://www.uniprot.org/uniprotkb/Q05322-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAPAWSMTRNLFPHLFQNPNSTIESPLWALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKFINKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMNRMKPGPAKFSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI", "length": 251, "header": "sp|Q05322-1|VP24_EBOZM Isoform 1 of Membrane-associated protein VP24 OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=VP24 PE=1 SV=2 CANONICAL=Q05322-1" }, "isoforms": [ { "isoform_ac": "Q05322-1", "url": "https://www.uniprot.org/uniprotkb/Q05322/entry#Q05322-1", "sequence": { "sequence": "MAKATGRYNLISPKKDLEKGVVLSDLCNFLVSQTIQGWKVYWAGIEFDVTHKGMALLHRLKTNDFAPAWSMTRNLFPHLFQNPNSTIESPLWALRVILAAGIQDQLIDQSLIEPLAGALGLISDWLLTTNTNHFNMRTQRVKEQLSLKMLSLIRSNILKFINKLDALHVVNYNGLLSSIEIGTQNHTIIITRTNMGFLVELQEPDKSAMNRMKPGPAKFSLLHESTLKAFTQGSSTRMQSLILEFNSSLAI", "length": 251, "header": "sp|Q05322-1|VP24_EBOZM Isoform 1 of Membrane-associated protein VP24 OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=VP24 PE=1 SV=2 CANONICAL=Q05322-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Characterization of the L gene and 5' trailer region of Ebola virus.", "journal": "J. Gen. Virol.", "date": "1999", "authors": "Feldmann H., Volchkov V.E., Blinov V.M., Chepurnov A.A., Netesov S.V., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "10073695", "url": "https://glygen.org/publication/PubMed/10073695" } ] }, { "title": "Molecular characterization of guinea pig-adapted variants of Ebola virus.", "journal": "Virology", "date": "2000", "authors": "Volchkov V.E., Klenk H.D., Chepurnov A.A., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "11062045", "url": "https://glygen.org/publication/PubMed/11062045" } ] }, { "title": "The assembly of Ebola virus nucleocapsid requires virion-associated proteins 35 and 24 and posttranslational modification of nucleoprotein.", "journal": "Molecular cell", "date": "2002-08", "authors": "Huang Yue, Xu Ling, Sun Yongnian, Nabel Gary J", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "12191476", "url": "https://glygen.org/publication/PubMed/12191476" } ] }, { "title": "Biochemical and functional characterization of the Ebola virus VP24 protein: implications for a role in virus assembly and budding.", "journal": "Journal of virology", "date": "2003-02", "authors": "Han Ziying, Boshra Hani, Sunyer J Oriol, Zwiers Susan H, Paragas Jason, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "12525613", "url": "https://glygen.org/publication/PubMed/12525613" } ] }, { "title": "Contribution of ebola virus glycoprotein, nucleoprotein, and VP24 to budding of VP40 virus-like particles.", "journal": "Journal of virology", "date": "2004-07", "authors": "Licata Jillian M, Johnson Reed F, Han Ziying, Harty Ronald N", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "15220407", "url": "https://glygen.org/publication/PubMed/15220407" } ] }, { "title": "Ebola virus VP24 binds karyopherin alpha-1 and blocks STAT1 nuclear accumulation.", "journal": "J. Virol.", "date": "2006", "authors": "Reid St Patrick, Leung Lawrence W, Hartman Amy L, Martinez Osvaldo, Shaw Megan L, Carbonnelle Caroline, Volchkov Viktor E, Nichol Stuart T, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "16698996", "url": "https://glygen.org/publication/PubMed/16698996" } ] }, { "title": "Ebola virus VP24 proteins inhibit the interaction of NPI-1 subfamily karyopherin alpha proteins with activated STAT1.", "journal": "Journal of virology", "date": "2007-12", "authors": "Reid St Patrick, Valmas Charalampos, Martinez Osvaldo, Sanchez Freddy Mauricio, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "17928350", "url": "https://glygen.org/publication/PubMed/17928350" } ] }, { "title": "The ebola virus interferon antagonist VP24 directly binds STAT1 and has a novel, pyramidal fold.", "journal": "PLoS Pathog.", "date": "2012", "authors": "Zhang Adrianna P P, Bornholdt Zachary A, Liu Tong, Abelson Dafna M, Lee David E, Li Sheng, Woods Virgil L, Saphire Erica Ollmann", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "22383882", "url": "https://glygen.org/publication/PubMed/22383882" } ] }, { "title": "The Marburg virus VP24 protein interacts with Keap1 to activate the cytoprotective antioxidant response pathway.", "journal": "Cell Rep.", "date": "2014", "authors": "Edwards Megan R, Johnson Britney, Mire Chad E, Xu Wei, Shabman Reed S, Speller Lauren N, Leung Daisy W, Geisbert Thomas W, Amarasinghe Gaya K, Basler Christopher F", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "24630991", "url": "https://glygen.org/publication/PubMed/24630991" } ] }, { "title": "Ebola