[ { "uniprot_canonical_ac": "A0ABZ3NNS3-1", "uniprot_ac": "A0ABZ3NNS3", "uniprot_id": "A0ABZ3NNS3_BOVIN", "mass": { "chemical_mass": 50189.0, "monoisotopic_mass": 50189.0 }, "refseq": { "ac": "XP_010806954", "name": "zinc finger protein PLAGL1 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_010806954" }, "gene_names": [ { "name": "PLAGL1", "type": "recommended", "evidence": [ { "id": "A0ABZ3NNS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" } ] }, { "name": "PLAGL1", "type": "synonym", "evidence": [ { "id": "XP_010806954", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_010806954" } ] }, { "name": "ZAC1", "type": "synonym", "evidence": [ { "id": "XP_010806954", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_010806954" } ] } ], "protein_names": [ { "name": "Zinc finger protein PLAGL1", "type": "recommended", "evidence": [ { "id": "A0ABZ3NNS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3/entry#names_and_taxonomy" } ] }, { "name": "Pleiomorphic adenoma-like protein 1", "type": "synonym", "evidence": [ { "id": "A0ABZ3NNS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3/entry#names_and_taxonomy" } ] }, { "name": "zinc finger protein PLAGL1 isoform X1", "type": "synonym", "evidence": [ { "id": "XP_010806954", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_010806954" } ] } ], "function": [ { "annotation": "Acts as a transcriptional activator. Involved in the transcriptional regulation of type 1 receptor for pituitary adenylate cyclase-activating polypeptide.", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3#function" }, { "database": "UniProtKB", "id": "ARBA00059534", "url": "https://www.uniprot.org/uniprotkb/ARBA00059534#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "PLAGL1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3", "locus": { "chromosome": "9", "start_pos": 81363026, "end_pos": 81463029, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000026523", "url": "https://www.ensembl.org/id/ENSBTAG00000026523" } ] } } ], "crossref": [ { "id": "ENSBTAG00000026523", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000026523", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "539761", "url": "https://www.ncbi.nlm.nih.gov/gene/539761", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "F6R951", "url": "https://www.orthodb.org/?gene=F6R951", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24399", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24399", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24399:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24399:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00096", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00096", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_010806954", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_010806954", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABZ3NNS3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6R951", "url": "https://www.uniprot.org/uniprotkb/F6R951", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6R951-1", "url": "https://www.uniprot.org/uniprotkb/F6R951-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATYPCQLCGKMFLTLEKFTIHSYSHSRERPYKCLQPDCGKAFISRYKLMRHMATHSPQKSHRCAYCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYHTMLGYKRHLALHAASSGDLTCGVCALELGSTEVLLDHLKAHAEEKPSTGTKEKKHQCDHCDRCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHPQELMKESLQAGDLLNTLHALSPQFQLKAAPLSPFPIGAPTQNGLAGSLPAEVHTLNALEQAPQPISVLSELLAPLHPMATPSSPPAPLQNHKYSAGSTSYAPLAGLPLKTDTKGFCSANLLEDLPLQEPQSPHKLNAGFDLAKGGAGKVNLPKELAADAVNILPASLDLSPLLGFWQLPPATQNAFGSSGLALGAGESLPHRLGCLGQQPQDPSLAMSTMSLGQLPLPPIPHVFPAGTGSAILPHFHHAFR", "length": 459, "header": "tr|A0ABZ3NNS3-1|A0ABZ3NNS3_BOVIN Isoform 1 of Zinc finger protein PLAGL1 OS=Bos taurus OX=9913 GN=PLAGL1 PE=3 SV=1 CANONICAL=A0ABZ3NNS3-1" }, "isoforms": [ { "isoform_ac": "A0ABZ3NNS3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3/entry#A0ABZ3NNS3-1", "sequence": { "sequence": "MATYPCQLCGKMFLTLEKFTIHSYSHSRERPYKCLQPDCGKAFISRYKLMRHMATHSPQKSHRCAYCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYHTMLGYKRHLALHAASSGDLTCGVCALELGSTEVLLDHLKAHAEEKPSTGTKEKKHQCDHCDRCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHPQELMKESLQAGDLLNTLHALSPQFQLKAAPLSPFPIGAPTQNGLAGSLPAEVHTLNALEQAPQPISVLSELLAPLHPMATPSSPPAPLQNHKYSAGSTSYAPLAGLPLKTDTKGFCSANLLEDLPLQEPQSPHKLNAGFDLAKGGAGKVNLPKELAADAVNILPASLDLSPLLGFWQLPPATQNAFGSSGLALGAGESLPHRLGCLGQQPQDPSLAMSTMSLGQLPLPPIPHVFPAGTGSAILPHFHHAFR", "length": 459, "header": "tr|A0ABZ3NNS3-1|A0ABZ3NNS3_BOVIN Isoform 1 of Zinc finger protein PLAGL1 OS=Bos taurus OX=9913 GN=PLAGL1 PE=3 SV=1 CANONICAL=A0ABZ3NNS3-1" }, "locus": { "chromosome": "9", "start_pos": 81369299, "end_pos": 81364391, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000071595.3", "url": "https://www.ensembl.org/id/ENSBTAT00000071595.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000073113.3", "url": "https://www.ensembl.org/id/ENSBTAP00000073113.3" } ] } }, { "isoform_ac": "F6R951-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3/entry#F6R951-1", "sequence": { "sequence": "MATHSPQKSHRCAYCEKTFNRKDHLKNHLQTHDPNKMAFGCEECGKKYHTMLGYKRHLALHAASSGDLTCGVCALELGSTEVLLDHLKAHAEEKPSTGTKEKKHQCDHCDRCFYTRKDVRRHLVVHTGCKDFLCQFCAQRFGRKDHLTRHTKKTHPQELMKESLQAGDLLNTLHALSPQFQLKAAPLSPFPIGAPTQNGLAGSLPAEVHTLNALEQAPQPISVLSELLAPLHPMATPSSPPAPLQNHKYSAGSTSYAPLAGLPLKTDTKGFCSANLLEDLPLQEPQSPHKLNAGFDLAKGGAGKVNLPKELAADAVNILPASLDLSPLLGFWQLPPATQNAFGSSGLALGAGESLPHRLGCLGQQPQDPSLAMSTMSLGQLPLPPIPHVFPAGTGSAILPHFHHAFR", "length": 407, "header": "tr|F6R951-1|A0ABZ3NNS3_BOVIN Computationally mapped isoform of Zinc finger protein PLAGL1 OS=Bos taurus OX=9913 GN=PLAGL1 PE=3 SV=1 CANONICAL=A0ABZ3NNS3-1" }, "locus": { "chromosome": "9", "start_pos": 81365611, "end_pos": 81364391, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000037724.7", "url": "https://www.ensembl.org/id/ENSBTAT00000037724.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000037548.4", "url": "https://www.ensembl.org/id/ENSBTAP00000037548.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 288, "start_aa": "Thr", "end_pos": 288, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr288", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nuclear body", "id": "GO:0016604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS3", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABZ3NNS3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS3" }, { "id": "PS50157", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50157" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "C2H2-type", "eco_id": "ECO_0000259", "start_pos": 4, "end_pos": 31, "start_aa": "Tyr", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 288 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5V6-1", "uniprot_ac": "A0ABI0P5V6", "uniprot_id": "A0ABI0P5V6_BOVIN", "mass": { "chemical_mass": 35537.0, "monoisotopic_mass": 35537.0 }, "refseq": {}, "gene_names": [ { "name": "LOC132345669", "type": "recommended", "evidence": [ { "id": "A0ABI0P5V6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6" } ] } ], "protein_names": [ { "name": "Phosphatidylinositol-specific phospholipase C X domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5V6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5V6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC132345669", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6", "locus": {} } ], "crossref": [ { "id": "ENSBTAG00000035144", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000035144", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08616", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08616", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000909", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000909", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017946", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017946", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042158", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042158", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR13593", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13593", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13593:SF24", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13593:SF24", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF26146", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF26146", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5V6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5V6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H9GW45", "url": "https://www.uniprot.org/uniprotkb/H9GW45", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H9GW45-1", "url": "https://www.uniprot.org/uniprotkb/H9GW45-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSALNSQLWDVPLHQLSIPGSHDTMTYCLNKKSPISSKEPRLLHLLCKVLPCVTLPMVLKWSTTQVLSVTEQLDAGVRYLDLRIAHVEDGSERNLHFVHMVYTTALVEDTLTEISEWLQSHPREVVILACRNFEGMTEDLHEYLVGCIKNIFGDMLCPRGEVPTLRQLWSRGQQVILSYEDEASVSRHTELWPGIPYWWGNKVKPQDLVNYLELMKSHGRPAIIGATTRPTSPPHAPQLRSRQPHAEGEGPSPRGSQDGVLHPGHQLIQPEPQKGRHGQDVGLHGFLMHWENMDKREVTTEGFISEILHFKEP", "length": 313, "header": "tr|A0ABI0P5V6-1|A0ABI0P5V6_BOVIN Isoform 1 of Phosphatidylinositol-specific phospholipase C X domain-containing protein OS=Bos taurus OX=9913 GN=LOC132345669 PE=4 SV=1 CANONICAL=A0ABI0P5V6-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5V6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6/entry#A0ABI0P5V6-1", "sequence": { "sequence": "MSALNSQLWDVPLHQLSIPGSHDTMTYCLNKKSPISSKEPRLLHLLCKVLPCVTLPMVLKWSTTQVLSVTEQLDAGVRYLDLRIAHVEDGSERNLHFVHMVYTTALVEDTLTEISEWLQSHPREVVILACRNFEGMTEDLHEYLVGCIKNIFGDMLCPRGEVPTLRQLWSRGQQVILSYEDEASVSRHTELWPGIPYWWGNKVKPQDLVNYLELMKSHGRPAIIGATTRPTSPPHAPQLRSRQPHAEGEGPSPRGSQDGVLHPGHQLIQPEPQKGRHGQDVGLHGFLMHWENMDKREVTTEGFISEILHFKEP", "length": 313, "header": "tr|A0ABI0P5V6-1|A0ABI0P5V6_BOVIN Isoform 1 of Phosphatidylinositol-specific phospholipase C X domain-containing protein OS=Bos taurus OX=9913 GN=LOC132345669 PE=4 SV=1 CANONICAL=A0ABI0P5V6-1" }, "locus": { "chromosome": "1", "start_pos": 88356337, "end_pos": 88341140, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000148555.1", "url": "https://www.ensembl.org/id/ENSBTAT00000148555.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106596.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106596.1" } ] } }, { "isoform_ac": "H9GW45-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6/entry#H9GW45-1", "sequence": { "sequence": "MSALNSQLWDVPLHQLSIPGSHDTMTYCLNKKSPISSKEPRLLHLLCKVLPCVTLPMVLKWSTTQVLSVTEQLDAGVRYLDLRIAHVEDGSERNLHFVHMVYTTALVEDTLTEISEWLQSHPREVVILACRNFEGMTEDLHEYLVGCIKNIFGDMLCPRGEVPTLRQLWSRGQQVILSYEDEASVSRHTELWPGIPYWWGNKVKPQDLVNYLELMKSHGRPGGLFVAGINLTENLEFILVHPAWSLEKLTLSGLPYLCAWVRAQCPGSAAGCTNIIAGDFIGASGFVSDVIGLNQKLLRG", "length": 300, "header": "tr|H9GW45-1|A0ABI0P5V6_BOVIN Computationally mapped isoform of Phosphatidylinositol-specific phospholipase C X domain-containing protein OS=Bos taurus OX=9913 GN=LOC132345669 PE=4 SV=3 CANONICAL=A0ABI0P5V6-1" }, "locus": { "chromosome": "1", "start_pos": 88349777, "end_pos": 88341140, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000066297.4", "url": "https://www.ensembl.org/id/ENSBTAT00000066297.4" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000056605.3", "url": "https://www.ensembl.org/id/ENSBTAP00000056605.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5V6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "phosphoric diester hydrolase activity", "id": "GO:0008081", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008081", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5V6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5V6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V6" }, { "id": "SM00148", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM00148" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Phosphatidylinositol-specific phospholipase C X", "eco_id": "ECO_0000259", "start_pos": 7, "end_pos": 180, "start_aa": "Gln", "end_aa": "Glu", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5S5-1", "uniprot_ac": "A0ABI0P5S5", "uniprot_id": "A0ABI0P5S5_BOVIN", "mass": { "chemical_mass": 88790.0, "monoisotopic_mass": 88790.0 }, "refseq": {}, "gene_names": [ { "name": "ARNT", "type": "recommended", "evidence": [ { "id": "A0ABI0P5S5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ] } ], "protein_names": [ { "name": "Aryl hydrocarbon receptor nuclear translocator", "type": "recommended", "evidence": [ { "id": "A0ABI0P5S5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Required for activity of the AHR. Upon ligand binding, AHR translocates into the nucleus, where it heterodimerizes with ARNT and induces transcription by binding to xenobiotic response elements (XRE). Not required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex initiates transcription of genes involved in the regulation of a variety of biological processes, including angiogenesis, hematopoiesis, drug and lipid metabolism, cell motility and immune modulation. The heterodimer binds to core DNA sequence 5'-TACGTG-3' within the hypoxia response element (HRE) of target gene promoters and functions as a transcriptional regulator of the adaptive response to hypoxia. The heterodimer ARNT:AHR binds to core DNA sequence 5'-TGCGTG-3' within the dioxin response element (DRE) of target gene promoters and activates their transcription.", "evidence": [ { "database": "UniProtKB", "id": "F1MYI1", "url": "https://www.uniprot.org/uniprotkb/F1MYI1#function" }, { "database": "UniProtKB", "id": "ARBA00045949", "url": "https://www.uniprot.org/uniprotkb/ARBA00045949#function" }, { "database": "UniProtKB", "id": "A0A3Q1LKX3", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LKX3#function" }, { "database": "UniProtKB", "id": "A0A3Q1N1D6", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1N1D6#function" }, { "database": "UniProtKB", "id": "A0ABI0NLJ0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLJ0#function" }, { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "ARNT", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5", "locus": { "chromosome": "3", "start_pos": 19950924, "end_pos": 19884977, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000021037", "url": "https://www.ensembl.org/id/ENSBTAG00000021037" } ] } } ], "crossref": [ { "id": "ENSBTAG00000021037", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000021037", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00130", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00130", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd18947", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd18947", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000014", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000014", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001067", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001067", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001610", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001610", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013767", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013767", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035965", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035965", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036638", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036638", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050933", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050933", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23042", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23042", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00010", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00010", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF00989", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00989", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF14598", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF14598", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-1234158", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-1234158", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-211945", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-211945", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-211976", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-211976", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-211981", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-211981", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-8937144", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-8937144", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9768919", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A3Q1LKX3", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LKX3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LKX3-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LKX3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1N1D6", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1N1D6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1N1D6-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1N1D6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NLJ0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLJ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NLJ0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLJ0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5S5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MYI1", "url": "https://www.uniprot.org/uniprotkb/F1MYI1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MYI1-1", "url": "https://www.uniprot.org/uniprotkb/F1MYI1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDCSTPGFSVHHQLPEPAQTHVHRVEMTSDVPPLGPAIASGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDSVSMNRLSFVRNRCRNGLGSAKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPSLSNTIQRPQLGPTANLSLEMGSGQLAPRQQQQQTELDVVPGRDGLTSYNHSQVSVQPVTTTGPEHSKPLEKSESLFAQDRDPRFSEIYSNISTDQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSTSAGQMLAQISRHSNPTQGAAPAWTPSTRPGFSAQQVVTQATAKTRSSQFGVGSFQTPSSFSPMSLPGASTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQSHHRSSSNEQHVQQPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPSFSE", "length": 807, "header": "tr|A0ABI0P5S5-1|A0ABI0P5S5_BOVIN Isoform 1 of Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus OX=9913 GN=ARNT PE=4 SV=1 CANONICAL=A0ABI0P5S5-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1LKX3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5/entry#A0A3Q1LKX3-1", "sequence": { "sequence": "MAATAANPEMTSDVPPLGPAIASGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDSVSMNRLSFVRNRCRNGLGSAKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPSLSNTIQRPQLGPTANLSLEMGSGQLAPRQQQQQTELDVVPGRDGLTSYNHSQVSVQPVTTTGPEHSKPLEKSESLFAQDRDPRFSEIYSNISTDQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSTSAGQMLAQISRHSNPTQGAAPAWTPSTRPGFSAQQVVTQATAKTRSSQFGVGSFQTPSSFSPMSLPGASTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQSHHRSSSNEQHVQQPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPSFSE", "length": 775, "header": "tr|A0A3Q1LKX3-1|A0ABI0P5S5_BOVIN Computationally mapped isoform of Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus OX=9913 GN=ARNT PE=4 SV=3 CANONICAL=A0ABI0P5S5-1" }, "locus": { "chromosome": "3", "start_pos": 19949920, "end_pos": 19885237, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000077897.3", "url": "https://www.ensembl.org/id/ENSBTAT00000077897.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000060357.3", "url": "https://www.ensembl.org/id/ENSBTAP00000060357.3" } ] } }, { "isoform_ac": "A0A3Q1N1D6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5/entry#A0A3Q1N1D6-1", "sequence": { "sequence": "MCLASAQLWNTARCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDSVSMNRLSFVRNRCRNGLGSAKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPSLSNTIQRPQLGPTANLSLEMGSGQLAPRQQQQQTELDVVPGRDGLTSYNHSQVSVQPVTTTGPEHSKPLEKSESLFAQDRDPRFSEIYSNISTDQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSTSAGQMLAQISRHSNPTQGAAPAWTPSTRPGFSAQQVVTQATAKTRSSQFGVGSFQTPSSFSPMSLPGASTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQSHHRSSSNEQHVQQPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPSFSE", "length": 742, "header": "tr|A0A3Q1N1D6-1|A0ABI0P5S5_BOVIN Computationally mapped isoform of Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus OX=9913 GN=ARNT PE=4 SV=2 CANONICAL=A0ABI0P5S5-1" }, "locus": { "chromosome": "3", "start_pos": 19949920, "end_pos": 19919670, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000079959.3", "url": "https://www.ensembl.org/id/ENSBTAT00000079959.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000062834.2", "url": "https://www.ensembl.org/id/ENSBTAP00000062834.2" } ] } }, { "isoform_ac": "A0ABI0NLJ0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5/entry#A0ABI0NLJ0-1", "sequence": { "sequence": "MAATAANPEMTSDVPPLGPAIASGNPGPGIQGGGAIVQRAIKRRPGCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDSVSMNRLSFVRNRCRNGLGSAKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPSLSNTIQRPQLGPTANLSLEMGSGQLAPRQQQQQTELDVVPGRDGLTSYNHSQVSVQPVTTTGPEHSKPLEKSESLFAQDRDPRFSEIYSNISTDQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSTSAGQMLAQISRHSNPTQGAAPAWTPSTRPGFSAQQVVTQATAKTRSSQFGVGSFQTPSSFSPMSLPGASTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQSHHRSSSNEQHVQQPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPSFSE", "length": 775, "header": "tr|A0ABI0NLJ0-1|A0ABI0P5S5_BOVIN Computationally mapped isoform of Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus OX=9913 GN=ARNT PE=4 SV=1 CANONICAL=A0ABI0P5S5-1" }, "locus": { "chromosome": "3", "start_pos": 19949920, "end_pos": 19885237, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000143678.1", "url": "https://www.ensembl.org/id/ENSBTAT00000143678.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000105958.1", "url": "https://www.ensembl.org/id/ENSBTAP00000105958.1" } ] } }, { "isoform_ac": "A0ABI0P5S5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5/entry#A0ABI0P5S5-1", "sequence": { "sequence": "MDCSTPGFSVHHQLPEPAQTHVHRVEMTSDVPPLGPAIASGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDSVSMNRLSFVRNRCRNGLGSAKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPSLSNTIQRPQLGPTANLSLEMGSGQLAPRQQQQQTELDVVPGRDGLTSYNHSQVSVQPVTTTGPEHSKPLEKSESLFAQDRDPRFSEIYSNISTDQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSTSAGQMLAQISRHSNPTQGAAPAWTPSTRPGFSAQQVVTQATAKTRSSQFGVGSFQTPSSFSPMSLPGASTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQSHHRSSSNEQHVQQPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPSFSE", "length": 807, "header": "tr|A0ABI0P5S5-1|A0ABI0P5S5_BOVIN Isoform 1 of Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus OX=9913 GN=ARNT PE=4 SV=1 CANONICAL=A0ABI0P5S5-1" }, "locus": { "chromosome": "3", "start_pos": 19949920, "end_pos": 19909655, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000137107.1", "url": "https://www.ensembl.org/id/ENSBTAT00000137107.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106654.