virus VP24 targets a unique NLS binding site on karyopherin alpha 5 to selectively compete with nuclear import of phosphorylated STAT1.", "journal": "Cell host & microbe", "date": "2014", "authors": "Xu W, Edwards MR, Borek DM, Feagins AR, Mittal A, Alinger JB, Berry KN, Yen B, Hamilton J, Brett TJ, Pappu RV, Leung DW, Basler CF, Amarasinghe GK", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "25121748", "url": "https://glygen.org/publication/PubMed/25121748" } ] }, { "title": "Ebola virus VP24 interacts with NP to facilitate nucleocapsid assembly and genome packaging.", "journal": "Scientific reports", "date": "2017-08-09", "authors": "Banadyga Logan, Hoenen Thomas, Ambroggio Xavier, Dunham Eric, Groseth Allison, Ebihara Hideki", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "28794491", "url": "https://glygen.org/publication/PubMed/28794491" } ] }, { "title": "Structure and assembly of the Ebola virus nucleocapsid.", "journal": "Nature", "date": "2017", "authors": "Wan William, Kolesnikova Larissa, Clarke Mairi, Koehler Alexander, Noda Takeshi, Becker Stephan, Briggs John A G", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "29144446", "url": "https://glygen.org/publication/PubMed/29144446" } ] }, { "title": "Sequence analysis of the Ebola virus genome: organization, genetic elements, and comparison with the genome of Marburg virus.", "journal": "Virus Res.", "date": "1993", "authors": "Sanchez A., Auperin D.D., Holloway B.P., Kiley M.P.", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "reference": [ { "type": "PubMed", "id": "8237108", "url": "https://glygen.org/publication/PubMed/8237108" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "pmid": "" }, { "name": "virion membrane", "id": "GO:0055036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055036", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "pmid": "" }, { "name": "host cell plasma membrane", "id": "GO:0020002", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0020002", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "pmid": "" }, { "name": "host cell endomembrane system", "id": "GO:0033645", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033645", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural molecule activity", "id": "GO:0005198", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005198", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "symbiont-mediated suppression of host type I interferon-mediated signaling pathway", "id": "GO:0039502", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039502", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host JAK-STAT cascade via inhibition of STAT1 activity", "id": "GO:0039563", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0039563", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "pmid": "" }, { "name": "viral budding from plasma membrane", "id": "GO:0046761", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046761", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host innate immune response", "id": "GO:0052170", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052170", "evidence": [ { "database": "UniProtKB", "id": "Q05322", "url": "https://www.uniprot.org/uniprotkb/Q05322" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 185, "end_pos": 187, "annotation": "n_glycosylation_sequon" }, { "start_pos": 246, "end_pos": 248, "annotation": "n_glycosylation_sequon" }, { "start_pos": 84, "end_pos": 86, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 185, "end_pos": 187 }, { "start_pos": 246, "end_pos": 248 }, { "start_pos": 84, "end_pos": 86 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 13 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q05323-1", "uniprot_ac": "Q05323", "uniprot_id": "VP30_EBOZM", "mass": { "chemical_mass": 32521.0, "monoisotopic_mass": 32521.0 }, "refseq": { "ac": "NP_066249", "name": "minor nucleoprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066249" }, "gene_names": [ { "name": "VP30", "type": "recommended", "evidence": [ { "id": "Q05323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ] } ], "protein_names": [ { "name": "Transcriptional activator VP30", "type": "recommended", "evidence": [ { "id": "Q05323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05323/entry#names_and_taxonomy" } ] }, { "name": "Ebola VP30", "type": "synonym", "evidence": [ { "id": "Q05323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05323/entry#names_and_taxonomy" } ] }, { "name": "Minor nucleoprotein VP30", "type": "synonym", "evidence": [ { "id": "Q05323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05323/entry#names_and_taxonomy" } ] }, { "name": "eVP30", "type": "synonym", "evidence": [ { "id": "Q05323", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05323/entry#names_and_taxonomy" } ] }, { "name": "minor nucleoprotein", "type": "synonym", "evidence": [ { "id": "NP_066249", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066249" } ] } ], "function": [ { "annotation": "Multifunctional protein that acts as a viral transcriptional activator (PubMed:12163572, PubMed:27279615). Promotes read-through of an RNA hairpin in the NP open reading frame to enhance viral transcription (PubMed:12163572). Mechanistically, nonphosphorylated VP30 hexamers form a ternary complex with the viral leader RNA (PubMed:27315567). Clamps the RNA template and the complex VP35-polymerase L together, thereby increasing the polymerase affinity for the RNA template to increase transcription initiation despite the presence of RNA secondary structures. Also assists stop-start transcription at gene junctions to promote transcription of downstream genes (PubMed:18829754). Interaction with NP plays a critical role in transcription initiation by recognizing the RNA stem loop (PubMed:28593988). Interaction with host RBBP6 interferes with NP-VP30 interaction and inhibits viral RNA synthesis. Also acts as a suppressor of RNA silencing by interacting with host DICER1 and TARBP2/TRBP (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323#function" }, { "database": "PubMed", "id": "18829754", "url": "https://glygen.org/publication/PubMed/18829754" }, { "database": "PubMed", "id": "27279615", "url": "https://glygen.org/publication/PubMed/27279615" }, { "database": "UniProtKB", "id": "Q77DJ5", "url": "https://www.uniprot.org/uniprotkb/Q77DJ5#function" }, { "database": "PubMed", "id": "28593988", "url": "https://glygen.org/publication/PubMed/28593988" }, { "database": "PubMed", "id": "12163572", "url": "https://glygen.org/publication/PubMed/12163572" }, { "database": "PubMed", "id": "27315567", "url": "https://glygen.org/publication/PubMed/27315567" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 100, "end_pos": 100, "sequence_org": "L", "sequence_mut": "A", "comment": "Complete loss of homo-oligomerization.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "12912982", "url": "https://glygen.org/publication/PubMed/12912982" } ] }, { "start_pos": 102, "end_pos": 102, "sequence_org": "L", "sequence_mut": "A", "comment": "Complete loss of homooligomerization.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "12912982", "url": "https://glygen.org/publication/PubMed/12912982" } ] }, { "start_pos": 197, "end_pos": 197, "sequence_org": "E", "sequence_mut": "R", "comment": "Complete loss of interaction with nucleoprotein/NP.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "27755595", "url": "https://glygen.org/publication/PubMed/27755595" } ] }, { "start_pos": 202, "end_pos": 202, "sequence_org": "D", "sequence_mut": "R", "comment": "Complete loss of interaction with nucleoprotein/NP.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "27755595", "url": "https://glygen.org/publication/PubMed/27755595" } ] }, { "start_pos": 203, "end_pos": 203, "sequence_org": "Q", "sequence_mut": "R", "comment": "Complete loss of interaction with nucleoprotein/NP.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "27755595", "url": "https://glygen.org/publication/PubMed/27755595" } ] }, { "start_pos": 229, "end_pos": 229, "sequence_org": "Q", "sequence_mut": "R", "comment": "Complete loss of interaction with nucleoprotein/NP.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "27755595", "url": "https://glygen.org/publication/PubMed/27755595" } ] }, { "start_pos": 230, "end_pos": 230, "sequence_org": "W", "sequence_mut": "F", "comment": "Complete loss of interaction with nucleoprotein/NP.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "27755595", "url": "https://glygen.org/publication/PubMed/27755595" } ] }, { "start_pos": 234, "end_pos": 234, "sequence_org": "S", "sequence_mut": "R", "comment": "Complete loss of interaction with nucleoprotein/NP.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "27755595", "url": "https://glygen.org/publication/PubMed/27755595" } ] }, { "start_pos": 72, "end_pos": 72, "sequence_org": "C", "sequence_mut": "S", "comment": "More than 70% loss of RNA-binding.