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106654.1" } ] } }, { "isoform_ac": "F1MYI1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5/entry#F1MYI1-1", "sequence": { "sequence": "MAATAANPEMTSDVPPLGPAIASGNPGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDSVSMNRLSFVRNRCRNGLGSAKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPSLSNTIQRPQLGPTANLSLEMGSGQLAPRQQQQQTELDVVPGRDGLTSYNHSQVSVQPVTTTGPEHSKPLEKSESLFAQDRDPRFSEIYSNISTDQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLAPPVTIVQPSTSAGQMLAQISRHSNPTQGAAPAWTPSTRPGFSAQQVVTQATAKTRSSQFGVGSFQTPSSFSPMSLPGASTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQSHHRSSSNEQHVQQPSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPSFSE", "length": 790, "header": "tr|F1MYI1-1|A0ABI0P5S5_BOVIN Computationally mapped isoform of Aryl hydrocarbon receptor nuclear translocator OS=Bos taurus OX=9913 GN=ARNT PE=4 SV=5 CANONICAL=A0ABI0P5S5-1" }, "locus": { "chromosome": "3", "start_pos": 19949920, "end_pos": 19885237, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000028023.8", "url": "https://www.ensembl.org/id/ENSBTAT00000028023.8" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000028023.8", "url": "https://www.ensembl.org/id/ENSBTAP00000028023.8" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-BTA-1234158", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-1234158", "resource": "Reactome", "description": "Regulation of gene expression by Hypoxia-inducible Factor" }, { "id": "R-BTA-211945", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-211945", "resource": "Reactome", "description": "Phase I - Functionalization of compounds" }, { "id": "R-BTA-211976", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-211976", "resource": "Reactome", "description": "Endogenous sterols" }, { "id": "R-BTA-211981", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-211981", "resource": "Reactome", "description": "Xenobiotics" }, { "id": "R-BTA-8937144", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-8937144", "resource": "Reactome", "description": "Aryl hydrocarbon receptor signalling" }, { "id": "R-BTA-9768919", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9768919", "resource": "Reactome", "description": "NPAS4 regulates expression of target genes" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" }, { "name": "aryl hydrocarbon receptor complex", "id": "GO:0034751", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034751", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" }, { "name": "transcription regulator complex", "id": "GO:0005667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005667", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" }, { "name": "response to hypoxia", "id": "GO:0001666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001666", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" }, { "start_pos": 164, "end_pos": 166, "annotation": "n_glycosylation_sequon" }, { "start_pos": 288, "end_pos": 290, "annotation": "n_glycosylation_sequon" }, { "start_pos": 367, "end_pos": 369, "annotation": "n_glycosylation_sequon" }, { "start_pos": 483, "end_pos": 485, "annotation": "n_glycosylation_sequon" }, { "start_pos": 506, "end_pos": 508, "annotation": "n_glycosylation_sequon" }, { "start_pos": 540, "end_pos": 542, "annotation": "n_glycosylation_sequon" }, { "start_pos": 581, "end_pos": 583, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5S5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" }, { "id": "PS50888", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50888" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "BHLH", "eco_id": "ECO_0000259", "start_pos": 106, "end_pos": 159, "start_aa": "Leu", "end_aa": "Leu", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P5S5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S5" }, { "id": "PS50112", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50112" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "PAS", "eco_id": "ECO_0000259", "start_pos": 178, "end_pos": 252, "start_aa": "Asp", "end_aa": "Arg", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 110, "end_pos": 112 }, { "start_pos": 164, "end_pos": 166 }, { "start_pos": 288, "end_pos": 290 }, { "start_pos": 367, "end_pos": 369 }, { "start_pos": 483, "end_pos": 485 }, { "start_pos": 506, "end_pos": 508 }, { "start_pos": 540, "end_pos": 542 }, { "start_pos": 581, "end_pos": 583 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABZ3NNS0-1", "uniprot_ac": "A0ABZ3NNS0", "uniprot_id": "A0ABZ3NNS0_BOVIN", "mass": { "chemical_mass": 42503.0, "monoisotopic_mass": 42503.0 }, "refseq": { "ac": "NP_001030389", "name": "eukaryotic translation initiation factor 3 subunit M", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030389" }, "gene_names": [ { "name": "EIF3M", "type": "recommended", "evidence": [ { "id": "A0ABZ3NNS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ] }, { "name": "EIF3M", "type": "synonym", "evidence": [ { "id": "NP_001030389", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030389" } ] }, { "name": "HFL-B5", "type": "synonym", "evidence": [ { "id": "NP_001030389", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030389" } ] } ], "protein_names": [ { "name": "Eukaryotic translation initiation factor 3 subunit M", "type": "recommended", "evidence": [ { "id": "A0ABZ3NNS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0/entry#names_and_taxonomy" } ] }, { "name": "dendritic cell protein", "type": "synonym", "evidence": [ { "id": "NP_001030389", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030389" } ] }, { "name": "eIF3m", "type": "synonym", "evidence": [ { "id": "A0ABZ3NNS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0/entry#names_and_taxonomy" } ] }, { "name": "eukaryotic translation initiation factor 3 subunit M", "type": "synonym", "evidence": [ { "id": "NP_001030389", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030389" } ] } ], "function": [ { "annotation": "Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression.", "evidence": [ { "database": "UniProtKB", "id": "A0AAA9TMW1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TMW1#function" }, { "database": "HAMAP", "id": "MF_03012", "url": "https://hamap.expasy.org/signature/MF_03012" }, { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "EIF3M", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0", "locus": { "chromosome": "15", "start_pos": 63317185, "end_pos": 63298858, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000005338", "url": "https://www.ensembl.org/id/ENSBTAG00000005338" } ] } } ], "crossref": [ { "id": "ENSBTAG00000005338", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000005338", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "515543", "url": "https://www.ncbi.nlm.nih.gov/gene/515543", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000717", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000717", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027528", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027528", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040750", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040750", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045237", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045237", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:515543", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:515543", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VCLKALW", "url": "https://omabrowser.org/oma/group/VCLKALW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "F1N5F7", "url": "https://www.orthodb.org/?gene=F1N5F7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15350", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15350", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15350:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15350:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01399", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01399", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF18005", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF18005", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-156827", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-156827", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-72649", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-72649", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-72689", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-72689", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-72695", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-72695", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-72702", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-72702", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "NP_001030389", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030389", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0AAA9SHF3", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SHF3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SHF3-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SHF3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9TMW1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TMW1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9TMW1-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TMW1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABZ3NNS0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1N5F7", "url": "https://www.uniprot.org/uniprotkb/F1N5F7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1N5F7-1", "url": "https://www.uniprot.org/uniprotkb/F1N5F7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT", "length": 374, "header": "tr|A0ABZ3NNS0-1|A0ABZ3NNS0_BOVIN Isoform 1 of Eukaryotic translation initiation factor 3 subunit M OS=Bos taurus OX=9913 GN=EIF3M PE=3 SV=1 CANONICAL=A0ABZ3NNS0-1" }, "isoforms": [ { "isoform_ac": "A0AAA9SHF3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0/entry#A0AAA9SHF3-1", "sequence": { "sequence": "MSVPAFIDISEEDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT", "length": 242, "header": "tr|A0AAA9SHF3-1|A0ABZ3NNS0_BOVIN Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit M OS=Bos taurus OX=9913 GN=EIF3M PE=3 SV=1 CANONICAL=A0ABZ3NNS0-1" }, "locus": { "chromosome": "15", "start_pos": 63316222, "end_pos": 63298946, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000093912.2", "url": "https://www.ensembl.org/id/ENSBTAT00000093912.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000083342.1", "url": "https://www.ensembl.org/id/ENSBTAP00000083342.1" } ] } }, { "isoform_ac": "A0AAA9TMW1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0/entry#A0AAA9TMW1-1", "sequence": { "sequence": "LNYPCYIDLKQSYLIQQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT", "length": 377, "header": "tr|A0AAA9TMW1-1|A0ABZ3NNS0_BOVIN Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit M OS=Bos taurus OX=9913 GN=EIF3M PE=3 SV=1 CANONICAL=A0ABZ3NNS0-1" }, "locus": { "chromosome": "15", "start_pos": 63316222, "end_pos": 63300807, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000124310.2", "url": "https://www.ensembl.org/id/ENSBTAT00000124310.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000098580.1", "url": "https://www.ensembl.org/id/ENSBTAP00000098580.1" } ] } }, { "isoform_ac": "A0ABZ3NNS0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0/entry#A0ABZ3NNS0-1", "sequence": { "sequence": "MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT", "length": 374, "header": "tr|A0ABZ3NNS0-1|A0ABZ3NNS0_BOVIN Isoform 1 of Eukaryotic translation initiation factor 3 subunit M OS=Bos taurus OX=9913 GN=EIF3M PE=3 SV=1 CANONICAL=A0ABZ3NNS0-1" }, "locus": { "chromosome": "15", "start_pos": 63316222, "end_pos": 63298946, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000109960.2", "url": "https://www.ensembl.org/id/ENSBTAT00000109960.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000085849.2", "url": "https://www.ensembl.org/id/ENSBTAP00000085849.2" } ] } }, { "isoform_ac": "F1N5F7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0/entry#F1N5F7-1", "sequence": { "sequence": "MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDVIAHIGHLENSSGSNSMTHLMPGNKI", "length": 340, "header": "tr|F1N5F7-1|A0ABZ3NNS0_BOVIN Computationally mapped isoform of Eukaryotic translation initiation factor 3 subunit M OS=Bos taurus OX=9913 GN=EIF3M PE=3 SV=3 CANONICAL=A0ABZ3NNS0-1" }, "locus": { "chromosome": "15", "start_pos": 63316181, "end_pos": 63298946, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000007021.6", "url": "https://www.ensembl.org/id/ENSBTAT00000007021.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000007021.5", "url": "https://www.ensembl.org/id/ENSBTAP00000007021.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:515543", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:515543", "resource": "KEGG Pathway" }, { "id": "R-BTA-156827", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-156827", "resource": "Reactome", "description": "L13a-mediated translational silencing of Ceruloplasmin expression" }, { "id": "R-BTA-72649", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-72649", "resource": "Reactome", "description": "Translation initiation complex formation" }, { "id": "R-BTA-72689", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-72689", "resource": "Reactome", "description": "Formation of a pool of free 40S subunits" }, { "id": "R-BTA-72695", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-72695", "resource": "Reactome", "description": "Formation of the ternary complex, and subsequently, the 43S complex" }, { "id": "R-BTA-72702", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-72702", "resource": "Reactome", "description": "Ribosomal scanning and start codon recognition" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZAZ0-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit M", "gene_name": "Eif3m", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWKLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLFKCKRVCGGYSGLPWS", "length": 366 }, "evidence": [ { "id": "A0ABZ3NNS0", "url": "https://omabrowser.org/oma/group/A0ABZ3NNS0/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "F1SGR0-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit M", "gene_name": "EIF3M", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLNTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT", "length": 374 }, "evidence": [ { "id": "A0ABZ3NNS0", "url": "https://omabrowser.org/oma/group/A0ABZ3NNS0/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "Q54KZ8-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit M", "gene_name": "eif3m", "tax_id": 44689, "organism": "Dictyostelium discoideum", "sequence": { "sequence": "MTIFIDLASLEDLYNDLISHIETLRKKKGSEYSVADYQILIGEQRTVEFLSKIVSNETEFLFKECKDSDKDIEGFFNVILTILHKLENEDEINIVSQKIRDSLSAHPTENSQLKIKILTNLFNSFQPKSTQRYDIFFALVKLASDSNNLEFVKYQITDIDSWLEDWNVSIQQKRKLYKLISNIFKEKQRMLSHQFLVKYLQTFTKEDSQEAQEDAVRVCIESISLQELYQSDYLLDLPAVQYLEGSTVSANSLTYELMKIFATEQLDSFLQFQQKNPNFLSTIGLSNDDCLQKIRLLSLATLTSEQSKVPYSLISKMLQIDENEVEMWVINAMEGDLLDAKLDQLNRIVNVNSSTQRVFNKSQWSQLGQRFSVWKSSVKNLLQVIENAKTTQVKPFYFQTR", "length": 401 }, "evidence": [ { "id": "A0ABZ3NNS0", "url": "https://omabrowser.org/oma/group/A0ABZ3NNS0/", "database": "OMA" } ], "glygen_name": "Cellular slime mold", "common_name": "Social amoeba" }, { "uniprot_canonical_ac": "Q5ZJ64-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit M", "gene_name": "EIF3M", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MSVPAFIDITEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEVCDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLLKVASSCGAIQYIPTELDQVRKWISDWNLSTDKKHTLLRLLYDVLVDCKKSDTAAKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNTFLFDHLLALKPVKFLEGELIHDLLTIFVSAKLVSYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVKTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNTWKQNLNQVKNSLLSLSDT", "length": 374 }, "evidence": [ { "id": "A0ABZ3NNS0", "url": "https://omabrowser.org/oma/group/A0ABZ3NNS0/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "Q7JVI3-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit M", "gene_name": "eIF3m", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MTSHPVFIDLSLDEQVQELRKYFKKLGAEISSEKSNKGVEDDLHKIIGVCDVCFKDGEPSQIDGILNSIVSIMITIPLDRGENIVLAYCEKMTKAPNLPLGKVCLQSLWRLFNNLDTASPLRYHVYYHLVQVAKQCEQVLEVFSGVDQLKSQFANCPPSSEQMQKLYRLLHDVTKDTNLELSSKVMIELLGTYTADNACVAREDAMKCIVTALADPNTFLLDPLLSLKPVRFLEGDLIHDLLSIFVSEKLPAYVQFYEDHREFVNSQGLNHEQNMKKMRLLTFMQLAESSPEMTFETLTKELQINEDEVEPFVIEVLKTKLVRARLDQANQKVHISSTMHRTFGAPQWEQLRDLLQAWKENLSTVREGLTSVSSAQLDLARSQKLIH", "length": 387 }, "evidence": [ { "id": "A0ABZ3NNS0", "url": "https://omabrowser.org/oma/group/A0ABZ3NNS0/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q7L2H7-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit M", "gene_name": "EIF3M", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT", "length": 374 }, "evidence": [ { "id": "A0ABZ3NNS0", "url": "https://omabrowser.org/oma/group/A0ABZ3NNS0/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q7T3B0-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit M", "gene_name": "eif3m", "tax_id": 7955, "organism": "Danio rerio", "sequence": { "sequence": "MSVPAFIDITEEDQASELRSYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKDDDKDVESVMNSIVSLLLILETEKQEALIESLCEKLVKFREGERPSLRMQLLSNLFHGMDENTPVRHTVYCSLIKVAATCNAITFMPTDLDQVRKWIVDWNLNTEKKHTLLRLVYEALVDCKKSEAAAKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNTYLFDHLLALKPVRFLEGELIHDLLTIFVSAKLISYVKFYQSNKDFIESLGLSHEQNMSKMRLLTFMGMAVEMKEISFETMQQELQIGAEDVEAFVIDAVRTKMVYSKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLCSWKQNLSTVKSSLQTLSPTA", "length": 375 }, "evidence": [ { "id": "A0ABZ3NNS0", "url": "https://omabrowser.org/oma/group/A0ABZ3NNS0/", "database": "OMA" } ], "glygen_name": "Zebrafish", "common_name": "Zebrafish" }, { "uniprot_canonical_ac": "Q99JX4-1", "protein_name": "Eukaryotic translation initiation factor 3 subunit M", "gene_name": "Eif3m", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSVPAFIDISEEDQAAELRAYLKSKGAELSEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWKLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT", "length": 374 }, "evidence": [ { "id": "A0ABZ3NNS0", "url": "https://omabrowser.org/oma/group/A0ABZ3NNS0/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ], "pmid": "" }, { "name": "eukaryotic 43S preinitiation complex", "id": "GO:0016282", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016282", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ], "pmid": "" }, { "name": "eukaryotic 48S preinitiation complex", "id": "GO:0033290", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033290", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ], "pmid": "" }, { "name": "eukaryotic translation initiation factor 3 complex, eIF3m", "id": "GO:0071541", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071541", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ], "pmid": "" }, { "name": "eukaryotic translation initiation factor 3 complex", "id": "GO:0005852", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005852", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "translation initiation factor activity", "id": "GO:0003743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003743", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "formation of cytoplasmic translation initiation complex", "id": "GO:0001732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001732", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ], "pmid": "" }, { "name": "cytoplasmic translational initiation", "id": "GO:0002183", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002183", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNS0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 155, "end_pos": 157, "annotation": "n_glycosylation_sequon" }, { "start_pos": 196, "end_pos": 198, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABZ3NNS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNS0" }, { "id": "PS50250", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50250" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "PCI", "eco_id": "ECO_0000259", "start_pos": 180, "end_pos": 339, "start_aa": "Ala", "end_aa": "His", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 155, "end_pos": 157 }, { "start_pos": 196, "end_pos": 198 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7D0-1", "uniprot_ac": "A0ABI0P7D0", "uniprot_id": "A0ABI0P7D0_BOVIN", "mass": { "chemical_mass": 59397.0, "monoisotopic_mass": 59397.0 }, "refseq": {}, "gene_names": [ { "name": "POFUT2", "type": "recommended", "evidence": [ { "id": "A0ABI0P7D0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0" } ] } ], "protein_names": [ { "name": "GDP-fucose protein O-fucosyltransferase 2", "type": "recommended", "evidence": [ { "id": "A0ABI0P7D0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0/entry#names_and_taxonomy" } ] }, { "name": "2.4.1.221", "type": "synonym", "evidence": [ { "id": "A0ABI0P7D0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0/entry#names_and_taxonomy" } ] }, { "name": "Peptide-O-fucosyltransferase 2", "type": "synonym", "evidence": [ { "id": "A0ABI0P7D0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "POFUT2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0", "locus": { "chromosome": "1", "start_pos": 145089427, "end_pos": 145103228, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000007818", "url": "https://www.ensembl.org/id/ENSBTAG00000007818" } ] } } ], "crossref": [ { "id": "ENSBTAG00000007818", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000007818", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd11298", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11298", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR019378", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019378", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045130", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045130", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "RNAVWPI", "url": "https://omabrowser.org/oma/group/RNAVWPI/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "F1MPI4", "url": "https://www.orthodb.org/?gene=F1MPI4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "F1MXU9", "url": "https://www.orthodb.org/?gene=F1MXU9", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13398", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13398", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13398:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13398:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10250", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF10250", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-5173214", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5173214", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "63644", "url": "https://www.rhea-db.org/rhea/63644", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "70491", "url": "https://www.rhea-db.org/rhea/70491", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0ABI0P7D0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7D0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MPI4", "url": "https://www.uniprot.org/uniprotkb/F1MPI4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MPI4-1", "url": "https://www.uniprot.org/uniprotkb/F1MPI4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MXU9", "url": "https://www.uniprot.org/uniprotkb/F1MXU9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MXU9-1", "url": "https://www.uniprot.org/uniprotkb/F1MXU9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGLRITHDACAGWAPWRCRGYGRRSPRGRAALPGWGEATGSAWPPGAMAALAVVFLLLWAASWPSASAFGEEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSDFFDLPSLNRNIPVIEYEQFIAESGGPFIDQVYILQGYTEGWKEGAWEEKIDSRPCIEPPLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIIAPVLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLRAVGDEFRSRYLNSTDVADGIPFEEDWTRMKVKLGSSLGGPYLGVHLRRKDFIWGHREDVPTSWTRCSWPQMLSGRSWRSCGGCCLRWCGSNPRGRSWSSTRMGAWPSWTSGSVRTPGFLSAHQSPRSPFEFTRRGRSWAWTPRQHTTGSAGTRRRRVSSPLIGGLHTEPTRLPEDTCPLPDLRLWTPRSGAVHRLSPVVCLSAGTSASPGLGLLSLGIHLEARVCSQRGPR", "length": 526, "header": "tr|A0ABI0P7D0-1|A0ABI0P7D0_BOVIN Isoform 1 of GDP-fucose protein O-fucosyltransferase 2 OS=Bos taurus OX=9913 GN=POFUT2 PE=3 SV=1 CANONICAL=A0ABI0P7D0-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7D0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0/entry#A0ABI0P7D0-1", "sequence": { "sequence": "MSGLRITHDACAGWAPWRCRGYGRRSPRGRAALPGWGEATGSAWPPGAMAALAVVFLLLWAASWPSASAFGEEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSDFFDLPSLNRNIPVIEYEQFIAESGGPFIDQVYILQGYTEGWKEGAWEEKIDSRPCIEPPLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIIAPVLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLRAVGDEFRSRYLNSTDVADGIPFEEDWTRMKVKLGSSLGGPYLGVHLRRKDFIWGHREDVPTSWTRCSWPQMLSGRSWRSCGGCCLRWCGSNPRGRSWSSTRMGAWPSWTSGSVRTPGFLSAHQSPRSPFEFTRRGRSWAWTPRQHTTGSAGTRRRRVSSPLIGGLHTEPTRLPEDTCPLPDLRLWTPRSGAVHRLSPVVCLSAGTSASPGLGLLSLGIHLEARVCSQRGPR", "length": 526, "header": "tr|A0ABI0P7D0-1|A0ABI0P7D0_BOVIN Isoform 1 of GDP-fucose protein O-fucosyltransferase 2 OS=Bos taurus OX=9913 GN=POFUT2 PE=3 SV=1 CANONICAL=A0ABI0P7D0-1" }, "locus": { "chromosome": "1", "start_pos": 145103154, "end_pos": 145090140, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000150258.1", "url": "https://www.ensembl.org/id/ENSBTAT00000150258.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107065.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107065.1" } ] } }, { "isoform_ac": "F1MPI4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0/entry#F1MPI4-1", "sequence": { "sequence": "MSGLRITHDACAGWAPWRCRGYGRRSPRGRAALPGWGEATGSAWPPGAMAALAVVFLLLWAASWPSASAFGEEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSDFFDLPSLNRNIPVIEYEQFIAESGGPFIDQVYILQGYTEGWKEGAWEEKIDSRPCIEPPLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIIAPVLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLRAVGDEFRSRYLNSTDVADGIPFEEDWTRMKVKLGSSLGGPYLGVHLRRKDFIWGHREDVPSLDGAVRKIRSLMKAHQLDKVFVATDAVRKELEELRRLLPEMVRFEPTWEELELYKDGGVAIVDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDKEKACEQPTHWRIAY", "length": 477, "header": "tr|F1MPI4-1|A0ABI0P7D0_BOVIN Computationally mapped isoform of GDP-fucose protein O-fucosyltransferase 2 OS=Bos taurus OX=9913 GN=POFUT2 PE=3 SV=2 CANONICAL=A0ABI0P7D0-1" }, "locus": { "chromosome": "1", "start_pos": 145103154, "end_pos": 145090333, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000010281.6", "url": "https://www.ensembl.org/id/ENSBTAT00000010281.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000010281.5", "url": "https://www.ensembl.org/id/ENSBTAP00000010281.5" } ] } }, { "isoform_ac": "F1MXU9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0/entry#F1MXU9-1", "sequence": { "sequence": "MSGLRITHDACAGWAPWRCRGYGRRSPRGRAALPGWGEATGSAWPPGAMAALAVVFLLLWAASWPSASAFGEEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSDFFDLPSLNRNIPVIEYEQFIAESGGPFIDQVYILQGYTEGWKEGAWEEKIDSRPCIEPPLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIIAPVLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLRAVGDEFRSRYLNSTDVADGIPFEEDWTRMKSWRSCGGCCLRWCGSNPRGRSWSSTRMGAWPSWTSGSVRTPGFLSAHQSPRSPFEFTRRGRSWAWTPRQHTTGSAGTRRRRVSSPLIGGLHTEPTRLPEDTCPLPDLRLWTPRSGAVHRLSPVVCLSAGTSASPGLGLLSLGIHLEARVCSQRGPR", "length": 481, "header": "tr|F1MXU9-1|A0ABI0P7D0_BOVIN Computationally mapped isoform of GDP-fucose protein O-fucosyltransferase 2 OS=Bos taurus OX=9913 GN=POFUT2 PE=3 SV=4 CANONICAL=A0ABI0P7D0-1" }, "locus": { "chromosome": "1", "start_pos": 145103154, "end_pos": 145090140, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000057179.5", "url": "https://www.ensembl.org/id/ENSBTAT00000057179.5" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000051399.5", "url": "https://www.ensembl.org/id/ENSBTAP00000051399.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "R-BTA-5173214", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5173214", "resource": "Reactome", "description": "O-glycosylation of TSR domain-containing proteins" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZUN5-1", "protein_name": "GDP-fucose protein O-fucosyltransferase 2", "gene_name": "Pofut2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPGVLLLSRSRMKPKRVLPAFGSMLTRLLRPARPPVHSQRKVQLGECEKGGTALRTRPTRGPTPGHAQCSGPCEARAHRGSGRVAVVTGDALRRADRRASGAGRGSRKCVAAGAMAALSVVCLLLAAASWRPVSASGEEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRVASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQGYAEGWKEGTWEEKVDERPCIDPLLYSQDKHEYFRGWFWGYEETRGLNVSCLSVQGSASVIAPVLLKNTSARSVMLDRAENLLHDHYGGREYWDTRRSMVFAKHLRAVGDEFRSQHLNSTDAADKMVLEEDWTRMKVKLGSALGGPYLGVHLRRKDFIWGHREDVPSLEGAVKKIRSLMKTHQLDKVFVATDAIRKEQEELRKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKIAY", "length": 543 }, "evidence": [ { "id": "A0ABI0P7D0", "url": "https://omabrowser.org/oma/group/A0ABI0P7D0/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8VHI3-1", "protein_name": "GDP-fucose protein O-fucosyltransferase 2", "gene_name": "Pofut2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAALSVVCLLLAAASWRPVSASGEEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRVASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQGYAEGWKEGTWEEKVDARPCIDPLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPVLLKNTSARSVMLDRAENLLHDHYGGREYWDTRRSMVFAKHLRAVGDEFRSQHLNSTDAADKMAPEEDWTKMKVKLGSALGGPYLGVHLRRKDFIWGHREDVPSLEGAVKKIRSLMKTHQLDKVFVATDAIRKEQEELRKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKIAY", "length": 429 }, "evidence": [ { "id": "A0ABI0P7D0", "url": "https://omabrowser.org/oma/group/A0ABI0P7D0/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9W589-1", "protein_name": "GDP-fucose protein O-fucosyltransferase 2", "gene_name": "Ofut2", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MRGSWPRLGFPALLLLLHLLTGSDAAVRNGTAKREIGDSRGSSGTCVKGFLQEILPLPATCPPEVLGMRGAVYILYDVNISEGFNLRRDVYIRMAVFVRRLQRRRRFRHVRLVLPPWPRLYHWHSQGLQQSGLPWSHFFDLASLRRYAPVLDYEEFLAEQRLFGNPGAPLVHVGHAFRLQHYEVMLEQGIFRDKFERVTDKPCSEGSLSGGPLLQQAELRVGRFHCVRFQGSAGLLEKLLREAIDEDTAGPEDVDDMRTYALLSAETVLHDHWGDEHFWQARRSMRFARRLEQVAADFRRQALDTTDASAGVQRPAMWELERPKRNAKGGDYLCAHLRRGDFVRSRDATTPTLKAAAQQVKQLLRGFNMTTVFLATDATPYELMELKELFYRFRLVHFAPESNVQRRELKDGGVAVVDQLVCAYARYFVGTYESTFTYRIYEEREILGFTQASTFNTFCKALGGSCSRNAVWPIVWADGDSDSEEDSDPY", "length": 490 }, "evidence": [ { "id": "A0ABI0P7D0", "url": "https://omabrowser.org/oma/group/A0ABI0P7D0/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "Q9Y2G5-3", "protein_name": "GDP-fucose protein O-fucosyltransferase 2", "gene_name": "POFUT2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MATLSFVFLLLGAVSWPPASASGQEFWPGQSAADILSGAASRRRYLLYDVNPPEGFNLRRDVYIRIASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPWSEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQSYAEGWKEGTWEEKVDERPCIDQLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPLLLRNTSARSVMLDRAENLLHDHYGGKEYWDTRRSMVFARHLREVGDEFRSRHLNSTDDADRIPFQEDWMKMKVKLGSALGGPYLGVHLRRKDFIWGHRQDVPSLEGAVRKIRSLMKTHRLDKVFVATDAVRKEYEELKKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGDQEKACEQPTHWKITY", "length": 429 }, "evidence": [ { "id": "A0ABI0P7D0", "url": "https://omabrowser.org/oma/group/A0ABI0P7D0/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "peptide-O-fucosyltransferase activity", "id": "GO:0046922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046922", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "fucose metabolic process", "id": "GO:0006004", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006004", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 237, "end_pos": 239, "annotation": "n_glycosylation_sequon" }, { "start_pos": 257, "end_pos": 259, "annotation": "n_glycosylation_sequon" }, { "start_pos": 307, "end_pos": 309, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "63644", "name": "", "equation": "L-seryl-[protein] + GDP-beta-L-fucose = 3-O-(alpha-L-fucosyl)-L-seryl-[protein] + GDP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0ABI0P7D0-1", "A0A3Q1MQ73-1", "Q6A198-1", "F1N557-1", "A0AAA9S1Q8-1" ], "evidence": [ { "id": "63644", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63644" } ] }, { "id": "70491", "name": "", "equation": "L-threonyl-[protein] + GDP-beta-L-fucose = 3-O-(alpha-L-fucosyl)-L-threonyl-[protein] + GDP + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0ABI0P7D0-1", "A0A3Q1MQ73-1", "Q6A198-1", "F1N557-1", "A0AAA9S1Q8-1" ], "evidence": [ { "id": "70491", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/70491" } ] }, { "id": "R-BTA-5173192", "name": "POFUT2 transfers fucose to TSR domain-containing proteins", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-1463452" ], "output_participant_list": [ "R-ALL-9942379" ], "enzyme_list": [ "P79331-1", "G8JKX1-1", "A0ABI0P7D0-1" ], "evidence": [ { "id": "R-BTA-5173192", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5173192" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-1463452", "participant_name": "GDP-Fuc [endoplasmic reticulum lumen]", "crossref": [ { "id": "57273", "database": "ChEBI", "url": "" }, { "id": "ZINC000008551145", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-ALL-9942379", "participant_name": "GDP [endoplasmic reticulum lumen]", "crossref": [ { "id": "ZINC000008215481", "database": "ZINC", "url": "" }, { "id": "58189", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A3Q1MQ73", "gene_name": "POFUT1", "activity": [ { "ec_number": "2.4.1.221", "activity": "L-seryl-[protein] + GDP-beta-L-fucose = 3-O-(alpha-L-fucosyl)-L-seryl-[protein] + GDP + H(+).", "evidence": [ { "id": "A0A3Q1MQ73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MQ73" } ] }, { "ec_number": "2.4.1.221", "activity": "", "evidence": [ { "id": "A0A3Q1MQ73", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MQ73" } ] } ] }, { "uniprot_ac": "A0AAA9S1Q8", "gene_name": "FUT11", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "A0AAA9S1Q8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9S1Q8" } ] } ] }, { "uniprot_ac": "A0ABI0P7D0", "gene_name": "POFUT2", "activity": [ { "ec_number": "2.4.1.221", "activity": "L-seryl-[protein] + GDP-beta-L-fucose = 3-O-(alpha-L-fucosyl)-L-seryl-[protein] + GDP + H(+).", "evidence": [ { "id": "A0ABI0P7D0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0" } ] }, { "ec_number": "2.4.1.221", "activity": "", "evidence": [ { "id": "A0ABI0P7D0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D0" } ] } ] }, { "uniprot_ac": "F1N557", "gene_name": "FUT10", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "F1N557", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1N557" } ] } ] }, { "uniprot_ac": "G8JKX1", "gene_name": "ADAMTS4", "activity": [ { "ec_number": "3.4.24.82", "activity": "Glutamyl endopeptidase. Bonds cleaved include 370-Thr-Glu-Gly-Glu-|-Ala-Arg-Gly-Ser-377 in the interglobular domain of mammalian aggrecan.", "evidence": [ { "id": "G8JKX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/G8JKX1" } ] }, { "ec_number": "3.4.24.82", "activity": "", "evidence": [ { "id": "G8JKX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/G8JKX1" } ] } ] }, { "uniprot_ac": "P79331", "gene_name": "ADAMTS2", "activity": [ { "ec_number": "3.4.24.14", "activity": "Cleaves the N-propeptide of collagen chain alpha1(I) at Pro-|-Gln and of alpha1(II) and alpha2(I) at Ala-|-Gln.", "evidence": [ { "id": "P79331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P79331" } ] }, { "ec_number": "3.4.24.14", "activity": "", "evidence": [ { "id": "P79331", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P79331" } ] } ] }, { "uniprot_ac": "Q6A198", "gene_name": "POFUT3", "activity": [ { "ec_number": "2.4.1.221", "activity": "L-seryl-[protein] + GDP-beta-L-fucose = 3-O-(alpha-L-fucosyl)-L-seryl-[protein] + GDP + H(+).", "evidence": [ { "id": "Q6A198", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6A198" } ] }, { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q6A198", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6A198" } ] }, { "ec_number": "2.4.1.221", "activity": "", "evidence": [ { "id": "Q6A198", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q6A198" } ] } ] } ], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [ { "glytoucan_ac": "G01002UX", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G01758EA", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G01854VF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G03493DQ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G05599VD", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G06038KF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G06127FF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G06414UP", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G06818PI", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G06997MX", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G08324ZK", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G08946OO", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G09090NW", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G09106ES", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G10008BD", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G10016UC", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G10184NJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G12181PI", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G12826LZ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G14402NL", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G14437UU", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G14848DF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G15080WZ", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G15319IX", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G15562AE", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G17012LI", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G17713SD", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G17931GP", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G17988BN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G18012DQ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G18898JN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G19136DJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G19968XU", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G21495MJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G21971UP", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G22765SI", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G23386LT", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G23925XC", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G25356VY", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G26040WE", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G26238GL", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G27608TI", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G28040RO", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G29201UH", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G29279FJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G29572KN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G30025VG", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G30104JB", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G30868KJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G30876HB", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G31486NW", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G31612WK", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G32795LG", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G34122OI", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G34964CV", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G36108VA", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G36143CN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G36220TC", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G36434MJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G36855WW", "type": "O-linked", "subtype": "O-fucose core 1" }, { "glytoucan_ac": "G37818VH", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G38021ZK", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G39294YF", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G40758QW", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G41472ZT", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G41992AB", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G42329TE", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G42917OE", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G43810RS", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G44148BN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G44154YF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G45338JM", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G45475MA", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G45792OQ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G46105DB", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G46802OR", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G47060VP", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G47652UN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G47722SQ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G48998UF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G49112ZN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G49847RK", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G50236GJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G50616AZ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G51212WC", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G52241UD", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G52249WE", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G52343HW", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G54574KG", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G55060EN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G55326NR", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G55950OL", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G56073QF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G56085TD", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G56521WJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G56692NU", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G56824UY", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G57530IM", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G58661LU", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G60414HV", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G60484ZS", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G60605ZN", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G61266PA", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G61773FW", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G62299BL", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G62787MH", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G64313PA", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G64338IU", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G65552OG", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G65847ZH", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G67443GJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G67676ND", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G68388HI", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G68872DJ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G69277WM", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G69467AR", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G69519HZ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G69658MM", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G69911BZ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G70593HA", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G70732AH", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G71599BU", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G72804UE", "type": "O-linked", "subtype": "O-fucose core 1" }, { "glytoucan_ac": "G73091PK", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G73549JS", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G73972JE", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G76127XF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G76920VG", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G78500BR", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G78997FO", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G80776EG", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G81427TO", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G82576YO", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G82600GX", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G82641VL", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G82875QY", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G83333IO", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G85157IU", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G85196CF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G85357CZ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G85661BQ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G85722FF", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G86823GS", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G89112ZH", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G90037CR", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G90651HU", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G90809LY", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G91459AN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G92071FK", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G92996IT", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G93118GA", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G93755DD", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G96419RG", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G96881BQ", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G97031QN", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G97392SN", "type": "O-linked", "subtype": "O-fucose core 2" }, { "glytoucan_ac": "G97501SC", "type": "O-linked", "subtype": "O-fucose core, other" }, { "glytoucan_ac": "G97959DX", "type": "O-linked", "subtype": "O-fucose core, other" } ], "enzyme_annotation": [ { "ec_number": "2.4.1.221", "ec_name": "L-seryl-[protein] + GDP-beta-L-fucose = 3-O-(alpha-L-fucosyl)-L-seryl-[protein] + GDP + H(+).", "evidence": [ { "id": "2.4.1.221", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.4.1.221" }, { "id": "2.4.1.221", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.221" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 237, "end_pos": 239 }, { "start_pos": 257, "end_pos": 259 }, { "start_pos": 307, "end_pos": 309 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5M0-1", "uniprot_ac": "A0ABI0P5M0", "uniprot_id": "A0ABI0P5M0_BOVIN", "mass": { "chemical_mass": 25480.0, "monoisotopic_mass": 25480.0 }, "refseq": {}, "gene_names": [ { "name": "GSTA1", "type": "recommended", "evidence": [ { "id": "A0ABI0P5M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" } ] } ], "protein_names": [ { "name": "Glutathione S-transferase", "type": "recommended", "evidence": [ { "id": "A0ABI0P5M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0/entry#names_and_taxonomy" } ] }, { "name": "2.5.1.18", "type": "synonym", "evidence": [ { "id": "A0ABI0P5M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "GSTA1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0", "locus": {} } ], "crossref": [ { "id": "ENSBTAG00000021516", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000021516", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSBTAG00000025485", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000025485", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03077", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03077", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd03208", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03208", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR003080", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003080", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004045", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004045", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004046", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004046", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010987", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010987", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036249", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036249", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036282", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036282", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050213", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050213", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11571", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11571:SF107", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11571:SF107", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00043", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00043", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF02798", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02798", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-156590", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-156590", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-189483", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-189483", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-9748787", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9748787", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "16437", "url": "https://www.rhea-db.org/rhea/16437", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A3Q1MEC8", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MEC8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MEC8-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MEC8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5M0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E1BKD8", "url": "https://www.uniprot.org/uniprotkb/E1BKD8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E1BKD8-1", "url": "https://www.uniprot.org/uniprotkb/E1BKD8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGKPILHYLNGRGRMECIRWLLAAAGVEFEEKFIEKTEDLDKIKNDGSLMLQQVPVVEIDGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYSEGVADLGEMIMHLSLCPESDTPPAEKDAKLTLIREKTTNRYLPAFVHVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDPQAFGQLPSALKARVSSLLAVKKFLQPGSQRKPPMDEKIIKVKKVFRF", "length": 224, "header": "tr|A0ABI0P5M0-1|A0ABI0P5M0_BOVIN Isoform 1 of Glutathione S-transferase OS=Bos taurus OX=9913 GN=GSTA1 PE=3 SV=1 CANONICAL=A0ABI0P5M0-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1MEC8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0/entry#A0A3Q1MEC8-1", "sequence": { "sequence": "MAGKPTLHYFNGRGRMECIRWLLAAAGVEFEEKFIEKPEDLDKLKNDGSLMFQQVPMVEIDGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYSEGVADLGEMIMHFPLCPPAEKDAKLTLIREKTTNRYLPAFENVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDPQAFGQLPSAEGPKSQSQQSPGREEISAAWQPEEASHG", "length": 209, "header": "tr|A0A3Q1MEC8-1|A0ABI0P5M0_BOVIN Computationally mapped isoform of Glutathione S-transferase OS=Bos taurus OX=9913 GN=GSTA1 PE=3 SV=2 CANONICAL=A0ABI0P5M0-1" }, "locus": { "chromosome": "23", "start_pos": 25130277, "end_pos": 25101856, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000087331.2", "url": "https://www.ensembl.org/id/ENSBTAT00000087331.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000068850.2", "url": "https://www.ensembl.org/id/ENSBTAP00000068850.2" } ] } }, { "isoform_ac": "A0ABI0P5M0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0/entry#A0ABI0P5M0-1", "sequence": { "sequence": "MAGKPILHYLNGRGRMECIRWLLAAAGVEFEEKFIEKTEDLDKIKNDGSLMLQQVPVVEIDGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYSEGVADLGEMIMHLSLCPESDTPPAEKDAKLTLIREKTTNRYLPAFVHVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDPQAFGQLPSALKARVSSLLAVKKFLQPGSQRKPPMDEKIIKVKKVFRF", "length": 224, "header": "tr|A0ABI0P5M0-1|A0ABI0P5M0_BOVIN Isoform 1 of Glutathione S-transferase OS=Bos taurus OX=9913 GN=GSTA1 PE=3 SV=1 CANONICAL=A0ABI0P5M0-1" }, "locus": { "chromosome": "23", "start_pos": 25113151, "end_pos": 25101819, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000141297.1", "url": "https://www.ensembl.org/id/ENSBTAT00000141297.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106574.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106574.1" } ] } }, { "isoform_ac": "E1BKD8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0/entry#E1BKD8-1", "sequence": { "sequence": "MAGKPTLHYFNGRGRMECIRWLLAAAGVEFEEKFIEKPEDLDKLKNDGSLMFQQVPMVEIDGMKLVQTRAILNYIATKYNLYGKDMKERALIDMYSEGVADLGEMIMHFPLCPPAEKDAKLTLIREKTTNRYLPAFENVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDPSLLANFPLLKALKARVSSLLAVKKFLQPGSQRKPPMDEKIIKVKKVFRF", "length": 221, "header": "tr|E1BKD8-1|A0ABI0P5M0_BOVIN Computationally mapped isoform of Glutathione S-transferase OS=Bos taurus OX=9913 GN=GSTA1 PE=3 SV=3 CANONICAL=A0ABI0P5M0-1" }, "locus": { "chromosome": "23", "start_pos": 25130277, "end_pos": 25101819, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000035828.6", "url": "https://www.ensembl.org/id/ENSBTAT00000035828.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000035695.6", "url": "https://www.ensembl.org/id/ENSBTAP00000035695.