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "27279615", "url": "https://glygen.org/publication/PubMed/27279615" } ] } ], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Zaire ebolavirus (strain Mayinga-76)", "taxid": 128952, "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "common_name": "Zaire ebolavirus", "glygen_name": "Ebola (EBOV)", "reference_species": "Zaire ebolavirus (strain Mayinga-76) [128952]" } ], "gene": [ { "name": "VP30", "url": "https://www.uniprot.org/uniprotkb/Q05323", "locus": {} } ], "crossref": [ { "id": "911826", "url": "https://www.ncbi.nlm.nih.gov/gene/911826", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "5DVW", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5DVW&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "5T3T", "url": "https://www.ncbi.nlm.nih.gov/Structure/icn3d/?mmdbid=5T3T&bu=0", "database": "iCn3D", "categories": [ "3D Structure" ] }, { "id": "IPR014459", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014459", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "pdb_00005dvw", "url": "https://www.rcsb.org/structure/pdb_00005dvw", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "pdb_00005t3t", "url": "https://www.rcsb.org/structure/pdb_00005t3t", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DVW", "url": "https://www.rcsb.org/structure/5DVW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5T3T", "url": "https://www.rcsb.org/structure/5T3T", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF11507", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF11507", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_066249", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066249", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q05323-1", "url": "https://www.uniprot.org/uniprotkb/Q05323-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRSASQVRVPTVFHKKRVEPLTVPPAPKDICPTLKKGFLCDSSFCKKDHQLESLTDRELLLLIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGPKITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLHSDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTNPGTCSWSDEGTP", "length": 288, "header": "sp|Q05323-1|VP30_EBOZM Isoform 1 of Transcriptional activator VP30 OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=VP30 PE=1 SV=2 CANONICAL=Q05323-1" }, "isoforms": [ { "isoform_ac": "Q05323-1", "url": "https://www.uniprot.org/uniprotkb/Q05323/entry#Q05323-1", "sequence": { "sequence": "MEASYERGRPRAARQHSRDGHDHHVRARSSSRENYRGEYRQSRSASQVRVPTVFHKKRVEPLTVPPAPKDICPTLKKGFLCDSSFCKKDHQLESLTDRELLLLIARKTCGSVEQQLNITAPKDSRLANPTADDFQQEEGPKITLLTLIKTAEHWARQDIRTIEDSKLRALLTLCAVMTRKFSKSQLSLLCETHLRREGLGQDQAEPVLEVYQRLHSDKGGSFEAALWQQWDRQSLIMFITAFLNIALQLPCESSAVVVSGLRTLVPQSDNEEASTNPGTCSWSDEGTP", "length": 288, "header": "sp|Q05323-1|VP30_EBOZM Isoform 1 of Transcriptional activator VP30 OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=VP30 PE=1 SV=2 CANONICAL=Q05323-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by host", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "site_lbl": "Ser29" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Molecular characterization of guinea pig-adapted variants of Ebola virus.", "journal": "Virology", "date": "2000", "authors": "Volchkov V.E., Klenk H.D., Chepurnov A.A., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "11062045", "url": "https://glygen.org/publication/PubMed/11062045" } ] }, { "title": "Phosphorylation of VP30 impairs ebola virus transcription.", "journal": "The Journal of biological chemistry", "date": "2002-09-06", "authors": "Modrof Jens, M\u00fchlberger Elke, Klenk Hans-Dieter, Becker Stephan", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "12052831", "url": "https://glygen.org/publication/PubMed/12052831" } ] }, { "title": "Ebola virus VP30-mediated transcription is regulated by RNA secondary structure formation.", "journal": "Journal of virology", "date": "2002-09", "authors": "Weik Michael, Modrof Jens, Klenk Hans-Dieter, Becker Stephan, M\u00fchlberger Elke", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "12163572", "url": "https://glygen.org/publication/PubMed/12163572" } ] }, { "title": "The assembly of Ebola virus nucleocapsid requires virion-associated proteins 35 and 24 and posttranslational modification of nucleoprotein.", "journal": "Mol. Cell", "date": "2002", "authors": "Huang Yue, Xu Ling, Sun Yongnian, Nabel Gary J", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "12191476", "url": "https://glygen.org/publication/PubMed/12191476" } ] }, { "title": "Ebola virus transcription activator VP30 is a zinc-binding protein.", "journal": "J. Virol.", "date": "2003", "authors": "Becker S., Modrof J., Muhlberger E.