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "R-BTA-156590", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-156590", "resource": "Reactome", "description": "Glutathione conjugation" }, { "id": "R-BTA-189483", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-189483", "resource": "Reactome", "description": "Heme degradation" }, { "id": "R-BTA-9748787", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9748787", "resource": "Reactome", "description": "Azathioprine ADME" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "glutathione transferase activity", "id": "GO:0004364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004364", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" } ], "pmid": "" }, { "name": "glutathione metabolic process", "id": "GO:0006749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006749", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "16437", "name": "", "equation": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O18879-1", "F1MUX5-1", "F1MX44-1", "A0ABI0P5M0-1", "A0AAA9TW47-1", "F6QEM8-1", "A0ABI0P3R2-1", "A0AAF6Z0W3-1", "P28801-1", "Q2KJG4-1", "A0A3Q1LMV5-1", "F1MVX2-1", "Q28035-1", "Q9N0V4-1", "Q2NL00-1", "F1MXY2-1", "E1BED9-1", "A0ABI0P006-1", "Q5E9G0-1", "Q64L89-1", "A0A452DIU1-1", "F1MGZ9-1", "A0AAA9TXU3-1", "E1BJX2-1" ], "evidence": [ { "id": "16437", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/16437" } ] }, { "id": "R-BTA-176054", "name": "GST dimers conjugate GSH with cytosolic substrates", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O18879-1", "E1BED9-1", "A0ABI0P006-1", "A0ABI0P5M0-1", "A0A3Q1LMV5-1", "F1MGZ9-1", "F1MUX5-1", "F1MX44-1", "Q2NL00-1", "Q5E9G0-1", "A0A452DIU1-1" ], "evidence": [ { "id": "R-BTA-176054", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-176054" } ] }, { "id": "R-BTA-9663492", "name": "BIL dissociates from GSTA1, FABP1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O18879-1", "A0ABI0P5M0-1", "F1MX44-1" ], "evidence": [ { "id": "R-BTA-9663492", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9663492" } ] }, { "id": "R-BTA-9663511", "name": "BIL binds GSTA1, FABP1", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O18879-1", "A0ABI0P5M0-1", "F1MX44-1" ], "evidence": [ { "id": "R-BTA-9663511", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9663511" } ] }, { "id": "R-BTA-9748996", "name": "GST dimers cleave AZA to 6MP", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-9748994" ], "output_participant_list": [ "R-ALL-9748975" ], "enzyme_list": [ "O18879-1", "A0ABI0P5M0-1", "F1MX44-1" ], "evidence": [ { "id": "R-BTA-9748996", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9748996" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-9748975", "participant_name": "GS-nitroimidazole [cytosol]", "crossref": [ { "id": "180931", "database": "ChEBI", "url": "" } ] }, { "participant_id": "R-ALL-9748994", "participant_name": "AZA [cytosol]", "crossref": [ { "id": "7120", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "2948", "database": "ChEBI", "url": "" }, { "id": "PDBC00620", "database": "PharmacoDB", "url": "" }, { "id": "0005101", "database": "Mondo", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A3Q1LMV5", "gene_name": "LOC281806", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "A0A3Q1LMV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LMV5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A3Q1LMV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LMV5" } ] } ] }, { "uniprot_ac": "A0A452DIU1", "gene_name": "LOC327709", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "A0A452DIU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A452DIU1" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0A452DIU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A452DIU1" } ] } ] }, { "uniprot_ac": "A0AAA9TW47", "gene_name": "GSTK1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "A0AAA9TW47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TW47" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0AAA9TW47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TW47" } ] } ] }, { "uniprot_ac": "A0AAA9TXU3", "gene_name": "GSTZ1", "activity": [ { "ec_number": "5.2.1.2", "activity": "4-maleylacetoacetate = 4-fumarylacetoacetate.", "evidence": [ { "id": "A0AAA9TXU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TXU3" } ] }, { "ec_number": "5.2.1.2", "activity": "", "evidence": [ { "id": "A0AAA9TXU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TXU3" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "A0AAA9TXU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TXU3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0AAA9TXU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TXU3" } ] } ] }, { "uniprot_ac": "A0AAF6Z0W3", "gene_name": "LANCL1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "A0AAF6Z0W3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAF6Z0W3" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0AAF6Z0W3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAF6Z0W3" } ] } ] }, { "uniprot_ac": "A0ABI0P006", "gene_name": "LOC785216", "activity": [ { "ec_number": "1.20.4.2", "activity": "methylarsonate + 2 glutathione + H(+) = methylarsonous acid + glutathione disulfide + H2O.", "evidence": [ { "id": "A0ABI0P006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P006" } ] }, { "ec_number": "1.8.5.1", "activity": "L-dehydroascorbate + 2 glutathione = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "A0ABI0P006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P006" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "A0ABI0P006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P006" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "A0ABI0P006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P006" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0ABI0P006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P006" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "A0ABI0P006", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P006" } ] } ] }, { "uniprot_ac": "A0ABI0P3R2", "gene_name": "GSTT2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "A0ABI0P3R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P3R2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0ABI0P3R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P3R2" } ] }, { "ec_number": "4.1.1.84", "activity": "D-dopachrome + H(+) = 5,6-dihydroxyindole + CO2.", "evidence": [ { "id": "A0ABI0P3R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P3R2" } ] }, { "ec_number": "4.1.1.84", "activity": "", "evidence": [ { "id": "A0ABI0P3R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P3R2" } ] } ] }, { "uniprot_ac": "A0ABI0P5M0", "gene_name": "GSTA1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "A0ABI0P5M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "A0ABI0P5M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" } ] } ] }, { "uniprot_ac": "E1BED9", "gene_name": "GSTO2", "activity": [ { "ec_number": "1.20.4.2", "activity": "methylarsonate + 2 glutathione + H(+) = methylarsonous acid + glutathione disulfide + H2O.", "evidence": [ { "id": "E1BED9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BED9" } ] }, { "ec_number": "1.8.5.1", "activity": "L-dehydroascorbate + 2 glutathione = glutathione disulfide + L-ascorbate.", "evidence": [ { "id": "E1BED9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BED9" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "E1BED9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BED9" } ] }, { "ec_number": "1.20.4.2", "activity": "", "evidence": [ { "id": "E1BED9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BED9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "E1BED9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BED9" } ] }, { "ec_number": "1.8.5.1", "activity": "", "evidence": [ { "id": "E1BED9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BED9" } ] } ] }, { "uniprot_ac": "E1BJX2", "gene_name": "GSTT4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "E1BJX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BJX2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "E1BJX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BJX2" } ] } ] }, { "uniprot_ac": "F1MGZ9", "gene_name": "HPGDS", "activity": [ { "ec_number": "5.3.99.2", "activity": "prostaglandin H2 = prostaglandin D2.", "evidence": [ { "id": "F1MGZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MGZ9" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "F1MGZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MGZ9" } ] }, { "ec_number": "5.3.99.2", "activity": "", "evidence": [ { "id": "F1MGZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MGZ9" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F1MGZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MGZ9" } ] } ] }, { "uniprot_ac": "F1MUX5", "gene_name": "LOC100295687", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "F1MUX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MUX5" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F1MUX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MUX5" } ] } ] }, { "uniprot_ac": "F1MVX2", "gene_name": "LANCL1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "F1MVX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MVX2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F1MVX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MVX2" } ] } ] }, { "uniprot_ac": "F1MX44", "gene_name": "GSTA5", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "F1MX44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MX44" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F1MX44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MX44" } ] } ] }, { "uniprot_ac": "F1MXY2", "gene_name": "MGST1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "F1MXY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MXY2" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F1MXY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MXY2" } ] } ] }, { "uniprot_ac": "F6QEM8", "gene_name": "LOC783879", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "F6QEM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6QEM8" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "F6QEM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6QEM8" } ] } ] }, { "uniprot_ac": "O18879", "gene_name": "GSTA2", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "O18879", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O18879" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "O18879", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/O18879" } ] } ] }, { "uniprot_ac": "P28801", "gene_name": "GSTP1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "P28801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P28801" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "P28801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/P28801" } ] } ] }, { "uniprot_ac": "Q28035", "gene_name": "GSTA1", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q28035", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q28035" } ] }, { "ec_number": "5.3.3.-", "activity": "", "evidence": [ { "id": "Q28035", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q28035" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "Q28035", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q28035" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q28035", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q28035" } ] } ] }, { "uniprot_ac": "Q2KJG4", "gene_name": "MGST2", "activity": [ { "ec_number": "1.11.1.-", "activity": "", "evidence": [ { "id": "Q2KJG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2KJG4" } ] }, { "ec_number": "4.4.1.20", "activity": "leukotriene C4 = leukotriene A4 + glutathione.", "evidence": [ { "id": "Q2KJG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2KJG4" } ] }, { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "Q2KJG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2KJG4" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q2KJG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2KJG4" } ] }, { "ec_number": "4.4.1.20", "activity": "", "evidence": [ { "id": "Q2KJG4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2KJG4" } ] } ] }, { "uniprot_ac": "Q2NL00", "gene_name": "GSTT1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "Q2NL00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2NL00" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q2NL00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q2NL00" } ] } ] }, { "uniprot_ac": "Q5E9G0", "gene_name": "GSTA4", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "Q5E9G0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5E9G0" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q5E9G0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q5E9G0" } ] } ] }, { "uniprot_ac": "Q64L89", "gene_name": "MGST1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "Q64L89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q64L89" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q64L89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q64L89" } ] } ] }, { "uniprot_ac": "Q9N0V4", "gene_name": "GSTM1", "activity": [ { "ec_number": "2.5.1.18", "activity": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "Q9N0V4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9N0V4" } ] }, { "ec_number": "2.5.1.18", "activity": "", "evidence": [ { "id": "Q9N0V4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q9N0V4" } ] } ] } ], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" }, { "id": "PS50405", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50405" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "GST C-terminal", "eco_id": "ECO_0000259", "start_pos": 85, "end_pos": 211, "start_aa": "Asp", "end_aa": "Met", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P5M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M0" }, { "id": "PS50404", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50404" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "GST N-terminal", "eco_id": "ECO_0000259", "start_pos": 3, "end_pos": 83, "start_aa": "Gly", "end_aa": "Gly", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "2.5.1.18", "ec_name": "RX + glutathione = an S-substituted glutathione + a halide anion + H(+).", "evidence": [ { "id": "2.5.1.18", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.5.1.18" }, { "id": "2.5.1.18", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.5.1.18" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6W8-1", "uniprot_ac": "A0ABI0P6W8", "uniprot_id": "A0ABI0P6W8_BOVIN", "mass": { "chemical_mass": 20245.0, "monoisotopic_mass": 20245.0 }, "refseq": {}, "gene_names": [ { "name": "MTFP1", "type": "recommended", "evidence": [ { "id": "A0ABI0P6W8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8" } ] } ], "protein_names": [ { "name": "Mitochondrial fission process protein 1", "type": "recommended", "evidence": [ { "id": "A0ABI0P6W8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8/entry#names_and_taxonomy" } ] }, { "name": "Mitochondrial 18 kDa protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P6W8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6W8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "MTFP1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8", "locus": { "chromosome": "17", "start_pos": 69429374, "end_pos": 69423142, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000018116", "url": "https://www.ensembl.org/id/ENSBTAG00000018116" } ] } } ], "crossref": [ { "id": "ENSBTAG00000018116", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000018116", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "525071", "url": "https://www.ncbi.nlm.nih.gov/gene/525071", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR019560", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019560", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11001", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11001", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11001:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11001:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF10558", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF10558", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0A3Q1MF50", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF50", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MF50-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF50-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SRW0", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SRW0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SRW0-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SRW0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6W8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6W8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RAJ3", "url": "https://www.uniprot.org/uniprotkb/F6RAJ3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RAJ3-1", "url": "https://www.uniprot.org/uniprotkb/F6RAJ3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "NPSQGEGLRCAEEFADAPCWRGEHDLSFSPGPSAGPAAANGRAGGSRGGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKGKKARDVPGPEAGRSSRVTVAVVDTFVWQALASVAIPGFTINRVCAASLYILSTATRWPLAVRKWTTTTLGLLAIPVIIHPIDRSVDFLLDSSLRKLYPSVEKPSSS", "length": 192, "header": "tr|A0ABI0P6W8-1|A0ABI0P6W8_BOVIN Isoform 1 of Mitochondrial fission process protein 1 OS=Bos taurus OX=9913 GN=MTFP1 PE=3 SV=1 CANONICAL=A0ABI0P6W8-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1MF50-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8/entry#A0A3Q1MF50-1", "sequence": { "sequence": "MSEPPSRGAERDLFRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKGKKARDVPGPEAGRSSRVTVAVVDTFVWQALASVAIPGFTINRVCAASLYILSTATRWPLAVRKWTTTTLGLLAIPVIIHPIDSLQDPSLMVPAP", "length": 154, "header": "tr|A0A3Q1MF50-1|A0ABI0P6W8_BOVIN Computationally mapped isoform of Mitochondrial fission process protein 1 OS=Bos taurus OX=9913 GN=MTFP1 PE=3 SV=2 CANONICAL=A0ABI0P6W8-1" }, "locus": { "chromosome": "17", "start_pos": 69429131, "end_pos": 69423244, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000075399.3", "url": "https://www.ensembl.org/id/ENSBTAT00000075399.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000067532.2", "url": "https://www.ensembl.org/id/ENSBTAP00000067532.2" } ] } }, { "isoform_ac": "A0AAA9SRW0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8/entry#A0AAA9SRW0-1", "sequence": { "sequence": "MSEPPSRGAERDLFRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKGKKARDGFPPLPLLD", "length": 74, "header": "tr|A0AAA9SRW0-1|A0ABI0P6W8_BOVIN Computationally mapped isoform of Mitochondrial fission process protein 1 OS=Bos taurus OX=9913 GN=MTFP1 PE=3 SV=1 CANONICAL=A0ABI0P6W8-1" }, "locus": { "chromosome": "17", "start_pos": 69424823, "end_pos": 69423244, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000094306.2", "url": "https://www.ensembl.org/id/ENSBTAT00000094306.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000089119.1", "url": "https://www.ensembl.org/id/ENSBTAP00000089119.1" } ] } }, { "isoform_ac": "A0ABI0P6W8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8/entry#A0ABI0P6W8-1", "sequence": { "sequence": "NPSQGEGLRCAEEFADAPCWRGEHDLSFSPGPSAGPAAANGRAGGSRGGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKGKKARDVPGPEAGRSSRVTVAVVDTFVWQALASVAIPGFTINRVCAASLYILSTATRWPLAVRKWTTTTLGLLAIPVIIHPIDRSVDFLLDSSLRKLYPSVEKPSSS", "length": 192, "header": "tr|A0ABI0P6W8-1|A0ABI0P6W8_BOVIN Isoform 1 of Mitochondrial fission process protein 1 OS=Bos taurus OX=9913 GN=MTFP1 PE=3 SV=1 CANONICAL=A0ABI0P6W8-1" }, "locus": { "chromosome": "17", "start_pos": 69426201, "end_pos": 69423058, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000145250.1", "url": "https://www.ensembl.org/id/ENSBTAT00000145250.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107336.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107336.1" } ] } }, { "isoform_ac": "F6RAJ3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W8/entry#F6RAJ3-1", "sequence": { "sequence": "MSEPPSRGAERDLFRDTWVRYLGYANEVGEAFRSLVPAAVVWLSYGVSSSYVLADAIDKGKKARDVPGPEAGRSSRVTVAVVDTFVWQALASVAIPGFTINRVCAASLYILSTATRWPLAVRKWTTTTLGLLAIPVIIHPIDRLGSCACP", "length": 150, "header": "tr|F6RAJ3-1|A0ABI0P6W8_BOVIN Computationally mapped isoform of Mitochondrial fission process protein 1 OS=Bos taurus OX=9913 GN=MTFP1 PE=3 SV=1 CANONICAL=A0ABI0P6W8-1" }, "locus": { "chromosome": "17", "start_pos": 69425852, "end_pos": 69423244, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000024112.6", "url": "https://www.ensembl.org/id/ENSBTAT00000024112.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000024112.4", "url": "https://www.ensembl.org/id/ENSBTAP00000024112.4" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P738-1", "uniprot_ac": "A0ABI0P738", "uniprot_id": "A0ABI0P738_BOVIN", "mass": { "chemical_mass": 23089.0, "monoisotopic_mass": 23089.0 }, "refseq": { "ac": "XP_005215553", "name": "sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005215553" }, "gene_names": [ { "name": "NKAIN3", "type": "recommended", "evidence": [ { "id": "A0ABI0P738", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738" } ] }, { "name": "NKAIN3", "type": "synonym", "evidence": [ { "id": "XP_005215553", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005215553" } ] } ], "protein_names": [ { "name": "Sodium/potassium-transporting ATPase subunit beta-1-interacting protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P738", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738/entry#names_and_taxonomy" } ] }, { "name": "Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P738", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738/entry#names_and_taxonomy" } ] }, { "name": "sodium/potassium-transporting ATPase subunit beta-1-interacting protein 3 isoform X1", "type": "synonym", "evidence": [ { "id": "XP_005215553", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005215553" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P738", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "NKAIN3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738", "locus": { "chromosome": "14", "start_pos": 27997704, "end_pos": 27464088, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000054400", "url": "https://www.ensembl.org/id/ENSBTAG00000054400" } ] } } ], "crossref": [ { "id": "ENSBTAG00000054400", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000054400", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "788352", "url": "https://www.ncbi.nlm.nih.gov/gene/788352", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR008516", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008516", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "A0A3Q1MKK1", "url": "https://www.orthodb.org/?gene=A0A3Q1MKK1", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A3Q1MT99", "url": "https://www.orthodb.org/?gene=A0A3Q1MT99", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13084", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13084", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13084:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13084:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05640", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF05640", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_005215553", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005215553", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A3Q1MKK1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MKK1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MKK1-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MKK1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MT99", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MT99", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MT99-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MT99-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SRW5", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SRW5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SRW5-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SRW5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P738", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P738-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGCCTGRCSLIGLCALQLLSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIVVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMTDDYTYVSVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISIFMEEEDTFDFIGGLDAHSYCQDHVTLKPVHLSK", "length": 203, "header": "tr|A0ABI0P738-1|A0ABI0P738_BOVIN Isoform 1 of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein OS=Bos taurus OX=9913 GN=NKAIN3 PE=3 SV=1 CANONICAL=A0ABI0P738-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1MKK1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738/entry#A0A3Q1MKK1-1", "sequence": { "sequence": "SDLAAAAAVAQTLSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIVVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMTDDYTYVSVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISIFMEEEDTCRNK", "length": 175, "header": "tr|A0A3Q1MKK1-1|A0ABI0P738_BOVIN Computationally mapped isoform of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein OS=Bos taurus OX=9913 GN=NKAIN3 PE=3 SV=2 CANONICAL=A0ABI0P738-1" }, "locus": { "chromosome": "14", "start_pos": 27996700, "end_pos": 27736947, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000077116.2", "url": "https://www.ensembl.org/id/ENSBTAT00000077116.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000071422.2", "url": "https://www.ensembl.org/id/ENSBTAP00000071422.2" } ] } }, { "isoform_ac": "A0A3Q1MT99-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738/entry#A0A3Q1MT99-1", "sequence": { "sequence": "PLRLPAEVSRGLGGSFFSGWFQVTWCHQKLSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIVVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMTDDYTYVSVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISIFMEEEDTCRNK", "length": 192, "header": "tr|A0A3Q1MT99-1|A0ABI0P738_BOVIN Computationally mapped isoform of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein OS=Bos taurus OX=9913 GN=NKAIN3 PE=3 SV=2 CANONICAL=A0ABI0P738-1" }, "locus": { "chromosome": "14", "start_pos": 27996700, "end_pos": 27464187, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000078535.2", "url": "https://www.ensembl.org/id/ENSBTAT00000078535.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000073493.2", "url": "https://www.ensembl.org/id/ENSBTAP00000073493.2" } ] } }, { "isoform_ac": "A0AAA9SRW5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738/entry#A0AAA9SRW5-1", "sequence": { "sequence": "MWLSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIVVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMTDDYTYVSVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISIFMEEEDTFDFIGGLDAHSYCQDHVTLKPVHLSK", "length": 187, "header": "tr|A0AAA9SRW5-1|A0ABI0P738_BOVIN Computationally mapped isoform of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein OS=Bos taurus OX=9913 GN=NKAIN3 PE=3 SV=2 CANONICAL=A0ABI0P738-1" }, "locus": { "chromosome": "14", "start_pos": 27996696, "end_pos": 27520870, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000107668.2", "url": "https://www.ensembl.org/id/ENSBTAT00000107668.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000089125.2", "url": "https://www.ensembl.org/id/ENSBTAP00000089125.2" } ] } }, { "isoform_ac": "A0ABI0P738-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738/entry#A0ABI0P738-1", "sequence": { "sequence": "MGCCTGRCSLIGLCALQLLSALERQIFDFLGFQWAPILGNFLHIIVVILGLFGTIQYRPRYIVVYTVWTALWVTWNVFIICFYLEVGGLSKDTDLMTFNISVHRSWWREHGPGCVRRVLPPSAHGMTDDYTYVSVTGCIVDFQYLEVIHSAVQILLSLVGFVYACYVISIFMEEEDTFDFIGGLDAHSYCQDHVTLKPVHLSK", "length": 203, "header": "tr|A0ABI0P738-1|A0ABI0P738_BOVIN Isoform 1 of Sodium/potassium-transporting ATPase subunit beta-1-interacting protein OS=Bos taurus OX=9913 GN=NKAIN3 PE=3 SV=1 CANONICAL=A0ABI0P738-1" }, "locus": { "chromosome": "14", "start_pos": 27996696, "end_pos": 27463927, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144569.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144569.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107303.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107303.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P738", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of sodium ion transport", "id": "GO:0002028", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002028", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P738", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P738" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 99, "end_pos": 101, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 99, "end_pos": 101 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P795-1", "uniprot_ac": "A0ABI0P795", "uniprot_id": "A0ABI0P795_BOVIN", "mass": { "chemical_mass": 40249.0, "monoisotopic_mass": 40249.0 }, "refseq": {}, "gene_names": [ { "name": "TNFSF10", "type": "recommended", "evidence": [ { "id": "A0ABI0P795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795" } ] } ], "protein_names": [ { "name": "Tumor necrosis factor ligand superfamily member 10", "type": "recommended", "evidence": [ { "id": "A0ABI0P795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795/entry#names_and_taxonomy" } ] }, { "name": "TNF-related apoptosis-inducing ligand", "type": "synonym", "evidence": [ { "id": "A0ABI0P795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "A0AAA9TZ76", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TZ76#function" }, { "database": "UniProtKB", "id": "ARBA00055277", "url": "https://www.uniprot.org/uniprotkb/ARBA00055277#function" }, { "database": "UniProtKB", "id": "A0AAA9TN74", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TN74#function" }, { "database": "UniProtKB", "id": "A0ABI0P795", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P795", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "TNFSF10", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795", "locus": { "chromosome": "1", "start_pos": 95002223, "end_pos": 94984481, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000018994", "url": "https://www.ensembl.org/id/ENSBTAG00000018994" } ] } } ], "crossref": [ { "id": "cd00184", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00184", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR006052", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006052", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008983", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008983", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017355", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017355", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021184", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021184", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11471", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11471", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11471:SF27", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11471:SF27", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00229", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00229", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0AAA9TN74", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TN74", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9TN74-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TN74-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9TZ76", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TZ76", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9TZ76-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TZ76-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P795", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P795-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVRCQSRTFCFRHESHPTVIMALKQAPGSRLGQICMPILIFTVLLQAFEFLTQILGQERSCLRGGLRLLLLSVTPLEASTELPHLLRWKTACLLLLQTTSLCKMQNKYFKSGLACFLEEDDRSWDSRDDESIINPCWELKSQLYLFVKKMTLRTFEEMIPTNPEKQYNPYLEREKGPKRVAAHITGSNRKKSTLPVPGSKNEKAVGHKINSWESSRKGHSFLNNLYLRNGELVILQTGFYYIYSQTYFRFQEPEEVLGTVSTEENRKKIKQMVQYIYKYTNYPDPILLMKSARNSCWSKDSEYGLYSIYQGGIFELKENDRIFVSVTNERLVDLDQEASFFGAFLIG", "length": 347, "header": "tr|A0ABI0P795-1|A0ABI0P795_BOVIN Isoform 1 of Tumor necrosis factor ligand superfamily member 10 OS=Bos taurus OX=9913 GN=TNFSF10 PE=3 SV=1 CANONICAL=A0ABI0P795-1" }, "isoforms": [ { "isoform_ac": "A0AAA9TN74-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795/entry#A0AAA9TN74-1", "sequence": { "sequence": "MALKQAPGSRLGQICMPILIFTVLLQAFGWKTACLLLLQTTSLCKMQNKYFKSGLACFLEEDDRSWDSRDDESIINPCWELKSQLYLFVKKMTLRTFEEMIPTNPEKQYNPYLEREKGPKRVAAHITGSNRKKSTLPVPGSKNEKAVGHKINSWESSRKGHSFLNNLYLRNGELVILQTGFYYIYSQTYFRFQEPEEVLGTVSTEENRKKIKQMVQYIYKYTNYPDPILLMKSARNSCWSKDSEYGLYSIYQGGIFELKENDRIFVSVTNERLVDLDQEASFFGAFLIG", "length": 289, "header": "tr|A0AAA9TN74-1|A0ABI0P795_BOVIN Computationally mapped isoform of Tumor necrosis factor ligand superfamily member 10 OS=Bos taurus OX=9913 GN=TNFSF10 PE=3 SV=1 CANONICAL=A0ABI0P795-1" }, "locus": { "chromosome": "1", "start_pos": 95001219, "end_pos": 94985351, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000123496.2", "url": "https://www.ensembl.org/id/ENSBTAT00000123496.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000097800.2", "url": "https://www.ensembl.org/id/ENSBTAP00000097800.2" } ] } }, { "isoform_ac": "A0AAA9TZ76-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795/entry#A0AAA9TZ76-1", "sequence": { "sequence": "MESHPTVIMALKQAPGSRLGQICMPILIFTVLLQAFGMAVFYMYFNKELKQMQNKYFKSGLACFLEEDDRSWDSRDDESIINPCWELKSQLYLFVKKMTLRTFEEMIPTNPEKQYNPYLEREKGPKRVAAHITGSNRKKSTLPVPGSKNEKAVGHKINSWESSRKGHSFLNNLYLRNGELVILQTGFYYIYSQTYFRFQEPEEVLGTVSTEENRKKIKQMVQYIYKYTNYPDPILLMKSARNSCWSKDSEYGLYSIYQGGIFELKENDRIFVSVTNERLVDLDQEASFFGAFLIG", "length": 295, "header": "tr|A0AAA9TZ76-1|A0ABI0P795_BOVIN Computationally mapped isoform of Tumor necrosis factor ligand superfamily member 10 OS=Bos taurus OX=9913 GN=TNFSF10 PE=3 SV=2 CANONICAL=A0ABI0P795-1" }, "locus": { "chromosome": "1", "start_pos": 95001219, "end_pos": 94984603, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000107242.2", "url": "https://www.ensembl.org/id/ENSBTAT00000107242.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000103948.2", "url": "https://www.ensembl.org/id/ENSBTAP00000103948.2" } ] } }, { "isoform_ac": "A0ABI0P795-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795/entry#A0ABI0P795-1", "sequence": { "sequence": "MVRCQSRTFCFRHESHPTVIMALKQAPGSRLGQICMPILIFTVLLQAFEFLTQILGQERSCLRGGLRLLLLSVTPLEASTELPHLLRWKTACLLLLQTTSLCKMQNKYFKSGLACFLEEDDRSWDSRDDESIINPCWELKSQLYLFVKKMTLRTFEEMIPTNPEKQYNPYLEREKGPKRVAAHITGSNRKKSTLPVPGSKNEKAVGHKINSWESSRKGHSFLNNLYLRNGELVILQTGFYYIYSQTYFRFQEPEEVLGTVSTEENRKKIKQMVQYIYKYTNYPDPILLMKSARNSCWSKDSEYGLYSIYQGGIFELKENDRIFVSVTNERLVDLDQEASFFGAFLIG", "length": 347, "header": "tr|A0ABI0P795-1|A0ABI0P795_BOVIN Isoform 1 of Tumor necrosis factor ligand superfamily member 10 OS=Bos taurus OX=9913 GN=TNFSF10 PE=3 SV=1 CANONICAL=A0ABI0P795-1" }, "locus": { "chromosome": "1", "start_pos": 95001219, "end_pos": 94984603, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152633.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152633.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107519.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107519.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P795", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P795", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P795", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P795", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P795", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795" } ], "pmid": "" }, { "name": "tumor necrosis factor receptor binding", "id": "GO:0005164", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005164", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P795", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P795" }, { "id": "PS50049", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50049" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "THD", "eco_id": "ECO_0000259", "start_pos": 180, "end_pos": 346, "start_aa": "Val", "end_aa": "Ile", "glycosite_overlap": "" } ], "binding_sites": [ { "evidence": [ { "id": "A0AAA9TN74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TN74#function" }, { "id": "A0AAA9TN74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TN74" }, { "id": "PIRSR038013-50", "database": "PIR Site Rule", "url": "https://proteininformationresource.org/cgi-bin/pirrule?id=PIRSR038013-50" } ], "binding_site_uniprot": 238, "amino_acid": "Gly", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "ligand shared between all trimeric partners", "eco_id": "ECO_0000256", "start_pos": 238, "end_pos": 238, "start_aa": "Gly", "end_aa": "Gly", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0AAA9TZ76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TZ76#function" }, { "id": "A0AAA9TZ76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TZ76" }, { "id": "PIRSR038013-50", "database": "PIR Site Rule", "url": "https://proteininformationresource.org/cgi-bin/pirrule?id=PIRSR038013-50" } ], "binding_site_uniprot": 244, "amino_acid": "Ser", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "ligand shared between all trimeric partners", "eco_id": "ECO_0000256", "start_pos": 244, "end_pos": 244, "start_aa": "Ser", "end_aa": "Ser", "glycosite_overlap": "" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0A3B0ITQ7-1", "uniprot_ac": "A0A3B0ITQ7", "uniprot_id": "A0A3B0ITQ7_BOVIN", "mass": { "chemical_mass": 30662.0, "monoisotopic_mass": 30662.0 }, "refseq": { "ac": "XP_005208372", "name": "complement C1q tumor necrosis factor-related protein 7 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005208372" }, "gene_names": [ { "name": "C1QTNF7", "type": "recommended", "evidence": [ { "id": "A0A3B0ITQ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7" } ] }, { "name": "ADIG", "type": "synonym", "evidence": [ { "id": "XP_005208372", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005208372" } ] }, { "name": "C1QTNF7", "type": "synonym", "evidence": [ { "id": "XP_005208372", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005208372" } ] } ], "protein_names": [ { "name": "C1q and TNF related 7", "type": "synonym", "evidence": [ { "id": "A0A3B0ITQ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7/entry#names_and_taxonomy" } ] }, { "name": "complement C1q tumor necrosis factor-related protein 7 isoform X1", "type": "synonym", "evidence": [ { "id": "XP_005208372", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005208372" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0A3B0ITQ7", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "C1QTNF7", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7", "locus": { "chromosome": "6", "start_pos": 110586041, "end_pos": 110458105, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000010343", "url": "https://www.ensembl.org/id/ENSBTAG00000010343" } ] } } ], "crossref": [ { "id": "ENSBTAG00000010343", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000010343", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "540131", "url": "https://www.ncbi.nlm.nih.gov/gene/540131", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001073", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001073", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008160", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008160", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008983", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008983", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050392", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050392", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:540131", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:540131", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VWMEIFY", "url": "https://omabrowser.org/oma/group/VWMEIFY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A3B0ITQ7", "url": "https://www.orthodb.org/?gene=A0A3B0ITQ7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "E1B766", "url": "https://www.orthodb.org/?gene=E1B766", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "F1N0F4", "url": "https://www.orthodb.org/?gene=F1N0F4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15427", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15427", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15427:SF24", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15427:SF24", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00386", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00386", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF01391", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01391", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_005208372", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005208372", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A3B0ITQ7", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3B0ITQ7-1", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E1B766", "url": "https://www.uniprot.org/uniprotkb/E1B766", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E1B766-1", "url": "https://www.uniprot.org/uniprotkb/E1B766-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1N0F4", "url": "https://www.uniprot.org/uniprotkb/F1N0F4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1N0F4-1", "url": "https://www.uniprot.org/uniprotkb/F1N0F4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFVLLYVTSFAICASGQPRSNQFKGESYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGAAGLRGKAGPLGLAGEKGDQGETGKKGPMGPEGEKGEVGPPGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL", "length": 289, "header": "tr|A0A3B0ITQ7-1|A0A3B0ITQ7_BOVIN Isoform 1 of C1q and TNF related 7 OS=Bos taurus OX=9913 GN=C1QTNF7 PE=4 SV=1 CANONICAL=A0A3B0ITQ7-1" }, "isoforms": [ { "isoform_ac": "A0A3B0ITQ7-1", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7/entry#A0A3B0ITQ7-1", "sequence": { "sequence": "MFVLLYVTSFAICASGQPRSNQFKGESYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGAAGLRGKAGPLGLAGEKGDQGETGKKGPMGPEGEKGEVGPPGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL", "length": 289, "header": "tr|A0A3B0ITQ7-1|A0A3B0ITQ7_BOVIN Isoform 1 of C1q and TNF related 7 OS=Bos taurus OX=9913 GN=C1QTNF7 PE=4 SV=1 CANONICAL=A0A3B0ITQ7-1" }, "locus": { "chromosome": "6", "start_pos": 110585687, "end_pos": 110578205, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000081121.3", "url": "https://www.ensembl.org/id/ENSBTAT00000081121.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000068925.3", "url": "https://www.ensembl.org/id/ENSBTAP00000068925.3" } ] } }, { "isoform_ac": "E1B766-1", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7/entry#E1B766-1", "sequence": { "sequence": "MPRKEPKMFVLLYVTSFAICASGQPRSNQFKGESYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGAAVQHSPTRPTAAKNRDFLQLHTARQLSPTLSKQTSKDRTIGALFQEINTSLFWLALVELLPSPSLLCLPYNRPRNWRRGLRGKAGPLGLAGEKGDQGETGKKGPMGPEGEKGEVGPPGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL", "length": 373, "header": "tr|E1B766-1|A0A3B0ITQ7_BOVIN Computationally mapped isoform of C1q and TNF related 7 OS=Bos taurus OX=9913 GN=C1QTNF7 PE=4 SV=3 CANONICAL=A0A3B0ITQ7-1" }, "locus": { "chromosome": "6", "start_pos": 110585687, "end_pos": 110458307, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000013656.6", "url": "https://www.ensembl.org/id/ENSBTAT00000013656.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000013656.6", "url": "https://www.ensembl.org/id/ENSBTAP00000013656.6" } ] } }, { "isoform_ac": "F1N0F4-1", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7/entry#F1N0F4-1", "sequence": { "sequence": "MLQVLPFAPVDNRGVISSKERATPQGISVAFLACLGLQAPLERMVPPGPMVASAFQDEMVETAGKERKVKRGPQKQTSKDRTIGALFQEINTSLFWLALVELLPSPSLLCLPYNRPRNWRRGLRGKAGPLGLAGEKGDQGETGKKGPMGPEGEKGEVGPPGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL", "length": 331, "header": "tr|F1N0F4-1|A0A3B0ITQ7_BOVIN Computationally mapped isoform of C1q and TNF related 7 OS=Bos taurus OX=9913 GN=C1QTNF7 PE=4 SV=2 CANONICAL=A0A3B0ITQ7-1" }, "locus": { "chromosome": "6", "start_pos": 110585687, "end_pos": 110578221, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000044776.4", "url": "https://www.ensembl.org/id/ENSBTAT00000044776.4" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000042241.3", "url": "https://www.ensembl.org/id/ENSBTAP00000042241.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:540131", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:540131", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2QC08-1", "protein_name": "C1q and TNF related 7", "gene_name": "C1qtnf7", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPRKEPKMIVLLYVTSLAICASGQPRGNQAKGESYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLKGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPAGPPGPKGDRGDQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFNDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL", "length": 296 }, "evidence": [ { "id": "A0A3B0ITQ7", "url": "https://omabrowser.org/oma/group/A0A3B0ITQ7/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8BVD7-1", "protein_name": "Complement C1q tumor necrosis factor-related protein 7", "gene_name": "C1qtnf7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MIVLLYVTSLAICASGQPRANQAKGESYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLKGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPAGPPGPKGDRGDQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFNDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL", "length": 289 }, "evidence": [ { "id": "A0A3B0ITQ7", "url": "https://omabrowser.org/oma/group/A0A3B0ITQ7/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BXJ2-1", "protein_name": "Complement C1q tumor necrosis factor-related protein 7", "gene_name": "C1QTNF7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MFVLLYVTSFAICASGQPRGNQLKGENYSPRYICSIPGLPGPPGPPGANGSPGPHGRIGLPGRDGRDGRKGEKGEKGTAGLRGKTGPLGLAGEKGDQGETGKKGPIGPEGEKGEVGPIGPPGPKGDRGEQGDPGLPGVCRCGSIVLKSAFSVGITTSYPEERLPIIFNKVLFNEGEHYNPATGKFICAFPGIYYFSYDITLANKHLAIGLVHNGQYRIKTFDANTGNHDVASGSTVIYLQPEDEVWLEIFFTDQNGLFSDPGWADSLFSGFLLYVDTDYLDSISEDDEL", "length": 289 }, "evidence": [ { "id": "A0A3B0ITQ7", "url": "https://omabrowser.org/oma/group/A0A3B0ITQ7/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0ITQ7", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0ITQ7", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "A0A3B0ITQ7", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 49, "end_pos": 51, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0A3B0ITQ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3B0ITQ7" }, { "id": "PS50871", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50871" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "C1q", "eco_id": "ECO_0000259", "start_pos": 143, "end_pos": 279, "start_aa": "Ser", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 49, "end_pos": 51 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6RYW0-1", "uniprot_ac": "F6RYW0", "uniprot_id": "F6RYW0_BOVIN", "mass": { "chemical_mass": 92238.0, "monoisotopic_mass": 92238.0 }, "refseq": {}, "gene_names": [ { "name": "DLGAP5", "type": "recommended", "evidence": [ { "id": "F6RYW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RYW0" } ] } ], "protein_names": [ { "name": "DLG associated protein 5", "type": "synonym", "evidence": [ { "id": "F6RYW0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RYW0/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6RYW0", "url": "https://www.uniprot.org/uniprotkb/F6RYW0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "DLGAP5", "url": "https://www.uniprot.org/uniprotkb/F6RYW0", "locus": { "chromosome": "10", "start_pos": 67631639, "end_pos": 67677160, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000002331", "url": "https://www.ensembl.org/id/ENSBTAG00000002331" } ] } } ], "crossref": [ { "id": "ENSBTAG00000002331", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000002331", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR005026", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005026", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:509161", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:509161", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PFDMPML", "url": "https://omabrowser.org/oma/group/PFDMPML/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR12353", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12353", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12353:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12353:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03359", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF03359", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0AAA9SXK4", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SXK4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SXK4-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SXK4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RYW0", "url": "https://www.uniprot.org/uniprotkb/F6RYW0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RYW0-1", "url": "https://www.uniprot.org/uniprotkb/F6RYW0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSSHFASRHRKDLSTDMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLESRSLLELDETSQELVPEKASIKPKSTKTVVFDQRKQMLQKYKEEKQLQKLKEQREKTKRGVFKVGLYKPDMPCFLFSNQNAMKAEPKKDVPSSVRITRSKARNQMELTKSGNGIDVRAIRPGQRQTSEKKVLDKEKKAVQPVMLPVRMTRSSTQAAKQIVKEIPSTAARKPESRAVNDNEADRKAPNQGKPAKKIGTKPDKVISFKVDNEENTLDSQTSATNGMNPDGVLSKMENVSKTNSAKMKGKNSFAPKDFIFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLNTEVDKTEATKEILAQKCKTFSAKTVPQDSSKSQCPLGSLTVWNKGKEEVPSLEVNEDQLSQPQHDVPYFRNILRSETEKLTSHCLEWDRKLDLDIPDDAKDLIRTAVGQTRLLMKERFKQFEGLVDNCEYKRGEKETTCTDLDGFWDMVSFQIEDVNQKFSNLTKLEESGWQNNNNTSKKVFRKKVVSGIASKPKQDDGGRIAARNRLAAIKNAMRERIKQEEQAEAATSVMPKEVDKIVFDAGFFRIESPIKSFSGLSSECLSQRLKTPQSVSKTVSETRAEMGLIRQTTSPENPGPQGAKSEHVDKTLISCIPGNRNSIGEDAKCLGLQDLIEINHGINKINFEIDCLSSERMNSALHAGKVADDINTNKKEEISDIVEGMELNSVTTQDVLMISPEKNIQSQNNISWEEETKTSQPVLCDNKSLTTECHLLDSVERRHQEQTRHISFGGNLISFSPLRPLSGEQPEEF", "length": 817, "header": "tr|F6RYW0-1|F6RYW0_BOVIN Isoform 1 of DLG associated protein 5 OS=Bos taurus OX=9913 GN=DLGAP5 PE=3 SV=1 CANONICAL=F6RYW0-1" }, "isoforms": [ { "isoform_ac": "A0AAA9SXK4-1", "url": "https://www.uniprot.org/uniprotkb/F6RYW0/entry#A0AAA9SXK4-1", "sequence": { "sequence": "MSSSHFASRHRKDLSTDMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLESRSLLELDETSQELVPEKASIKPKSTKTVVFDQRKQMLQKYKEEKQLQKLKEQREKTKRGVFKVGLYKPDMPCFLFSNQNAMKAEPKKDVPSSVRITRSKARNQMELTKSGNGIDVRAIRPGQRQTSEKKVLDKEKKAVQPVMLPVRMTRSSTQAAKQIVKEIPSTAARKPESRAVNDNEADRKAPNQGKPAKKIGTKPDKVISFKVDNEENTLDSQTSATNGMNPDGVLSKMENVSKTNSAKMKGKNSFAPKDFIFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLNTEVDKTEATKEILAQKCKTFSAKTVPQDSSKSQCPLGSLTVWNKGKEEVPSLEVNEDQLSQPQHDVPYFRNILRSETEKLTSHCLEWDRKLDLDIPDDAKDLIRTAVGQTRLLMKERFKQFEGLVDNCEYKRGEKETTCTDLDGFWDMVSFQIEDVNQKFSNLTKLEESGWQNNNNTSKKVFRKKVVSGIASKPKQDDGGRIAARNRLAAIKNAMRERIKQEEQAEAATSVMPKEVDKIVFDAGFFRIESPIKSFSGLSSECLSQRLKTPQSVSKTVSETRAEMGLIRQTTSPENPGPQGAKSEHVDKTLISCIPGNRNSIGEDAKCLGLQDLIEINHGINKINFEIDCLSSERMNSALHAGKVADDINTNKKEEISDIVEGMELNSVTTQDVLMISPEKNIQSQNNISWEEETKTSQPVLCDNKSLTTECHLLDSRN", "length": 784, "header": "tr|A0AAA9SXK4-1|F6RYW0_BOVIN Computationally mapped isoform of DLG associated protein 5 OS=Bos taurus OX=9913 GN=DLGAP5 PE=3 SV=1 CANONICAL=F6RYW0-1" }, "locus": { "chromosome": "10", "start_pos": 67673482, "end_pos": 67633809, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000126622.1", "url": "https://www.ensembl.org/id/ENSBTAT00000126622.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000088035.1", "url": "https://www.ensembl.org/id/ENSBTAP00000088035.1" } ] } }, { "isoform_ac": "F6RYW0-1", "url": "https://www.uniprot.org/uniprotkb/F6RYW0/entry#F6RYW0-1", "sequence": { "sequence": "MSSSHFASRHRKDLSTDMIRTKIAHRKSLSQKENRHKEYERNRHFGLKDVNIPTLESRSLLELDETSQELVPEKASIKPKSTKTVVFDQRKQMLQKYKEEKQLQKLKEQREKTKRGVFKVGLYKPDMPCFLFSNQNAMKAEPKKDVPSSVRITRSKARNQMELTKSGNGIDVRAIRPGQRQTSEKKVLDKEKKAVQPVMLPVRMTRSSTQAAKQIVKEIPSTAARKPESRAVNDNEADRKAPNQGKPAKKIGTKPDKVISFKVDNEENTLDSQTSATNGMNPDGVLSKMENVSKTNSAKMKGKNSFAPKDFIFQPLDGLKTYQVTPMTPRSANAFLTPSYTWTPLNTEVDKTEATKEILAQKCKTFSAKTVPQDSSKSQCPLGSLTVWNKGKEEVPSLEVNEDQLSQPQHDVPYFRNILRSETEKLTSHCLEWDRKLDLDIPDDAKDLIRTAVGQTRLLMKERFKQFEGLVDNCEYKRGEKETTCTDLDGFWDMVSFQIEDVNQKFSNLTKLEESGWQNNNNTSKKVFRKKVVSGIASKPKQDDGGRIAARNRLAAIKNAMRERIKQEEQAEAATSVMPKEVDKIVFDAGFFRIESPIKSFSGLSSECLSQRLKTPQSVSKTVSETRAEMGLIRQTTSPENPGPQGAKSEHVDKTLISCIPGNRNSIGEDAKCLGLQDLIEINHGINKINFEIDCLSSERMNSALHAGKVADDINTNKKEEISDIVEGMELNSVTTQDVLMISPEKNIQSQNNISWEEETKTSQPVLCDNKSLTTECHLLDSVERRHQEQTRHISFGGNLISFSPLRPLSGEQPEEF", "length": 817, "header": "tr|F6RYW0-1|F6RYW0_BOVIN Isoform 1 of DLG associated protein 5 OS=Bos taurus OX=9913 GN=DLGAP5 PE=3 SV=1 CANONICAL=F6RYW0-1" }, "locus": { "chromosome": "10", "start_pos": 67673482, "end_pos": 67632031, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000003008.7", "url": "https://www.ensembl.org/id/ENSBTAT00000003008.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000003008.6", "url": "https://www.ensembl.org/id/ENSBTAP00000003008.