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "12584359", "url": "https://glygen.org/publication/PubMed/12584359" } ] }, { "title": "Oligomerization of Ebola virus VP30 is essential for viral transcription and can be inhibited by a synthetic peptide.", "journal": "The Journal of biological chemistry", "date": "2003-10-24", "authors": "Hartlieb Bettina, Modrof Jens, M\u00fchlberger Elke, Klenk Hans-Dieter, Becker Stephan", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "12912982", "url": "https://glygen.org/publication/PubMed/12912982" } ] }, { "title": "Ebola virus VP30 is an RNA binding protein.", "journal": "J. Virol.", "date": "2007", "authors": "Wang T., Longhi S., John S.P., Jonsson C.B., Schmaljohn C.S., Steffen S.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "17567691", "url": "https://glygen.org/publication/PubMed/17567691" } ] }, { "title": "Role of Ebola virus VP30 in transcription reinitiation.", "journal": "Journal of virology", "date": "2008-12", "authors": "Mart\u00ednez Miguel J, Biedenkopf Nadine, Volchkova Valentina, Hartlieb Bettina, Alazard-Dany Nathalie, Reynard Olivier, Becker Stephan, Volchkov Viktor", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "18829754", "url": "https://glygen.org/publication/PubMed/18829754" } ] }, { "title": "RNA Binding of Ebola Virus VP30 Is Essential for Activating Viral Transcription.", "journal": "Journal of virology", "date": "2016-08-15", "authors": "Biedenkopf Nadine, Schlereth Julia, Gr\u00fcnweller Arnold, Becker Stephan, Hartmann Roland K", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "27279615", "url": "https://glygen.org/publication/PubMed/27279615" } ] }, { "title": "RNA binding specificity of Ebola virus transcription factor VP30.", "journal": "RNA biology", "date": "2016-09", "authors": "Schlereth Julia, Gr\u00fcnweller Arnold, Biedenkopf Nadine, Becker Stephan, Hartmann Roland K", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "27315567", "url": "https://glygen.org/publication/PubMed/27315567" } ] }, { "title": "The Ebola Virus VP30-NP Interaction Is a Regulator of Viral RNA Synthesis.", "journal": "PLoS pathogens", "date": "2016-10", "authors": "Kirchdoerfer Robert N, Moyer Crystal L, Abelson Dafna M, Saphire Erica Ollmann", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "27755595", "url": "https://glygen.org/publication/PubMed/27755595" } ] }, { "title": "Ebola virus VP30 and nucleoprotein interactions modulate viral RNA synthesis.", "journal": "Nature communications", "date": "2017-06-08", "authors": "Xu Wei, Luthra Priya, Wu Chao, Batra Jyoti, Leung Daisy W, Basler Christopher F, Amarasinghe Gaya K", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "28593988", "url": "https://glygen.org/publication/PubMed/28593988" } ] }, { "title": "Dynamic phosphorylation of Ebola virus VP30 in NP-induced inclusion bodies.", "journal": "Virology", "date": "2017-12", "authors": "Lier Clemens, Becker Stephan, Biedenkopf Nadine", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "28915404", "url": "https://glygen.org/publication/PubMed/28915404" } ] }, { "title": "The Ebola virus nucleoprotein recruits the host PP2A-B56 Phosphatase to activate transcriptional support activity of VP30.", "journal": "Mol. Cell", "date": "2018", "authors": "Kruse Thomas, Biedenkopf Nadine, Hertz Emil Peter Thrane, Dietzel Erik, Stalmann Gertrud, L\u00f3pez-M\u00e9ndez Blanca, Davey Norman E, Nilsson Jakob, Becker Stephan", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "29290611", "url": "https://glygen.org/publication/PubMed/29290611" } ] }, { "title": "Sequence analysis of the Ebola virus genome: organization, genetic elements, and comparison with the genome of Marburg virus.", "journal": "Virus Res.", "date": "1993", "authors": "Sanchez A., Auperin D.D., Holloway B.P., Kiley M.P.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "reference": [ { "type": "PubMed", "id": "8237108", "url": "https://glygen.org/publication/PubMed/8237108" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" }, { "name": "positive regulation of viral transcription", "id": "GO:0050434", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050434", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host RNAi-mediated antiviral immune response", "id": "GO:0140533", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140533", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" }, { "name": "symbiont-mediated suppression of host defenses", "id": "GO:0044414", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044414", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" }, { "name": "single-stranded RNA