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:509161", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:509161", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "signaling", "id": "GO:0023052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0023052", "evidence": [ { "database": "UniProtKB", "id": "F6RYW0", "url": "https://www.uniprot.org/uniprotkb/F6RYW0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 291, "end_pos": 293, "annotation": "n_glycosylation_sequon" }, { "start_pos": 508, "end_pos": 510, "annotation": "n_glycosylation_sequon" }, { "start_pos": 521, "end_pos": 523, "annotation": "n_glycosylation_sequon" }, { "start_pos": 522, "end_pos": 524, "annotation": "n_glycosylation_sequon" }, { "start_pos": 753, "end_pos": 755, "annotation": "n_glycosylation_sequon" }, { "start_pos": 770, "end_pos": 772, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 291, "end_pos": 293 }, { "start_pos": 508, "end_pos": 510 }, { "start_pos": 521, "end_pos": 523 }, { "start_pos": 522, "end_pos": 524 }, { "start_pos": 753, "end_pos": 755 }, { "start_pos": 770, "end_pos": 772 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6J0-1", "uniprot_ac": "A0ABI0P6J0", "uniprot_id": "A0ABI0P6J0_BOVIN", "mass": { "chemical_mass": 20718.0, "monoisotopic_mass": 20718.0 }, "refseq": { "ac": "XP_005203130", "name": "microfibrillar-associated protein 2 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005203130" }, "gene_names": [ { "name": "MFAP2", "type": "recommended", "evidence": [ { "id": "A0ABI0P6J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0" } ] }, { "name": "MFAP2", "type": "synonym", "evidence": [ { "id": "XP_005203130", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005203130" } ] } ], "protein_names": [ { "name": "Microfibril associated protein 2", "type": "synonym", "evidence": [ { "id": "A0ABI0P6J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0/entry#names_and_taxonomy" } ] }, { "name": "microfibrillar-associated protein 2 isoform X1", "type": "synonym", "evidence": [ { "id": "XP_005203130", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005203130" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6J0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "MFAP2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0", "locus": { "chromosome": "2", "start_pos": 135615963, "end_pos": 135609739, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000003832", "url": "https://www.ensembl.org/id/ENSBTAG00000003832" } ] } } ], "crossref": [ { "id": "ENSBTAG00000003832", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000003832", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "281912", "url": "https://www.ncbi.nlm.nih.gov/gene/281912", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003582", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003582", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008673", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008673", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "A0A3Q1LQL8", "url": "https://www.orthodb.org/?gene=A0A3Q1LQL8", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A3Q1MAS0", "url": "https://www.orthodb.org/?gene=A0A3Q1MAS0", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "F1MWK6", "url": "https://www.orthodb.org/?gene=F1MWK6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16485", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16485", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16485:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16485:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05507", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF05507", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_005203130", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005203130", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A3Q1LQL8", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LQL8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LQL8-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LQL8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MAS0", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MAS0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MAS0-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MAS0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6J0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6J0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MWK6", "url": "https://www.uniprot.org/uniprotkb/F1MWK6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MWK6-1", "url": "https://www.uniprot.org/uniprotkb/F1MWK6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRAASLFLLFLPAGLLAQGQYDLDPLPPYPDHVQYTHYSEQIENPDYYDYPEMTPRPPEEQFQFQSQQQVQQEVIPAPTLEPGTVETEPTEPGPLDCREEQYPCTRLYSIHKPCKQCLNEVCFYSLRRVYVVNKEICVRTVCAHEELLRADLCRDKFSKCGVLASSGLCQSVAAACARSCGGC", "length": 183, "header": "tr|A0ABI0P6J0-1|A0ABI0P6J0_BOVIN Isoform 1 of Microfibril associated protein 2 OS=Bos taurus OX=9913 GN=MFAP2 PE=3 SV=1 CANONICAL=A0ABI0P6J0-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1LQL8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0/entry#A0A3Q1LQL8-1", "sequence": { "sequence": "MRAASLFLLFLPGLLAQGQYDLDPLPPYPDHVQYTHYSEQIENPDYYDYPEMTPRPPEEQFQFQSQQQVQQEVIPAPTLEPGTVETEPTEPGPLDCREEQYPCTRLYSIHKPCKQCLNEVCFYSLRRVYVVNKEICVRTVCAHEELLRADLCRDKFSKCGVLASSGLCQSVAAACARSCGGC", "length": 182, "header": "tr|A0A3Q1LQL8-1|A0ABI0P6J0_BOVIN Computationally mapped isoform of Microfibril associated protein 2 OS=Bos taurus OX=9913 GN=MFAP2 PE=3 SV=2 CANONICAL=A0ABI0P6J0-1" }, "locus": { "chromosome": "2", "start_pos": 135615616, "end_pos": 135611614, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000086139.2", "url": "https://www.ensembl.org/id/ENSBTAT00000086139.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000059288.2", "url": "https://www.ensembl.org/id/ENSBTAP00000059288.2" } ] } }, { "isoform_ac": "A0A3Q1MAS0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0/entry#A0A3Q1MAS0-1", "sequence": { "sequence": "AGSTESQPLYLPAGLLAQGQYDLDPLPPYPDHVQYTHYSEQIGKPTAHPQMTPRPPEEQFQFQSQQQVQQEVIPAPTLAQPPDPTCHPDCREEQYPCTRLYSIHKPCKQCLNEVCFYSLRRVYVVNKEICVRTVCAHEELLRADLCRDKFSKCGVLASSGLCQSVAAACARSCGGC", "length": 176, "header": "tr|A0A3Q1MAS0-1|A0ABI0P6J0_BOVIN Computationally mapped isoform of Microfibril associated protein 2 OS=Bos taurus OX=9913 GN=MFAP2 PE=3 SV=2 CANONICAL=A0ABI0P6J0-1" }, "locus": { "chromosome": "2", "start_pos": 135615616, "end_pos": 135612430, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000082039.2", "url": "https://www.ensembl.org/id/ENSBTAT00000082039.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000071136.2", "url": "https://www.ensembl.org/id/ENSBTAP00000071136.2" } ] } }, { "isoform_ac": "A0ABI0P6J0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0/entry#A0ABI0P6J0-1", "sequence": { "sequence": "MRAASLFLLFLPAGLLAQGQYDLDPLPPYPDHVQYTHYSEQIENPDYYDYPEMTPRPPEEQFQFQSQQQVQQEVIPAPTLEPGTVETEPTEPGPLDCREEQYPCTRLYSIHKPCKQCLNEVCFYSLRRVYVVNKEICVRTVCAHEELLRADLCRDKFSKCGVLASSGLCQSVAAACARSCGGC", "length": 183, "header": "tr|A0ABI0P6J0-1|A0ABI0P6J0_BOVIN Isoform 1 of Microfibril associated protein 2 OS=Bos taurus OX=9913 GN=MFAP2 PE=3 SV=1 CANONICAL=A0ABI0P6J0-1" }, "locus": { "chromosome": "2", "start_pos": 135615616, "end_pos": 135611614, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000154125.1", "url": "https://www.ensembl.org/id/ENSBTAT00000154125.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107420.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107420.1" } ] } }, { "isoform_ac": "F1MWK6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0/entry#F1MWK6-1", "sequence": { "sequence": "MRAASLFLLFLPAGLLAQGQYDLDPLPPYPDHVQYTHYSEQIEMTPRPPEEQFQFQSQQQVQQEVIPAPTLEPGTVETEPTEPGPLDCREEQYPCTRLYSIHKPCKQCLNEVCFYSLRRVYVVNKEICVRTVCAHEELLRADLCRDKFSKCGVLASSGLCQSVAAACARSCGGC", "length": 174, "header": "tr|F1MWK6-1|A0ABI0P6J0_BOVIN Computationally mapped isoform of Microfibril associated protein 2 OS=Bos taurus OX=9913 GN=MFAP2 PE=3 SV=4 CANONICAL=A0ABI0P6J0-1" }, "locus": { "chromosome": "2", "start_pos": 135615616, "end_pos": 135611614, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000004994.7", "url": "https://www.ensembl.org/id/ENSBTAT00000004994.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000004994.6", "url": "https://www.ensembl.org/id/ENSBTAP00000004994.6" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "microfibril", "id": "GO:0001527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001527", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6J0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6J0" }, { "id": "PS51670", "database": "PROSITE", "url": "https://prosite.expasy.org/PS51670" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "ShKT", "eco_id": "ECO_0000259", "start_pos": 153, "end_pos": 183, "start_aa": "Cys", "end_aa": "Cys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABZ3NNR0-1", "uniprot_ac": "A0ABZ3NNR0", "uniprot_id": "A0ABZ3NNR0_BOVIN", "mass": { "chemical_mass": 66911.0, "monoisotopic_mass": 66911.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Solute carrier family 23 member 2", "type": "recommended", "evidence": [ { "id": "A0ABZ3NNR0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNR0/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNR0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNR0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNR0", "locus": {} } ], "crossref": [ { "id": "ENSBTAG00000031548", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000031548", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSBTAG00000047605", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000047605", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR006042", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006042", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006043", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006043", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "A0A3Q1LUV5", "url": "https://www.orthodb.org/?gene=A0A3Q1LUV5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11119", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11119", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00860", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00860", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0A3Q1LUV5", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LUV5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LUV5-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LUV5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABZ3NNR0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNR0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABZ3NNR0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNR0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "METVADFILGGSKVTVDGVCSHEIKRHLCDGVISSHEGDQGSKKDGQLKSPSSSHMAYGILDIPPWYLCIFLGIQHFLTALGGLVAIPLILAKDLCLQHDPLTQSYLISTIFFVSGICTLLQVFLGIRLPILQGGTFAFLGPSLAMLSLPTWKCPVWTLNASQVNTSSPEFTEEWQKRIRELQGAVLVASCVQMLVGFSGLIGFLMRFIGPLTIAPTISLMALPLFDSAGDNAGIHWGIAATTIFLIVLFSQYLKNIAVPVPVYGQEKKSHTSKFYLFQIFPVLLGLCISWLLCFVLTVTDALPSAPTAYGYLARTDTKGSVLSQAPWFRFPYPGQWGLPTVSLAGVFGIIAAVISSMVESIGDYHACARLVGAPPPPKHAINRGIGIEGLGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIVAAGCVLLLMGIFGKIGAAFATIPTPVIGGMFLVMFGVITAVGISNLQYVDLNSSRNLFIFGFSIFCGLAIPNWVNKNPERLRTGILQLDQVIQVLLTTGMFVGGFLGFLLDNTIPGSLEERGLLAWNQVQEESEETTKALEVYGLPWGISTRFCTSSCAQYLPFWPREGKVGVRHLSLCPADSEEGPRSAADTRM", "length": 622, "header": "tr|A0ABZ3NNR0-1|A0ABZ3NNR0_BOVIN Isoform 1 of Solute carrier family 23 member 2 OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABZ3NNR0-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1LUV5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNR0/entry#A0A3Q1LUV5-1", "sequence": { "sequence": "MNSAITSCEHPNPLRCDGVISSHEGDQGSKKDGQLKSPSSSHMAYGILDIPPWYLCIFLGIQHFLTALGGLVAIPLILAKDLCLQHDPLTQSYLISTIFFVSGICTLLQVFLGIRLPILQGGTFAFLGPSLAMLSLPTWKCPVWTLNASQVNTSSPEFTEEWQKRIRELQGAVLVASCVQMLVGFSGLIGFLMRFIGPLTIAPTISLMALPLFDSAGDNAGIHWGIAATTIFLIVLFSQYLKNIAVPVPVYGQEKKSHTSKFYLFQIFPVLLGLCISWLLCFVLTVTDALPSAPTAYGYLARTDTKGSVLSQAPWFRFPYPGQWGLPTVSLAGVFGIIAAVISSMVESIGDYHACARLVGAPPPPKHAINRGIGIEGLGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIVAAGCVLLLMGIFGKIGAAFATIPTPVIGGMFLVMFGVITAVGISNLQYVDLNSSRNLFIFGFSIFCGLAIPNWVNKNPERLRTGILQLDQVIQVLLTTGMFVGGFLGFLLDNTIPGSLEERGLLAWNQVQEESEETTKALEVYGLPWGISTRFCTSSCAQYLPFWPREGKVGVRHLSLCPADSEEGPRSAADTRM", "length": 609, "header": "tr|A0A3Q1LUV5-1|A0ABZ3NNR0_BOVIN Computationally mapped isoform of Solute carrier family 23 member 2 OS=Bos taurus OX=9913 GN= PE=3 SV=3 CANONICAL=A0ABZ3NNR0-1" }, "locus": { "chromosome": "4", "start_pos": 99149329, "end_pos": 99084292, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000085778.3", "url": "https://www.ensembl.org/id/ENSBTAT00000085778.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000060954.3", "url": "https://www.ensembl.org/id/ENSBTAP00000060954.3" } ] } }, { "isoform_ac": "A0ABZ3NNR0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNR0/entry#A0ABZ3NNR0-1", "sequence": { "sequence": "METVADFILGGSKVTVDGVCSHEIKRHLCDGVISSHEGDQGSKKDGQLKSPSSSHMAYGILDIPPWYLCIFLGIQHFLTALGGLVAIPLILAKDLCLQHDPLTQSYLISTIFFVSGICTLLQVFLGIRLPILQGGTFAFLGPSLAMLSLPTWKCPVWTLNASQVNTSSPEFTEEWQKRIRELQGAVLVASCVQMLVGFSGLIGFLMRFIGPLTIAPTISLMALPLFDSAGDNAGIHWGIAATTIFLIVLFSQYLKNIAVPVPVYGQEKKSHTSKFYLFQIFPVLLGLCISWLLCFVLTVTDALPSAPTAYGYLARTDTKGSVLSQAPWFRFPYPGQWGLPTVSLAGVFGIIAAVISSMVESIGDYHACARLVGAPPPPKHAINRGIGIEGLGCLLAGAWGTGNGTTSYSENVGALGITRVGSRMVIVAAGCVLLLMGIFGKIGAAFATIPTPVIGGMFLVMFGVITAVGISNLQYVDLNSSRNLFIFGFSIFCGLAIPNWVNKNPERLRTGILQLDQVIQVLLTTGMFVGGFLGFLLDNTIPGSLEERGLLAWNQVQEESEETTKALEVYGLPWGISTRFCTSSCAQYLPFWPREGKVGVRHLSLCPADSEEGPRSAADTRM", "length": 622, "header": "tr|A0ABZ3NNR0-1|A0ABZ3NNR0_BOVIN Isoform 1 of Solute carrier family 23 member 2 OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABZ3NNR0-1" }, "locus": { "chromosome": "4", "start_pos": 99134112, "end_pos": 99084292, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000070216.3", "url": "https://www.ensembl.org/id/ENSBTAT00000070216.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000068838.3", "url": "https://www.ensembl.org/id/ENSBTAP00000068838.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNR0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNR0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "transmembrane transporter activity", "id": "GO:0022857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022857", "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNR0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNR0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 160, "end_pos": 162, "annotation": "n_glycosylation_sequon" }, { "start_pos": 165, "end_pos": 167, "annotation": "n_glycosylation_sequon" }, { "start_pos": 403, "end_pos": 405, "annotation": "n_glycosylation_sequon" }, { "start_pos": 479, "end_pos": 481, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 160, "end_pos": 162 }, { "start_pos": 165, "end_pos": 167 }, { "start_pos": 403, "end_pos": 405 }, { "start_pos": 479, "end_pos": 481 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6C2-1", "uniprot_ac": "A0ABI0P6C2", "uniprot_id": "A0ABI0P6C2_BOVIN", "mass": { "chemical_mass": 33463.0, "monoisotopic_mass": 33463.0 }, "refseq": { "ac": "XP_024835939", "name": "dehydrogenase/reductase SDR family member 7B isoform X2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024835939" }, "gene_names": [ { "name": "DHRS7B", "type": "recommended", "evidence": [ { "id": "A0ABI0P6C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" } ] }, { "name": "DHRS7B", "type": "synonym", "evidence": [ { "id": "XP_024835939", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024835939" } ] } ], "protein_names": [ { "name": "Peroxisomal reductase activating PPAR-gamma", "type": "recommended", "evidence": [ { "id": "A0ABI0P6C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2/entry#names_and_taxonomy" } ] }, { "name": "1.1.1.101", "type": "synonym", "evidence": [ { "id": "A0ABI0P6C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2/entry#names_and_taxonomy" } ] }, { "name": "Dehydrogenase/reductase SDR family member 7B", "type": "synonym", "evidence": [ { "id": "A0ABI0P6C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2/entry#names_and_taxonomy" } ] }, { "name": "Short-chain dehydrogenase/reductase family 32C member 1", "type": "synonym", "evidence": [ { "id": "A0ABI0P6C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2/entry#names_and_taxonomy" } ] }, { "name": "dehydrogenase/reductase SDR family member 7B isoform X2", "type": "synonym", "evidence": [ { "id": "XP_024835939", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024835939" } ] } ], "function": [ { "annotation": "Reductase required for adipogenesis and activation of PPARG nuclear receptor. Can convert acyl and alkyl dihydroxyacetone-phosphate (DHAP) into glycerolipids and ether lipids, respectively, synthesizing ether-linked phospholipids that act as agonists for PPARG. Also regulates adipogenesis by preventing adipocyte browning: following import into the nucleus, interacts with PRDM16, inhibiting the interaction between PRDM16 and PPARG and preventing differentiation of brown adipocytes.", "evidence": [ { "database": "UniProtKB", "id": "A0A3Q1M1E6", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1M1E6#function" }, { "database": "UniProtKB", "id": "ARBA00094406", "url": "https://www.uniprot.org/uniprotkb/ARBA00094406#function" }, { "database": "UniProtKB", "id": "F1MN23", "url": "https://www.uniprot.org/uniprotkb/F1MN23#function" }, { "database": "UniProtKB", "id": "A0ABI0P6C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "DHRS7B", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2", "locus": { "chromosome": "19", "start_pos": 35212185, "end_pos": 35165054, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000010559", "url": "https://www.ensembl.org/id/ENSBTAG00000010559" } ] } } ], "crossref": [ { "id": "ENSBTAG00000010559", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000010559", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd05332", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05332", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "522283", "url": "https://www.ncbi.nlm.nih.gov/gene/522283", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR002347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020904", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020904", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036291", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036291", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR057326", "url": "https://www.ebi.ac.uk/interpro/entry/IPR057326", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "YFWIMAK", "url": "https://omabrowser.org/oma/group/YFWIMAK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "F1MN23", "url": "https://www.orthodb.org/?gene=F1MN23", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR44196", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR44196", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR44196:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR44196:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00106", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00106", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-75896", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-75896", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "XP_024835939", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024835939", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "17341", "url": "https://www.rhea-db.org/rhea/17341", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "36175", "url": "https://www.rhea-db.org/rhea/36175", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A3Q1M1E6", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1M1E6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1M1E6-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1M1E6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6C2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MN23", "url": "https://www.uniprot.org/uniprotkb/F1MN23", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MN23-1", "url": "https://www.uniprot.org/uniprotkb/F1MN23-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDFITSTAILPLLLGCVGLFSLFKLLQWLRMRAYVRNAVVVITGATSGLGRECARVFHAAGARLVLCGRNAEALEELSQELAASRAPEVQTHKPCTVTFDLADPGAIAGAASEILQCFGHVDVLINNAGISYRGAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRRQGHVVAISSIQGKISLPFRSAYAASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNLSLNAVTADGSKYGVMDETTAQGRSPVQVAQDILAALGKKKKDVVLADPMPSLAVYLRTLAPGLFFRLMASRARKERKSKHS", "length": 310, "header": "tr|A0ABI0P6C2-1|A0ABI0P6C2_BOVIN Isoform 1 of Peroxisomal reductase activating PPAR-gamma OS=Bos taurus OX=9913 GN=DHRS7B PE=3 SV=1 CANONICAL=A0ABI0P6C2-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1M1E6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2/entry#A0A3Q1M1E6-1", "sequence": { "sequence": "MDPLILVPYLPRAERSPGPEDLGWRAMCQVLQEHQMCPRRKSLLRARVMDFITSTAILPLLLGCVGLFSLFKLLQWLRMRAYVRNAVVVITGATSGLGRECARVFHAAGARLVLCGRNAEALEELSQELAASRAPEVQTHKPCTVTFDLADPGAIAGAASEILQCFGHVDVLINNAGISYRGAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRRQGHVVAISSIQGKISLPFRSAYAASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNLSLNAVTADGSKYGVMDETTAQGRSPVQVAQDILAALGKKKKDVVLADPMPSLAVYLRTLAPGLFFRLMASRARKERKSKHS", "length": 358, "header": "tr|A0A3Q1M1E6-1|A0ABI0P6C2_BOVIN Computationally mapped isoform of Peroxisomal reductase activating PPAR-gamma OS=Bos taurus OX=9913 GN=DHRS7B PE=3 SV=1 CANONICAL=A0ABI0P6C2-1" }, "locus": { "chromosome": "19", "start_pos": 35211940, "end_pos": 35189177, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000081450.2", "url": "https://www.ensembl.org/id/ENSBTAT00000081450.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000061879.2", "url": "https://www.ensembl.org/id/ENSBTAP00000061879.2" } ] } }, { "isoform_ac": "A0ABI0P6C2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2/entry#A0ABI0P6C2-1", "sequence": { "sequence": "MDFITSTAILPLLLGCVGLFSLFKLLQWLRMRAYVRNAVVVITGATSGLGRECARVFHAAGARLVLCGRNAEALEELSQELAASRAPEVQTHKPCTVTFDLADPGAIAGAASEILQCFGHVDVLINNAGISYRGAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRRQGHVVAISSIQGKISLPFRSAYAASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNLSLNAVTADGSKYGVMDETTAQGRSPVQVAQDILAALGKKKKDVVLADPMPSLAVYLRTLAPGLFFRLMASRARKERKSKHS", "length": 310, "header": "tr|A0ABI0P6C2-1|A0ABI0P6C2_BOVIN Isoform 1 of Peroxisomal reductase activating PPAR-gamma OS=Bos taurus OX=9913 GN=DHRS7B PE=3 SV=1 CANONICAL=A0ABI0P6C2-1" }, "locus": { "chromosome": "19", "start_pos": 35211940, "end_pos": 35198518, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000136532.1", "url": "https://www.ensembl.org/id/ENSBTAT00000136532.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106868.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106868.1" } ] } }, { "isoform_ac": "F1MN23-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2/entry#F1MN23-1", "sequence": { "sequence": "MVSAATRKSLLRARVMDFITSTAILPLLLGCVGLFSLFKLLQWLRMRAYVRNAVVVITGATSGLGRECARVFHAAGARLVLCGRNAEALEELSQELAASRAPEVQTHKPCTVTFDLADPGAIAGAASEILQCFGHVDVLINNAGISYRGAIVDTSPDVDKRVMETNYFGPVALTKALLPAMIRRRQGHVVAISSIQGKISLPFRSAYAASKHATQAFFDCLRAEVEQHDIEVTVISPGYIHTNLSLNAVTADGSKYGVMDETTAQGRSPVQVAQDILAALGKKKKDVVLADPMPSLAVYLRTLAPGLFFRLMASRARKERKSKHS", "length": 325, "header": "tr|F1MN23-1|A0ABI0P6C2_BOVIN Computationally mapped isoform of Peroxisomal reductase activating PPAR-gamma OS=Bos taurus OX=9913 GN=DHRS7B PE=3 SV=1 CANONICAL=A0ABI0P6C2-1" }, "locus": { "chromosome": "19", "start_pos": 35211940, "end_pos": 35165071, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000013968.7", "url": "https://www.ensembl.org/id/ENSBTAT00000013968.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000013968.5", "url": "https://www.ensembl.org/id/ENSBTAP00000013968.