binding", "id": "GO:0003727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003727", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" }, { "name": "viral nucleocapsid", "id": "GO:0019013", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019013", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" }, { "name": "host cell cytoplasm", "id": "GO:0030430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030430", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 117, "end_pos": 119, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by host (PubMed:12052831, PubMed:28915404). Phosphorylation negatively regulates the transcription activation (PubMed:12052831). Phosphorylation and dephosphorylation take place in viral inclusion bodies and are largely influenced by the presence of NP (PubMed:28915404). Dephosphorylated by host PPP2R5C; this dephosphorylation enhances viral transcription and is mediated by NP.", "evidence": [ { "database": "UniProtKB", "id": "Q05323", "url": "https://www.uniprot.org/uniprotkb/Q05323" }, { "database": "PubMed", "id": "12052831", "url": "https://glygen.org/publication/PubMed/12052831" }, { "database": "PubMed", "id": "28915404", "url": "https://glygen.org/publication/PubMed/28915404" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 29 ], "sequon_annotation_sites": [ { "start_pos": 117, "end_pos": 119 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 15 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "Q9YMG2-1", "uniprot_ac": "Q9YMG2", "uniprot_id": "VSSGP_EBOZM", "mass": { "chemical_mass": 33520.0, "monoisotopic_mass": 33520.0 }, "refseq": { "ac": "NP_066248", "name": "second secreted glycoprotein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066248" }, "gene_names": [ { "name": "GP", "type": "recommended", "evidence": [ { "id": "Q9YMG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2" } ] } ], "protein_names": [ { "name": "Super small secreted glycoprotein", "type": "recommended", "evidence": [ { "id": "Q9YMG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2/entry#names_and_taxonomy" } ] }, { "name": "SsGP", "type": "synonym", "evidence": [ { "id": "Q9YMG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2/entry#names_and_taxonomy" } ] }, { "name": "second secreted glycoprotein", "type": "synonym", "evidence": [ { "id": "NP_066248", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066248" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Zaire ebolavirus (strain Mayinga-76)", "taxid": 128952, "evidence": [ { "database": "UniProtKB", "id": "Q9YMG2", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2" } ], "common_name": "Zaire ebolavirus", "glygen_name": "Ebola (EBOV)", "reference_species": "Zaire ebolavirus (strain Mayinga-76) [128952]" } ], "gene": [ { "name": "GP", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2", "locus": {} } ], "crossref": [ { "id": "911829", "url": "https://www.ncbi.nlm.nih.gov/gene/911829", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002561", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002561", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PF01611", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01611", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_066248", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066248", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "Q9YMG2", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q9YMG2-1", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKKPH", "length": 298, "header": "sp|Q9YMG2-1|VSSGP_EBOZM Isoform 1 of Super small secreted glycoprotein OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=GP PE=3 SV=2 CANONICAL=Q9YMG2-1" }, "isoforms": [ { "isoform_ac": "Q9YMG2-1", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2/entry#Q9YMG2-1", "sequence": { "sequence": "MGVTGILQLPRDRFKRTSFFLWVIILFQRTFSIPLGVIHNSTLQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSGVPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDFAFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSSGYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTGKLIWKVNPEIDTTIGEWAFWETKKKPH", "length": 298, "header": "sp|Q9YMG2-1|VSSGP_EBOZM Isoform 1 of Super small secreted glycoprotein OS=Zaire ebolavirus (strain Mayinga-76) OX=128952 GN=GP PE=3 SV=2 CANONICAL=Q9YMG2-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 204, "start_aa": "Asn", "end_pos": 204, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn204", "evidence": [ { "id": "Q9YMG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 228, "start_aa": "Asn", "end_pos": 228, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn228", "evidence": [ { "id": "Q9YMG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 238, "start_aa": "Asn", "end_pos": 238, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn238", "evidence": [ { "id": "Q9YMG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 257, "start_aa": "Asn", "end_pos": 257, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn257", "evidence": [ { "id": "Q9YMG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 268, "start_aa": "Asn", "end_pos": 268, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn268", "evidence": [ { "id": "Q9YMG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "prediction_tool_list": [], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "icn3d_view": {}, "start_pos": 40, "start_aa": "Asn", "end_pos": 40, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn40", "evidence": [ { "id": "Q9YMG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Characterization of the L gene and 5' trailer region of Ebola virus.", "journal": "J. Gen. Virol.", "date": "1999", "authors": "Feldmann H., Volchkov V.E., Blinov V.M., Chepurnov A.A., Netesov S.V., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q9YMG2", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2" } ], "reference": [ { "type": "PubMed", "id": "10073695", "url": "https://glygen.org/publication/PubMed/10073695" } ] }, { "title": "The VP35 and VP40 proteins of filoviruses. Homology between Marburg and Ebola viruses.", "journal": "FEBS Lett.", "date": "1993", "authors": "Volchkov V.E., Blinov V.M., Bukreyev A.A., Netesov S.V.", "evidence": [ { "database": "UniProtKB", "id": "Q9YMG2", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2" } ], "reference": [ { "type": "PubMed", "id": "8482365", "url": "https://glygen.org/publication/PubMed/8482365" } ] }, { "title": "GP mRNA of Ebola virus is edited by the Ebola virus polymerase and by T7 and vaccinia virus polymerases.", "journal": "Virology", "date": "1995", "authors": "Becker S., Volchkov V.E., Klenk H.-D., Kotov A.N., Netesov S.V., Ternovoj V.A., Volchkova V.A.", "evidence": [ { "database": "UniProtKB", "id": "Q9YMG2", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2" } ], "reference": [ { "type": "PubMed", "id": "8553543", "url": "https://glygen.org/publication/PubMed/8553543" } ] }, { "title": "Processing of the Ebola virus glycoprotein by the proprotein convertase furin.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Volchkov V E, Feldmann H, Volchkova V A, Klenk H D", "evidence": [ { "database": "UniProtKB", "id": "Q9YMG2", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2" } ], "reference": [ { "type": "PubMed", "id": "9576958", "url": "https://glygen.org/publication/PubMed/9576958" } ] }, { "title": "Release of viral glycoproteins during Ebola virus infection.", "journal": "Virology", "date": "1998", "authors": "Volchkov V E, Volchkova V A, Slenczka W, Klenk H D, Feldmann H", "evidence": [ { "database": "UniProtKB", "id": "Q9YMG2", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2" } ], "reference": [ { "type": "PubMed", "id": "9614872", "url": "https://glygen.org/publication/PubMed/9614872" } ] }, { "title": "The nonstructural small glycoprotein sGP of Ebola virus is secreted as an antiparallel-orientated homodimer.", "journal": "Virology", "date": "1998", "authors": "Volchkova V A, Feldmann H, Klenk H D, Volchkov V E", "evidence": [ { "database": "UniProtKB", "id": "Q9YMG2", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2" } ], "reference": [ { "type": "PubMed", "id": "9792851", "url": "https://glygen.org/publication/PubMed/9792851" } ] } ], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "Q9YMG2", "url": "https://www.uniprot.org/uniprotkb/Q9YMG2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 228, "end_pos": 230, "annotation": "n_glycosylation_sequon" }, { "start_pos": 238, "end_pos": 240, "annotation": "n_glycosylation_sequon" }, { "start_pos": 257, "end_pos": 259, "annotation": "n_glycosylation_sequon" }, { "start_pos": 268, "end_pos": 270, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [ 40, 204, 228, 238, 257, 268 ], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 204, "end_pos": 206 }, { "start_pos": 228, "end_pos": 230 }, { "start_pos": 238, "end_pos": 240 }, { "start_pos": 257, "end_pos": 259 }, { "start_pos": 268, "end_pos": 270 }, { "start_pos": 40, "end_pos": 42 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_sites", "count": 6 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 6 }, { "field": "exact_n_linked_sites", "count": 6 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] } ]