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "R-BTA-75896", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-75896", "resource": "Reactome", "description": "Plasmalogen biosynthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A287A1V9-1", "protein_name": "Peroxisomal reductase activating PPAR-gamma", "gene_name": "DHRS7B", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MDLITSTATLPLLFGCVGVFGLLKLLQWLRTRAYVRDAVVVITGATSGLGRECARAFSAAGARLVLCGRNAEALEELSRELAASPAAKVQTHKPHTVTFDLADPGAIVGAAAEILRCFGHVDVLINNAGISYRGAVVDTSLDVDKRVMETNYFGPVALTKALLPSMIRRRQGHIVAISSIQGRISIPFRSAYAASKHATQAFFDCLRAEVEQHGVEVTVISPGYIHTHLSLNALTADGSKYGVMDESTAQGRSPAEVARDVLAAVGQRKKDVVLAGLAPSLAVYLRTLAPGLFFSLMASRARKERKSKHC", "length": 310 }, "evidence": [ { "id": "A0ABI0P6C2", "url": "https://omabrowser.org/oma/group/A0ABI0P6C2/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0A3Q2UBH5-1", "protein_name": "Peroxisomal reductase activating PPAR-gamma", "gene_name": "DHRS7B", "tax_id": 9031, "organism": "Gallus gallus", "sequence": { "sequence": "MDLTSTVIIPLLFGSLGLFSLFRLLQWMRMRAYLRGAVVVVTGATSGLGKECAKAFHAAGSRLVLCGRDSEKLKDLAQELSAMTDHRKNIHKPHTVVFDLSDTKTILNAAEEILKHLGHVDILINNAGISYRGTIVDTGLDVDKKVMETNYFGPIALTKALLPSMIKRRQGHIVAISSVQGKISIPFRSAYAASKHATQAFFDCLRAEVEQYDIDVTVISPGYIQTNLSLNAVTADGSRYGVMDKNTAEGKTAAEVAQVVLCAVGQKKKEVLIAGLKPSLAVYLRNLFPRLFFNLMAARAKKERKTKDS", "length": 309 }, "evidence": [ { "id": "A0ABI0P6C2", "url": "https://omabrowser.org/oma/group/A0ABI0P6C2/", "database": "OMA" } ], "glygen_name": "Chicken", "common_name": "Chicken" }, { "uniprot_canonical_ac": "Q5RJY4-1", "protein_name": "Peroxisomal reductase activating PPAR-gamma", "gene_name": "Dhrs7b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MISPSSRKGMLKERAMDLVTQTTILPLLFGCLGIFSLFRLLQRTRSKAYLRNAVVVVTGATSGLGKECARVFHAAGAKVVLCGRNVKALEEFTRELADSSSSQGQTHQPCVVTFDLADPGAIAPAAAEILQCFGYVDILINNAGISYRGAISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKRGHIVAISSIQGKISIPFRSAYAASKHATQAFFDCLRAEMKDSDIEVTVISPGYIHTNLSVNAVTADGSRYGALDKNTAQGRSAVEVAQDIFDAVGKKKKDVLLTDFLPTMAVYIRTLAPRLFFRIMASRARKERKSKNS", "length": 325 }, "evidence": [ { "id": "A0ABI0P6C2", "url": "https://omabrowser.org/oma/group/A0ABI0P6C2/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6IAN0-1", "protein_name": "Peroxisomal reductase activating PPAR-gamma", "gene_name": "DHRS7B", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MVSPATRKSLPKVKAMDFITSTAILPLLFGCLGVFGLFRLLQWVRGKAYLRNAVVVITGATSGLGKECAKVFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGYVDILVNNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAASKHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAVGKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS", "length": 325 }, "evidence": [ { "id": "A0ABI0P6C2", "url": "https://omabrowser.org/oma/group/A0ABI0P6C2/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "Q99J47-1", "protein_name": "Peroxisomal reductase activating PPAR-gamma", "gene_name": "Dhrs7b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MISPSFRKGMLKERVMDLASQTTILPLLFGCLGIFSLFRLLQRIRSKAYLRNAVVVVTGATSGLGRECAKVFHAAGAKLVLCGRNVKALEELSRELAGSSQGQTHQPFVVTFDLADPGTIAAAAAEILQCFGYVDVLINNAGISYRGTISDTIVDVDRKVMEINYFGPVALTKALLPSMVERKQGHIVAISSIQGKISIPFRSAYSASKHATQAFFDCLRAEMEEANIKVTVISPGYIHTNLSVNAVTADGSRYGALDKNTAQGRSAAEVAQDVFDAVGKKKKDVLLTDFVPSMAVYIRTLAPGLFFRIMASRARKERKSKSS", "length": 323 }, "evidence": [ { "id": "A0ABI0P6C2", "url": "https://omabrowser.org/oma/group/A0ABI0P6C2/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9Y140-1", "protein_name": "Dehydrogenase/reductase SDR family protein 7-like", "gene_name": "", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MKVQDMDKCAPSSDWNVLYWVLGTVLMPVALPLAIINIWQRFQAQKFRNQLPGKVVLITGASSGLGESLAHVFYRAGCRVILAARRTQELERVKKDLLALDVDPAYPPTVLPLDLAELNSIPEFVTRVLAVYNQVDILINNGGISVRADVASTAVDVDLKVMVVNYFGSVALTKALLPSMVKRGSGHICFISSVQGKFAIPQRAAYSASKHAMQAFADSLRAEVANKNINVSCVSPGYIRTQLSLNALTGSGSSYGKVDETTAKGMSPDKLAERILQCILRKEPDIIVSDVQAKIAYYLRHLCPSLYFWIMAKRAVKLENAEKKST", "length": 326 }, "evidence": [ { "id": "A0ABI0P6C2", "url": "https://omabrowser.org/oma/group/A0ABI0P6C2/", "database": "OMA" } ], "glygen_name": "Fruit fly", "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "lipid metabolic process", "id": "GO:0006629", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor", "id": "GO:0016616", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016616", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" } ], "pmid": "" }, { "name": "oxidoreductase activity", "id": "GO:0016491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016491", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 228, "end_pos": 230, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "17341", "name": "", "equation": "1-hexadecanoyl-sn-glycero-3-phosphate + NADP(+) = 1-hexadecanoylglycerone 3-phosphate + NADPH + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0ABI0P6C2-1", "Q3T0R4-1" ], "evidence": [ { "id": "17341", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17341" } ] }, { "id": "36175", "name": "", "equation": "a 1-O-alkylglycerone 3-phosphate + NADPH + H(+) = a 1-O-alkyl-sn-glycero-3-phosphate + NADP(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A0ABI0P6C2-1", "Q3T0R4-1" ], "evidence": [ { "id": "36175", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/36175" } ] }, { "id": "R-BTA-75883", "name": "DHRS7B reduces GO3P to HXDG3P", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "cytosol", "input_participant_list": [ "R-ALL-75973" ], "output_participant_list": [ "R-ALL-390422" ], "enzyme_list": [ "A0ABI0P6C2-1" ], "evidence": [ { "id": "R-BTA-75883", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-75883" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-390422", "participant_name": "HXDG3P [cytosol]", "crossref": [ { "id": "ZINC000059303559", "database": "ZINC", "url": "" }, { "id": "63818", "database": "ChEBI", "url": "" }, { "id": "HMDB0062325", "database": "HMDB Metabolite", "url": "" } ] }, { "participant_id": "R-ALL-75973", "participant_name": "GO3P [cytosol]", "crossref": [ { "id": "73315", "database": "ChEBI", "url": "" }, { "id": "C03372", "database": "COMPOUND", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0ABI0P6C2", "gene_name": "DHRS7B", "activity": [ { "ec_number": "1.1.1.101", "activity": "1-hexadecanoyl-sn-glycero-3-phosphate + NADP(+) = 1-hexadecanoylglycerone 3-phosphate + NADPH + H(+).", "evidence": [ { "id": "A0ABI0P6C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" } ] }, { "ec_number": "1.1.1.101", "activity": "", "evidence": [ { "id": "A0ABI0P6C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" } ] } ] }, { "uniprot_ac": "Q3T0R4", "gene_name": "DHRS7B", "activity": [ { "ec_number": "1.1.1.101", "activity": "1-hexadecanoyl-sn-glycero-3-phosphate + NADP(+) = 1-hexadecanoylglycerone 3-phosphate + NADPH + H(+).", "evidence": [ { "id": "Q3T0R4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q3T0R4" } ] }, { "ec_number": "1.1.1.101", "activity": "", "evidence": [ { "id": "Q3T0R4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q3T0R4" } ] } ] } ], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6C2" }, { "id": "SM00822", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM00822" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ketoreductase", "eco_id": "ECO_0000259", "start_pos": 38, "end_pos": 228, "start_aa": "Ala", "end_aa": "Asn", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "1.1.1.101", "ec_name": "1-hexadecanoyl-sn-glycero-3-phosphate + NADP(+) = 1-hexadecanoylglycerone 3-phosphate + NADPH + H(+).", "evidence": [ { "id": "1.1.1.101", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:1.1.1.101" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 228, "end_pos": 230 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6P2-1", "uniprot_ac": "A0ABI0P6P2", "uniprot_id": "A0ABI0P6P2_BOVIN", "mass": { "chemical_mass": 21945.0, "monoisotopic_mass": 21945.0 }, "refseq": {}, "gene_names": [ { "name": "EIF5A2", "type": "recommended", "evidence": [ { "id": "A0ABI0P6P2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2" } ] } ], "protein_names": [ { "name": "Eukaryotic translation initiation factor 5A2", "type": "synonym", "evidence": [ { "id": "A0ABI0P6P2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Translation factor that promotes translation elongation and termination, particularly upon ribosome stalling at specific amino acid sequence contexts. Binds between the exit (E) and peptidyl (P) site of the ribosome and promotes rescue of stalled ribosome: specifically required for efficient translation of polyproline-containing peptides as well as other motifs that stall the ribosome. Acts as ribosome quality control (RQC) cofactor by joining the RQC complex to facilitate peptidyl transfer during CAT tailing step.", "evidence": [ { "database": "UniProtKB", "id": "A0AAA9S8A2", "url": "https://www.uniprot.org/uniprotkb/A0AAA9S8A2#function" }, { "database": "UniProtKB", "id": "RU362005", "url": "https://www.uniprot.org/uniprotkb/RU362005#function" }, { "database": "UniProtKB", "id": "A0A3Q1LSN7", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LSN7#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6P2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "EIF5A2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2", "locus": { "chromosome": "1", "start_pos": 96560504, "end_pos": 96540930, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000010550", "url": "https://www.ensembl.org/id/ENSBTAG00000010550" } ] } } ], "crossref": [ { "id": "cd04468", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04468", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001884", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001884", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008991", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008991", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012340", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012340", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014722", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014722", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019769", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019769", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020189", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020189", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048670", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048670", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11673", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11673", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01287", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01287", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF21485", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF21485", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0A3Q1LSN7", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LSN7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LSN7-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LSN7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9S8A2", "url": "https://www.uniprot.org/uniprotkb/A0AAA9S8A2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9S8A2-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9S8A2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6P2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6P2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCGLGWVPRTEDPGGGGGPGGAVREGRPAVGRWGPGFAAPRAVPSEESPQPTMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK", "length": 205, "header": "tr|A0ABI0P6P2-1|A0ABI0P6P2_BOVIN Isoform 1 of Eukaryotic translation initiation factor 5A2 OS=Bos taurus OX=9913 GN=EIF5A2 PE=3 SV=1 CANONICAL=A0ABI0P6P2-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1LSN7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2/entry#A0A3Q1LSN7-1", "sequence": { "sequence": "MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQVSVMCAMSEEYAVAIKPCK", "length": 109, "header": "tr|A0A3Q1LSN7-1|A0ABI0P6P2_BOVIN Computationally mapped isoform of Eukaryotic translation initiation factor 5A2 OS=Bos taurus OX=9913 GN=EIF5A2 PE=3 SV=1 CANONICAL=A0ABI0P6P2-1" }, "locus": { "chromosome": "1", "start_pos": 96557619, "end_pos": 96541824, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000079770.3", "url": "https://www.ensembl.org/id/ENSBTAT00000079770.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000058098.2", "url": "https://www.ensembl.org/id/ENSBTAP00000058098.2" } ] } }, { "isoform_ac": "A0AAA9S8A2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2/entry#A0AAA9S8A2-1", "sequence": { "sequence": "MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQNNIFYFYCEDFVISYLLQSYIPSETDQIIATLT", "length": 167, "header": "tr|A0AAA9S8A2-1|A0ABI0P6P2_BOVIN Computationally mapped isoform of Eukaryotic translation initiation factor 5A2 OS=Bos taurus OX=9913 GN=EIF5A2 PE=3 SV=1 CANONICAL=A0ABI0P6P2-1" }, "locus": { "chromosome": "1", "start_pos": 96560128, "end_pos": 96541824, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000093187.2", "url": "https://www.ensembl.org/id/ENSBTAT00000093187.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000078382.1", "url": "https://www.ensembl.org/id/ENSBTAP00000078382.1" } ] } }, { "isoform_ac": "A0ABI0P6P2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2/entry#A0ABI0P6P2-1", "sequence": { "sequence": "MCGLGWVPRTEDPGGGGGPGGAVREGRPAVGRWGPGFAAPRAVPSEESPQPTMADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK", "length": 205, "header": "tr|A0ABI0P6P2-1|A0ABI0P6P2_BOVIN Isoform 1 of Eukaryotic translation initiation factor 5A2 OS=Bos taurus OX=9913 GN=EIF5A2 PE=3 SV=1 CANONICAL=A0ABI0P6P2-1" }, "locus": { "chromosome": "1", "start_pos": 96557619, "end_pos": 96541425, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000136631.1", "url": "https://www.ensembl.org/id/ENSBTAT00000136631.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107224.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107224.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6P2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2" } ], "pmid": "" }, { "name": "translation elongation factor activity", "id": "GO:0003746", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003746", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6P2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2" } ], "pmid": "" }, { "name": "ribosome binding", "id": "GO:0043022", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043022", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6P2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6P2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "positive regulation of translational elongation", "id": "GO:0045901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045901", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6P2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2" } ], "pmid": "" }, { "name": "positive regulation of translational termination", "id": "GO:0045905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045905", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6P2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6P2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6P2" }, { "id": "SM01376", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM01376" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Translation initiation factor 5A C-terminal", "eco_id": "ECO_0000259", "start_pos": 135, "end_pos": 202, "start_aa": "Asn", "end_aa": "Lys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P597-1", "uniprot_ac": "A0ABI0P597", "uniprot_id": "A0ABI0P597_BOVIN", "mass": { "chemical_mass": 123581.0, "monoisotopic_mass": 123581.0 }, "refseq": { "ac": "NP_001359051", "name": "importin-5", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001359051" }, "gene_names": [ { "name": "IPO5", "type": "recommended", "evidence": [ { "id": "A0ABI0P597", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597" } ] }, { "name": "IPO5", "type": "synonym", "evidence": [ { "id": "NP_001359051", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001359051" } ] } ], "protein_names": [ { "name": "Importin-5", "type": "recommended", "evidence": [ { "id": "A0ABI0P597", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597/entry#names_and_taxonomy" } ] }, { "name": "Importin subunit beta-3", "type": "synonym", "evidence": [ { "id": "A0ABI0P597", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597/entry#names_and_taxonomy" } ] }, { "name": "Karyopherin beta-3", "type": "synonym", "evidence": [ { "id": "A0ABI0P597", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597/entry#names_and_taxonomy" } ] }, { "name": "Ran-binding protein 5", "type": "synonym", "evidence": [ { "id": "A0ABI0P597", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597/entry#names_and_taxonomy" } ] }, { "name": "importin-5", "type": "synonym", "evidence": [ { "id": "NP_001359051", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001359051" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P597", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "IPO5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597", "locus": { "chromosome": "12", "start_pos": 75070803, "end_pos": 75029792, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000039374", "url": "https://www.ensembl.org/id/ENSBTAG00000039374" } ] } } ], "crossref": [ { "id": "ENSBTAG00000039374", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000039374", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "508273", "url": "https://www.ncbi.nlm.nih.gov/gene/508273", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000357", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000357", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001494", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001494", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011989", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011989", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034085", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034085", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040122", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040122", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040928", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040928", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041389", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041389", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041653", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041653", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR057672", "url": "https://www.ebi.ac.uk/interpro/entry/IPR057672", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR058584", "url": "https://www.ebi.ac.uk/interpro/entry/IPR058584", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR10527", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10527", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02985", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02985", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF13513", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13513", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF18808", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF18808", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF18816", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF18816", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF18829", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF18829", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF25574", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF25574", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF25780", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF25780", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001359051", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001359051", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A3Q1LV36", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LV36", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LV36-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LV36-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P597", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P597-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MPE5", "url": "https://www.uniprot.org/uniprotkb/F1MPE5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MPE5-1", "url": "https://www.uniprot.org/uniprotkb/F1MPE5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTAAAEEARQMAAVLLRRLLSSAFDEVYPTLPTDVQTAIKSELLMIIQMETQSSMRKKICDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNMGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIRTLSARATAAFILANEHNVALFKHFADLLPGFLQAVNDSCYQNDDSVLKSLVEIADTVPKYLRPHLEATLQLSLKLCGDTGLNNMQRQLALEVIVTLSETAAAMLRKHTNIVAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQMLQNPDWKYRHAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAACNAVGQMATDFAPGFQKKFHEKVIAALLQTMEDQGNQRVQAHAAAALINFTEDCPKSLLIPYLDSLVKHLHSIMVLKLQELIQKGTKLVLEQVVTSIASVADTAEEKFVPYYDLFMPSLKHIVENAVQKELRLLRGKTIECISLIGLAVGKEKFMQDASDVMQLLLKTQTDFSDMEDDDPQISYMISAWARMCKILGKEFQQYLPVVMGPLMKTASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIKTAGLEEKSTACQMLVCYAKELKEGFVEYTEQVVKLMVPLLKFYFHDGVRVAAAESMPLLLECARVRGPEYLTQMWHFMCDALIKAIGTEPDSDVLSEIMHSFAKCIEVMGDGCLNNEHFEELGGILKAKLEEHFKNQELRQVKRQDEDYDEQVEESLQDEDDNDVYILTKVSDILHSIFSSYKEKVLPWFEQLLPLIVNLICPHRPWPDRQWGLCIFDDVIEHCSPASFKYAEYFLRPMLQYVCDSSPEVRQAAAYGLGVMAQYGGDNYRPFCTEALPLLVRVIQSADAKTKENINATENCISAVGKMMKFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFNYLCDLIESNHPIVLGPNNTNLPKIFSIIAEGEMHEAIKHDDPCAKRLANVVRQVQTSGGLWTECIAQLSPEQQAAIQELLNSA", "length": 1097, "header": "tr|A0ABI0P597-1|A0ABI0P597_BOVIN Isoform 1 of Importin-5 OS=Bos taurus OX=9913 GN=IPO5 PE=1 SV=1 CANONICAL=A0ABI0P597-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1LV36-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597/entry#A0A3Q1LV36-1", "sequence": { "sequence": "MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTAAAEEARQMAAVLLRRLLSSAFDEVYPTLPTDVQTAIKSELLMIIQMETQSSMRKKICDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNMGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIRTLSARATAAFILANEHNVALFKHFADLLPGFLQAVNDSCYQNDDSVLKSLVEIADTVPKYLRPHLEATLQLSLKLCGDTGLNNMQRQLALEVIVTLSETAAAMLRKHTNIVAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQMLQNPDWKYRHAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAACNAVGQMATDFAPGFQKKFHEKVIAALLQTMEDQGNQRVQAHAAAALINFTEDCPKSLLIPYLDSLVKHLHSIMVLKLQELIQKGTKLVLEQVVTSIASVADTAEEKFVPYYDLFMPSLKHIVENAVQKELRLLRGKTIECISLIGLAVGKEKFMQDASDVMQLLLKTQTDFSDMEDDDPQISYMISAWARMCKILGKEFQQYLPVVMGPLMKTASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIKTAGLEEKSTACQMLCIEVMGDGCLNNEHFEELGGILKAKLEEHFKNQELRQVKRQDEDYDEQVEESLQDEDDNDVYILTKVSDILHSIFSSYKEKVLPWFEQLLPLIVNLICPHRPWPDRQWGLCIFDDVIEHCSPASFKYAEYFLRPMLQYVCDSSPEVRQAAAYGLGVMAQYGGDNYRPFCTEALPLLVRVIQSADAKTKENINATENCISAVGKMMKFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFNYLCDLIESNHPIVLGPNNTNLPKIFSIIAEGEMHEAIKHDDPCAKRLANVVRQVQTSGGLWTECIAQLSPEQQAAIQELLNSA", "length": 1007, "header": "tr|A0A3Q1LV36-1|A0ABI0P597_BOVIN Computationally mapped isoform of Importin-5 OS=Bos taurus OX=9913 GN=IPO5 PE=1 SV=3 CANONICAL=A0ABI0P597-1" }, "locus": { "chromosome": "12", "start_pos": 75069540, "end_pos": 75029817, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000067996.3", "url": "https://www.ensembl.org/id/ENSBTAT00000067996.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000061047.3", "url": "https://www.ensembl.org/id/ENSBTAP00000061047.3" } ] } }, { "isoform_ac": "A0ABI0P597-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597/entry#A0ABI0P597-1", "sequence": { "sequence": "MAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTAAAEEARQMAAVLLRRLLSSAFDEVYPTLPTDVQTAIKSELLMIIQMETQSSMRKKICDIAAELARNLIDEDGNNQWPEGLKFLFDSVSSQNMGLREAALHIFWNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIRTLSARATAAFILANEHNVALFKHFADLLPGFLQAVNDSCYQNDDSVLKSLVEIADTVPKYLRPHLEATLQLSLKLCGDTGLNNMQRQLALEVIVTLSETAAAMLRKHTNIVAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQMLQNPDWKYRHAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAACNAVGQMATDFAPGFQKKFHEKVIAALLQTMEDQGNQRVQAHAAAALINFTEDCPKSLLIPYLDSLVKHLHSIMVLKLQELIQKGTKLVLEQVVTSIASVADTAEEKFVPYYDLFMPSLKHIVENAVQKELRLLRGKTIECISLIGLAVGKEKFMQDASDVMQLLLKTQTDFSDMEDDDPQISYMISAWARMCKILGKEFQQYLPVVMGPLMKTASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIKTAGLEEKSTACQMLVCYAKELKEGFVEYTEQVVKLMVPLLKFYFHDGVRVAAAESMPLLLECARVRGPEYLTQMWHFMCDALIKAIGTEPDSDVLSEIMHSFAKCIEVMGDGCLNNEHFEELGGILKAKLEEHFKNQELRQVKRQDEDYDEQVEESLQDEDDNDVYILTKVSDILHSIFSSYKEKVLPWFEQLLPLIVNLICPHRPWPDRQWGLCIFDDVIEHCSPASFKYAEYFLRPMLQYVCDSSPEVRQAAAYGLGVMAQYGGDNYRPFCTEALPLLVRVIQSADAKTKENINATENCISAVGKMMKFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFNYLCDLIESNHPIVLGPNNTNLPKIFSIIAEGEMHEAIKHDDPCAKRLANVVRQVQTSGGLWTECIAQLSPEQQAAIQELLNSA", "length": 1097, "header": "tr|A0ABI0P597-1|A0ABI0P597_BOVIN Isoform 1 of Importin-5 OS=Bos taurus OX=9913 GN=IPO5 PE=1 SV=1 CANONICAL=A0ABI0P597-1" }, "locus": { "chromosome": "12", "start_pos": 75069540, "end_pos": 75029817, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000149633.1", "url": "https://www.ensembl.org/id/ENSBTAT00000149633.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106049.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106049.1" } ] } }, { "isoform_ac": "F1MPE5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597/entry#F1MPE5-1", "sequence": { "sequence": "SLSLTPSAMAAAAAEQQQFYLLLGNLLSPDNVVRKQAEETYENIPGQSKITFLLQAIRNTAAAEEARQMAAVLLRRLLSSAFDEVYPTLPTDVQTAIKSELLMIIQMETQSSMRKKICDIAAELARNLIGVYFSEDVFYRIFRNFPGIFGNQQQHYLDVIKRMLVQCMQDQEHPSIRTLSARATAAFILANEHNVALFKHFADLLPGFLQAVNDSCYQNDDSVLKSLVEIADTVPKYLRPHLEATLQLSLKLCGDTGLNNMQRQLALEVIVTLSETAAAMLRKHTNIVAQTIPQMLAMMVDLEEDEDWANADELEDDDFDSNAVAGESALDRMACGLGGKLVLPMIKEHIMQMLQNPDWKYRHAGLMALSAIGEGCHQQMEGILNEIVNFVLLFLQDPHPRVRYAACNAVGQMATDFAPGFQKKFHEKVIAALLQTMEDQGNQRVQAHAAAALINFTEDCPKSLLIPYLDSLVKHLHSIMVLKLQELIQKGTKLVLEQVVTSIASVADTAEEKFVPYYDLFMPSLKHIVENAVQKELRLLRGKTIECISLIGLAVGKEKFMQDASDVMQLLLKTQTDFSDMEDDDPQISYMISAWARMCKILGKEFQQYLPVVMGPLMKTASIKPEVALLDTQDMENMSDDDGWEFVNLGDQQSFGIKTAGLEEKSTACQMLVCYAKELKEGFVEYTEQVVKLMVPLLKFYFHDDILTFSLTIKRVRVAAAESMPLLLECARVRGPEYLTQMWHFMCDALIKAIGTEPDSDVLSEIMHSFAKCIEVMGDGCLNNEHFEELGGILKAKLEEHFKNQELRQVKRQDEDYDEQVEESLQDEDDNDVYILTKVSDILHSIFSSYKEKVLPWFEQLLPLIVNLICPHRPWPDRQWGLCIFDDVIEHCSPASFKYAEYFLRPMLQYVCDSSPEVRQAAAYGLGVMAQYGGDNYRPFCTEALPLLVRVIQSADAKTKENINATENCISAVGKMMKFKPDCVNVEEVLPHWLSWLPLHEDKEEAVQTFNYLCDLIESNHPIVLGPNNTNLPKIFSIIAEGEMHEAIKHDDPCAKRLANVVRQVQTSGGLWTECIAQLSPEQQAAIQELLNSA", "length": 1094, "header": "tr|F1MPE5-1|A0ABI0P597_BOVIN Computationally mapped isoform of Importin-5 OS=Bos taurus OX=9913 GN=IPO5 PE=1 SV=3 CANONICAL=A0ABI0P597-1" }, "locus": { "chromosome": "12", "start_pos": 75069540, "end_pos": 75029793, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000061564.4", "url": "https://www.ensembl.org/id/ENSBTAT00000061564.4" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000053578.3", "url": "https://www.ensembl.org/id/ENSBTAP00000053578.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P597", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P597", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "small GTPase binding", "id": "GO:0031267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031267", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P597", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597" } ], "pmid": "" }, { "name": "nuclear localization sequence binding", "id": "GO:0008139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008139", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P597", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597" } ], "pmid": "" }, { "name": "nuclear import signal receptor activity", "id": "GO:0061608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061608", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P597", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "protein import into nucleus", "id": "GO:0006606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006606", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P597", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1031, "end_pos": 1033, "annotation": "n_glycosylation_sequon" }, { "start_pos": 226, "end_pos": 228, "annotation": "n_glycosylation_sequon" }, { "start_pos": 468, "end_pos": 470, "annotation": "n_glycosylation_sequon" }, { "start_pos": 650, "end_pos": 652, "annotation": "n_glycosylation_sequon" }, { "start_pos": 967, "end_pos": 969, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P597", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P597" }, { "id": "PS50166", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50166" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Importin N-terminal", "eco_id": "ECO_0000259", "start_pos": 45, "end_pos": 99, "start_aa": "Leu", "end_aa": "Met", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1031, "end_pos": 1033 }, { "start_pos": 226, "end_pos": 228 }, { "start_pos": 468, "end_pos": 470 }, { "start_pos": 650, "end_pos": 652 }, { "start_pos": 967, "end_pos": 969 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6F6-1", "uniprot_ac": "A0ABI0P6F6", "uniprot_id": "A0ABI0P6F6_BOVIN", "mass": { "chemical_mass": 98100.0, "monoisotopic_mass": 98100.0 }, "refseq": {}, "gene_names": [ { "name": "CSF2RB", "type": "recommended", "evidence": [ { "id": "A0ABI0P6F6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ] } ], "protein_names": [ { "name": "Colony stimulating factor 2 receptor subunit beta", "type": "synonym", "evidence": [ { "id": "A0ABI0P6F6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "CSF2RB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6", "locus": { "chromosome": "5", "start_pos": 75371433, "end_pos": 75349235, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000009064", "url": "https://www.ensembl.org/id/ENSBTAG00000009064" } ] } } ], "crossref": [ { "id": "ENSBTAG00000009064", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000009064", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00063", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00063", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR003531", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003531", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003961", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003961", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015321", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015321", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036116", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036116", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048668", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048668", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "F1MXH7", "url": "https://www.orthodb.org/?gene=F1MXH7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23037", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23037", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23037:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23037:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF09240", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF09240", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF21460", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF21460", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-512988", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-512988", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-5673001", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5673001", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-5683826", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5683826", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-912526", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-912526", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6F6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MXH7", "url": "https://www.uniprot.org/uniprotkb/F1MXH7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MXH7-1", "url": "https://www.uniprot.org/uniprotkb/F1MXH7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTLTQGLLPLALLVLCWGLSITGAEETVPMQTLRCHNDYTSRIICRWADTQDAQRLVNVTLYRRPKEDHPQRVSCSLSDDKPWLNSPCSGCVPRKCVIPYRNFVLADFDYFSFRPDQPLVTELTVNLSQHVQPPTPKDLNITATRESLLLFWSIAHEGFQSHWLSSLEFEVVYKRLQDSWEDALTIHSKSPQAILELKDLQPSSTYVARVRTRLAPGSGLSGRPSQWSQEVSWNSQPGDEAQPQNLQCFFDGATLLTCTWEVRSEVTHSVSFTLFYKTGPSARSAMILREEECSPVQKETGSPYIQHRCQIPVPDPRNYSQYIVSVRPKVEERLIKSSDNIQMAPPTLNVTKGRDGYILHWREEKMSYSHIACIFQVQYKKEGASWEDTKTEDFQNAHTMSLPPLEPASRYQARVRVKRPGYNGIWSEWSEARSWDTDWVLPMWVLALILVISTLILLPVLHFCGVYGYRLNRKWEEKIPNPSKSHLFQNGSAGLRMPDSMATLGSGSHPHKGPWGSSCPQLLEGVFPVDCRHSEVSPLTTEDPKDACDSSSEPDMTLTASDLPTEQPPSPPTGLAAPSSRPESQASGFDFNGPYLGPPHSCSLPDLMGQQVPPQTGVSRKPQSPGSLEYLCLPAGGQVQLVPLAQVKRQGKAGDGDTKSSPGAQTSPSLESGVDPAPPEPGLMGVGQDQKDRAPTVLPTGLPEDGTVASGYVTTPDLIFTPPIGAPSPSQAAPPNLPSDQNPTFHPGLADGPPVASAPQKPEFEGYVELPPATGQFPQSPLASPAPPRVSSPVLSPGPHRADVSPTSPTPEGLLVLQQVGDYCFLPGPLSPQSKPTSPGPCPEIRDLNQVVQAKKPPAQAFPQVPAIQLFKALKQQDYLSLPPWDINRPGQVC", "length": 894, "header": "tr|A0ABI0P6F6-1|A0ABI0P6F6_BOVIN Isoform 1 of Colony stimulating factor 2 receptor subunit beta OS=Bos taurus OX=9913 GN=CSF2RB PE=4 SV=1 CANONICAL=A0ABI0P6F6-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6F6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6/entry#A0ABI0P6F6-1", "sequence": { "sequence": "MTLTQGLLPLALLVLCWGLSITGAEETVPMQTLRCHNDYTSRIICRWADTQDAQRLVNVTLYRRPKEDHPQRVSCSLSDDKPWLNSPCSGCVPRKCVIPYRNFVLADFDYFSFRPDQPLVTELTVNLSQHVQPPTPKDLNITATRESLLLFWSIAHEGFQSHWLSSLEFEVVYKRLQDSWEDALTIHSKSPQAILELKDLQPSSTYVARVRTRLAPGSGLSGRPSQWSQEVSWNSQPGDEAQPQNLQCFFDGATLLTCTWEVRSEVTHSVSFTLFYKTGPSARSAMILREEECSPVQKETGSPYIQHRCQIPVPDPRNYSQYIVSVRPKVEERLIKSSDNIQMAPPTLNVTKGRDGYILHWREEKMSYSHIACIFQVQYKKEGASWEDTKTEDFQNAHTMSLPPLEPASRYQARVRVKRPGYNGIWSEWSEARSWDTDWVLPMWVLALILVISTLILLPVLHFCGVYGYRLNRKWEEKIPNPSKSHLFQNGSAGLRMPDSMATLGSGSHPHKGPWGSSCPQLLEGVFPVDCRHSEVSPLTTEDPKDACDSSSEPDMTLTASDLPTEQPPSPPTGLAAPSSRPESQASGFDFNGPYLGPPHSCSLPDLMGQQVPPQTGVSRKPQSPGSLEYLCLPAGGQVQLVPLAQVKRQGKAGDGDTKSSPGAQTSPSLESGVDPAPPEPGLMGVGQDQKDRAPTVLPTGLPEDGTVASGYVTTPDLIFTPPIGAPSPSQAAPPNLPSDQNPTFHPGLADGPPVASAPQKPEFEGYVELPPATGQFPQSPLASPAPPRVSSPVLSPGPHRADVSPTSPTPEGLLVLQQVGDYCFLPGPLSPQSKPTSPGPCPEIRDLNQVVQAKKPPAQAFPQVPAIQLFKALKQQDYLSLPPWDINRPGQVC", "length": 894, "header": "tr|A0ABI0P6F6-1|A0ABI0P6F6_BOVIN Isoform 1 of Colony stimulating factor 2 receptor subunit beta OS=Bos taurus OX=9913 GN=CSF2RB PE=4 SV=1 CANONICAL=A0ABI0P6F6-1" }, "locus": { "chromosome": "5", "start_pos": 75370429, "end_pos": 75357421, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000146903.1", "url": "https://www.ensembl.org/id/ENSBTAT00000146903.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107216.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107216.1" } ] } }, { "isoform_ac": "F1MXH7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6/entry#F1MXH7-1", "sequence": { "sequence": "MTLTQGLLPLALLVLCWGLSITGAEETVPMQTLRCHNDYTSRIICRWADTQDAQRLVNVTLYRRPKEDHPQRVSCSLSDDKPWLNSPCSGCVPRKCVIPYRNFVLADFDYFSFRPDQPLVTELTVNLSQHVQPPTPKDLNITATRESLLLFWSIAHEGFQSHWLSSLEFEVVYKRLQDSWEDALTIHSKSPQAILELKDLQPSSTYVARVRTRLAPGSGLSGRPSQWSQEVSWNSQPGDEAQPQNLQCFFDGATLLTCTWEVRSEVTHSVSFTLFYKTGPYIQHRCQIPVPDPRNYSQYIVSVRPKVEERLIKSSDNIQMAPPTLNVTKGRDGYILHWREEKMSYSHIACIFQVQYKKEGASWEDTKTEDFQNAHTMSLPPLEPASRYQARVRVKPDPGNYNGIWSEWSEARSWDTDWVLPMWVLALILVISTLILLPVLHFCGVYGYRLNRKWEEKIPNPSKSHLFQNGSAGLRMPDSMATLGSGSHPHKGPWGSSCPQLLEGVFPVDCRHSEVSPLTTEDPKDACDSSSEPDMTLTASDLPTEQPPSPPTGLAAPSSRPESQASGFDFNGPYLGPPHSCSLPDLMGQQVPPQTGVSRKPQSPGSLEYLCLPAGGQVQLVPLAQVKRQGKAGDGDTKSSPGAQTSPSLESGVDPAPPEPGLMGVGQDQKDRAPTVLPTGLPEDGTVASGYVTTPDLIFTPPIGAPSPSQAAPPNLPSDQNPTFHPGLADGPPVASAPQKPEFEGYVELPPATGQFPQSPLASPAPPRVSSPVLSPGPHRADVSPTSPTPEGLLVLQQVGDYCFLPGPLSPQSKPTSPGPCPEIRDLNQVVQAKKPPAQAFPQVPAIQLFKALKQQDYLSLPPWDINRPGQVC", "length": 873, "header": "tr|F1MXH7-1|A0ABI0P6F6_BOVIN Computationally mapped isoform of Colony stimulating factor 2 receptor subunit beta OS=Bos taurus OX=9913 GN=CSF2RB PE=4 SV=4 CANONICAL=A0ABI0P6F6-1" }, "locus": { "chromosome": "5", "start_pos": 75370429, "end_pos": 75357421, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000011947.8", "url": "https://www.ensembl.org/id/ENSBTAT00000011947.8" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000011947.7", "url": "https://www.ensembl.org/id/ENSBTAP00000011947.7" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-BTA-512988", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-512988", "resource": "Reactome", "description": "Interleukin-3, Interleukin-5 and GM-CSF signaling" }, { "id": "R-BTA-5673001", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5673001", "resource": "Reactome", "description": "RAF/MAP kinase cascade" }, { "id": "R-BTA-5683826", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5683826", "resource": "Reactome", "description": "Surfactant metabolism" }, { "id": "R-BTA-912526", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-912526", "resource": "Reactome", "description": "Interleukin receptor SHC signaling" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "interleukin-5-mediated signaling pathway", "id": "GO:0038043", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038043", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "pmid": "" }, { "name": "interleukin-3-mediated signaling pathway", "id": "GO:0038156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038156", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "pmid": "" }, { "name": "immunoglobulin mediated immune response", "id": "GO:0016064", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016064", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "pmid": "" }, { "name": "cell surface receptor signaling pathway via JAK-STAT", "id": "GO:0007259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007259", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "pmid": "" }, { "name": "positive regulation of leukocyte proliferation", "id": "GO:0070665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070665", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "pmid": "" }, { "name": "granulocyte-macrophage colony-stimulating factor signaling pathway", "id": "GO:0038157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038157", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cytokine receptor activity", "id": "GO:0004896", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004896", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 126, "end_pos": 128, "annotation": "n_glycosylation_sequon" }, { "start_pos": 140, "end_pos": 142, "annotation": "n_glycosylation_sequon" }, { "start_pos": 318, "end_pos": 320, "annotation": "n_glycosylation_sequon" }, { "start_pos": 349, "end_pos": 351, "annotation": "n_glycosylation_sequon" }, { "start_pos": 490, "end_pos": 492, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6F6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6F6" }, { "id": "PS50853", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50853" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Fibronectin type-III", "eco_id": "ECO_0000259", "start_pos": 133, "end_pos": 238, "start_aa": "Pro", "end_aa": "Gly", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 126, "end_pos": 128 }, { "start_pos": 140, "end_pos": 142 }, { "start_pos": 318, "end_pos": 320 }, { "start_pos": 349, "end_pos": 351 }, { "start_pos": 490, "end_pos": 492 }, { "start_pos": 58, "end_pos": 60 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P643-1", "uniprot_ac": "A0ABI0P643", "uniprot_id": "A0ABI0P643_BOVIN", "mass": { "chemical_mass": 73541.0, "monoisotopic_mass": 73541.0 }, "refseq": {}, "gene_names": [ { "name": "GLB1L2", "type": "recommended", "evidence": [ { "id": "A0ABI0P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" } ] } ], "protein_names": [ { "name": "Beta-galactosidase", "type": "recommended", "evidence": [ { "id": "A0ABI0P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643/entry#names_and_taxonomy" } ] }, { "name": "3.2.1.23", "type": "synonym", "evidence": [ { "id": "A0ABI0P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P643", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "GLB1L2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643", "locus": { "chromosome": "15", "start_pos": 83673239, "end_pos": 83633522, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000018390", "url": "https://www.ensembl.org/id/ENSBTAG00000018390" } ] } } ], "crossref": [ { "id": "ENSBTAG00000018390", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000018390", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "519145", "url": "https://www.ncbi.nlm.nih.gov/gene/519145", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001944", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001944", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017853", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017853", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019801", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019801", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026283", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026283", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031330", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031330", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048912", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048912", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR048913", "url": "https://www.ebi.ac.uk/interpro/entry/IPR048913", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:519145", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:519145", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "GSEIVHN", "url": "https://omabrowser.org/oma/group/GSEIVHN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "F1MY73", "url": "https://www.orthodb.org/?gene=F1MY73", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23421", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23421", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01301", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01301", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF21317", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF21317", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF21467", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF21467", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-2022857", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-2022857", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-2024101", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-2024101", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-9840310", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9840310", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0ABI0P643", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P643-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MY73", "url": "https://www.uniprot.org/uniprotkb/F1MY73", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MY73-1", "url": "https://www.uniprot.org/uniprotkb/F1MY73-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPKWSVRRRPSLLLGAVLLIVCLPVLRRYLHRQPGGCDLEVTPRLDWSGLGASLWRRRHLGLRADGQNFKLENSAFWIFGGSVHYFRVPRAYWRDRLLKLRACGLNTLTTYVPWNLHEPERGTFDFSGNLDLEAFILLAAEVGLWVILRPGPYICSEVDLGGLPSWLLRDPDMRLRTTYKGFTEAVDLYFDHLMLRVVPLQYKHGGPIIAVQVENEYGSYNKDPAYMPYIKKALQDRGIAELLLTSDNQGGLKSGVLDGVLATINLQSQSELQLFTTILLGAQGSQPKMVMEYWTGWFDSWGGPHYILDSSEVLNTVSAIVKAGSSINLYMFHGGTNFGFIGGAMHFQDYKPDVTSYDYDAVLTEAGDYTAKYTKLREFFGSMAGAPLPVPPDLLPKTAYDPVTPAFYVSLWDALNFLELPVTSEHPVNMENLPINGGSGQSFGYTLYETTITASGVLTALVRDRGQVFLNTFFLGTLDYKKKTIVIPTVQGFTTLRILVENCGRVNYGDNIDQQRKGIIGNVYLNDSPLKKFKIYSLEMDRSFLQRFTADKWKPLTEEPMFPAFFLGALSVLDSPYDTFVKLEGWEKGVVFINNQNLGRYWNIGPQETLYLPGAWLDVGLNKIIVFEEKMAQRIIQFVDTPNLGQHEYVH", "length": 651, "header": "tr|A0ABI0P643-1|A0ABI0P643_BOVIN Isoform 1 of Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1L2 PE=3 SV=1 CANONICAL=A0ABI0P643-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P643-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643/entry#A0ABI0P643-1", "sequence": { "sequence": "MPKWSVRRRPSLLLGAVLLIVCLPVLRRYLHRQPGGCDLEVTPRLDWSGLGASLWRRRHLGLRADGQNFKLENSAFWIFGGSVHYFRVPRAYWRDRLLKLRACGLNTLTTYVPWNLHEPERGTFDFSGNLDLEAFILLAAEVGLWVILRPGPYICSEVDLGGLPSWLLRDPDMRLRTTYKGFTEAVDLYFDHLMLRVVPLQYKHGGPIIAVQVENEYGSYNKDPAYMPYIKKALQDRGIAELLLTSDNQGGLKSGVLDGVLATINLQSQSELQLFTTILLGAQGSQPKMVMEYWTGWFDSWGGPHYILDSSEVLNTVSAIVKAGSSINLYMFHGGTNFGFIGGAMHFQDYKPDVTSYDYDAVLTEAGDYTAKYTKLREFFGSMAGAPLPVPPDLLPKTAYDPVTPAFYVSLWDALNFLELPVTSEHPVNMENLPINGGSGQSFGYTLYETTITASGVLTALVRDRGQVFLNTFFLGTLDYKKKTIVIPTVQGFTTLRILVENCGRVNYGDNIDQQRKGIIGNVYLNDSPLKKFKIYSLEMDRSFLQRFTADKWKPLTEEPMFPAFFLGALSVLDSPYDTFVKLEGWEKGVVFINNQNLGRYWNIGPQETLYLPGAWLDVGLNKIIVFEEKMAQRIIQFVDTPNLGQHEYVH", "length": 651, "header": "tr|A0ABI0P643-1|A0ABI0P643_BOVIN Isoform 1 of Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1L2 PE=3 SV=1 CANONICAL=A0ABI0P643-1" }, "locus": { "chromosome": "15", "start_pos": 83672598, "end_pos": 83633654, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152938.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152938.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106727.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106727.1" } ] } }, { "isoform_ac": "F1MY73-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643/entry#F1MY73-1", "sequence": { "sequence": "MPKWSVRRRPSLLLGAVLLIVCLPVLRRLDWSGLGASLWRRRHLGLRADGQNFKLENSAFWIFGGSVHYFRVPRAYWRDRLLKLRACGLNTLTTYVPWNLHEPERGTFDFSGNLDLEAFILLAAEVGLWVILRPGPYICSEVDLGGLPSWLLRDPDMRLRTTYKGFTEAVDLYFDHLMLRVVPLQYKHGGPIIAVQVENEYGSYNKDPAYMPYIKKALQDRGIAELLLTSDNQGGLKSGVLDGVLATINLQSQSELQLFTTILLGAQGSQPKMVMEYWTGWFDSWGGPHYILDSSEVLNTVSAIVKAGSSINLYMFHGGTNFGFIGGAMHFQDYKPDVTSYDYDAVLTEAGDYTAKYTKLREFFGSMAGAPLPVPPDLLPKTAYDPVTPAFYVSLWDALNFLELPVTSEHPVNMENLPINGGSGQSFGYTLYETTITASGVLTALVRDRGQVFLNTFFLGTLDYKKKTIVIPTVQGFTTLRILVENCGRVNYGDNIDQQRKGIIGNVYLNDSPLKKFKIYSLEMDRSFLQRFTADKWKPLTEEPMFPAFFLGALSVLDSPYDTFVKLEGWEKGVVFINNQNLGRYWNIGPQETLYLPGAWLDVGLNKIIVFEEKMAQRIIQFVDTPNLGQHEYVH", "length": 635, "header": "tr|F1MY73-1|A0ABI0P643_BOVIN Computationally mapped isoform of Beta-galactosidase OS=Bos taurus OX=9913 GN=GLB1L2 PE=3 SV=2 CANONICAL=A0ABI0P643-1" }, "locus": { "chromosome": "15", "start_pos": 83672598, "end_pos": 83633654, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000016231.8", "url": "https://www.ensembl.org/id/ENSBTAT00000016231.8" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000016231.5", "url": "https://www.ensembl.org/id/ENSBTAP00000016231.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 404, "start_aa": "Thr", "end_pos": 404, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr404", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [ { "id": "bta:519145", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:519145", "resource": "KEGG Pathway" }, { "id": "R-BTA-2022857", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-2022857", "resource": "Reactome", "description": "Keratan sulfate degradation" }, { "id": "R-BTA-2024101", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-2024101", "resource": "Reactome", "description": "CS/DS degradation" }, { "id": "R-BTA-9840310", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9840310", "resource": "Reactome", "description": "Glycosphingolipid catabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A4X1V7D8-1", "protein_name": "Beta-galactosidase", "gene_name": "GLB1L2", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MPKWNVRRPGRLLGLLLLVILSFLVLRRLNWSSLAPSWLRHRQLGLQAKDQNFMLEDSAFWIFGGSVHYFRVPRAYWRDRLLKMKACGLNTLTTYVPWNLHEPERGKFDFSGNLDMEAFILLAAEVGLWVILRPGPYICSEIDLGGLPSWLLQDSSMKLRTTYEGFTKAVDLYFDHLMARVVPLQYKNGGPIIAVQVENEYGSYNKDPAYMPYIKKALEDRGIVELLLTSDNEDGLSKGTVDGVLATINLQSQNELRLLHNFLQSVQGVRPKMVMEYWTGWFDSWGGPHHILDTSEVLRTVSAIIDAGASINLYMFHGGTNFGFINGAMHFQDYMSDVTSYDYDAVLTEAGDYTPKYIRLRELFGSISGASLPLPPDLLPKVRYEPVVPAFYLSLWDALPYIKEPVTSEKPVNMENLPINDGNGQSFGYTLYETTITSSGILSALVRDRGQVFLNTETIGFLDYKTKKIPIPLIQGFTILRILVENCGRVNYGENIDNQRKGLIGDIYLNDTPLKKFKIYSLDMKKSFFQRFTAEKWDPVPGVPTLPAFFLGALSVTSFPYDTFVKLEGWEKGVVFVNGYNLGRYWNIGPQETLYLPGVWLNEGINQVIVFEEMMQGPVIQFMEMPYLGRQQYVE", "length": 635 }, "evidence": [ { "id": "A0ABI0P643", "url": "https://omabrowser.org/oma/group/A0ABI0P643/", "database": "OMA" } ], "glygen_name": "Pig", "common_name": "Pig" }, { "uniprot_canonical_ac": "A0ABK0LJW5-1", "protein_name": "Beta-galactosidase", "gene_name": "Glb1l2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPKWSLRRRPGRTLGLLLLLVLSFLVLRRLNWTSVLPLWLQRQRLGLRTKGPNFMLEDSTFQILGGSIHYFRVPREYWRDRLLKLKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFIWLAAKIGLWVILRPGPYICSEIDLGGLPSWLLQDPDMKLRTTYPGFTKAVDLYFDHLMSRVVPLQYKHGGPIIAVQVENEYGSYNGDHAYMPYIKKALEDRGIIEMLLTSDNKDGLEKGVVDGVLATINLQSQQELVALNSILLSIQGIQPKMVMEYWTGWFDSWGGSHNILDSSEVLQTVSAIIKDGSSINLYMFHGGTNFGFINGAMHFGDYKADVTSYDYDAILTEAGDYTAKYTKLRELFGTFSGVPPPPPPELTAKMVYEPVTPSFYLSLWDALLYMDKPITSEIPINMENLPVNNGNGQAFGYVLYETTIFSSGVLSGLVRDRGQVFLNRVSIGFLDYTTTKITIPLTQGYTILRILVENRGRVNYGNNIDSQRKGLIGNLYLNNKPLKNFKIYSLDMTKQFFQRFDMDKWSVVPKEITFPAFFLGTLSVGIYPSDTFLKLEGWVKGVVLVNDHNLGRYWNVGPQETLYLPGVWLDKGLNKVIIFEETMAGSMVQSTDIPHLGRNQYVN", "length": 636 }, "evidence": [ { "id": "A0ABI0P643", "url": "https://omabrowser.org/oma/group/A0ABI0P643/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "Q3UPY5-1", "protein_name": "Beta-galactosidase-1-like protein 2", "gene_name": "Glb1l2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPKWSLRRRPGRTLGLLLLLVLSFLVLRRLNWSTLVPLWLQHQRLGLRTKGPDFILEDSIFQILGGSIHYFRVPREYWRDRLLKLKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFIQLAAKIGLWVILRPGPYICSEIDLGGLPSWLLQDPDMKLRTTYHGFTKAVELYFDHLMSRVVPLQYKHGGPIIAVQVENEYGSYNKDRAYMPYIKKALEDRGIIEMLLTSDNKDGLEKGVVDGVLATINLQSQQELMALNTVLLSIQGIQPKMVMEYWTGWFDSWGGSHNILDSSEVLQTVSAIIKDGSSINLYMFHGGTNFGFINGAMHFNDYKADVTSYDYDAILTEAGDYTAKYTKLRELFGTVSGIPPPPPPELTAKMVYEPMSPALYLSLWDAIQYMDKPVTSETPINMENLPVNNGNGQAFGYVLYETTIFSSGVLSGLVRDRGQVFLNRVSIGFLDYKTTKITIPLTQGYTILRILVENRGRVNYGNNIDSQRKGLIGNLYLNNKALKNFKIYSLDMTKQFLQRFDMDNWSVIPKELTFPAFFLGALSVGIYPSDTFLKLEGWVKGVVFVNGHNLGRYWNVGPQETLYLPGVWLDKGINKVIIFEETMSGSMVQSTDIPHLGRNQYIN", "length": 636 }, "evidence": [ { "id": "A0ABI0P643", "url": "https://omabrowser.org/oma/group/A0ABI0P643/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8IW92-1", "protein_name": "Beta-galactosidase-1-like protein 2", "gene_name": "GLB1L2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MTTWSLRRRPARTLGLLLLVVLGFLVLRRLDWSTLVPLRLRHRQLGLQAKGWNFMLEDSTFWIFGGSIHYFRVPREYWRDRLLKMKACGLNTLTTYVPWNLHEPERGKFDFSGNLDLEAFVLMAAEIGLWVILRPGPYICSEMDLGGLPSWLLQDPGMRLRTTYKGFTEAVDLYFDHLMSRVVPLQYKRGGPIIAVQVENEYGSYNKDPAYMPYVKKALEDRGIVELLLTSDNKDGLSKGIVQGVLATINLQSTHELQLLTTFLFNVQGTQPKMVMEYWTGWFDSWGGPHNILDSSEVLKTVSAIVDAGSSINLYMFHGGTNFGFMNGAMHFHDYKSDVTSYDYDAVLTEAGDYTAKYMKLRDFFGSISGIPLPPPPDLLPKMPYEPLTPVLYLSLWDALKYLGEPIKSEKPINMENLPVNGGNGQSFGYILYETSITSSGILSGHVHDRGQVFVNTVSIGFLDYKTTKIAVPLIQGYTVLRILVENRGRVNYGENIDDQRKGLIGNLYLNDSPLKNFRIYSLDMKKSFFQRFGLDKWSSLPETPTLPAFFLGSLSISSTPCDTFLKLEGWEKGVVFINGQNLGRYWNIGPQKTLYLPGPWLSSGINQVIVFEETMAGPALQFTETPHLGRNQYIK", "length": 636 }, "evidence": [ { "id": "A0ABI0P643", "url": "https://omabrowser.org/oma/group/A0ABI0P643/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "beta-galactosidase activity", "id": "GO:0004565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004565", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P643", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "vacuole", "id": "GO:0005773", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005773", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P643", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "galactose catabolic process", "id": "GO:0019388", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019388", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P643", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" } ], "pmid": "" }, { "name": "carbohydrate metabolic process", "id": "GO:0005975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005975", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P643", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 526, "end_pos": 528, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "R-BTA-1605624", "name": "Beta-galactosidases hydrolyse mobilized GM1 to mobilized GM2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal membrane, lysosomal lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "F1MDX6-1", "A0ABI0P643-1", "A0A3Q1NDQ7-1", "E1BCP9-1" ], "evidence": [ { "id": "R-BTA-1605624", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-1605624" } ] }, { "id": "R-BTA-1606312", "name": "GLB1 hydrolyzes SapB/C:LacCer", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "F1MDX6-1", "A0ABI0P643-1", "A0A3Q1NDQ7-1", "E1BCP9-1" ], "evidence": [ { "id": "R-BTA-1606312", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-1606312" } ] }, { "id": "R-BTA-1630306", "name": "GLB1 hydrolyses a glycosaminoglycan", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [ "R-ALL-2104997" ], "output_participant_list": [], "enzyme_list": [ "F1MDX6-1", "A0ABI0P643-1", "A0A3Q1NDQ7-1", "E1BCP9-1" ], "evidence": [ { "id": "R-BTA-1630306", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-1630306" } ] }, { "id": "R-BTA-2090079", "name": "GLB1 hydrolyses linker chain(2)", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [ "R-ALL-2090075" ], "output_participant_list": [ "R-ALL-2090063" ], "enzyme_list": [ "F1MDX6-1", "A0ABI0P643-1", "A0A3Q1NDQ7-1", "E1BCP9-1" ], "evidence": [ { "id": "R-BTA-2090079", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-2090079" } ] }, { "id": "R-BTA-9840795", "name": "Beta-galactosidases hydrolyze GM2A:GA1 to GM2A:GA2", "equation": "", "summary": "This event has been computationally inferred from an event that has been demonstrated in another species.

The inference is based on the homology mapping from PANTHER. Briefly, reactions for which all involved PhysicalEntities (in input, output and catalyst) have a mapped orthologue/paralogue (for complexes at least 75% of components must have a mapping) are inferred to the other species. High level events are also inferred for these events to allow for easier navigation.

More details and caveats of the event inference in Reactome. For details on PANTHER see also: http://www.pantherdb.org/about.jsp", "cellular_location": "lysosomal lumen", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "F1MDX6-1", "A0ABI0P643-1", "A0A3Q1NDQ7-1", "E1BCP9-1" ], "evidence": [ { "id": "R-BTA-9840795", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-9840795" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-2090063", "participant_name": "D-xylose [lysosomal lumen]", "crossref": [ { "id": "4724", "database": "Guide to Pharmacology - Ligands", "url": "" }, { "id": "15936", "database": "ChEBI", "url": "" }, { "id": "G01550VL", "database": "GlyTouCan", "url": "" }, { "id": "ZINC000018168715", "database": "ZINC", "url": "" }, { "id": "C00181", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-2090075", "participant_name": "linker chain(2) [lysosomal lumen]", "crossref": [ { "id": "154964", "database": "ChEBI", "url": "" }, { "id": "G87877ES", "database": "GlyTouCan", "url": "" } ] }, { "participant_id": "R-ALL-2104997", "participant_name": "Gal-GlcNAc(S)-Gal-GlcNAc(S)-Gal [lysosomal lumen]", "crossref": [ { "id": "63850", "database": "ChEBI", "url": "" }, { "id": "G13032", "database": "KEGG Glycan", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A3Q1NDQ7", "gene_name": "GLB1", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "A0A3Q1NDQ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1NDQ7" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "A0A3Q1NDQ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1NDQ7" } ] } ] }, { "uniprot_ac": "A0ABI0P643", "gene_name": "GLB1L2", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "A0ABI0P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "A0ABI0P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" } ] } ] }, { "uniprot_ac": "E1BCP9", "gene_name": "GLB1L", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "E1BCP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BCP9" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "E1BCP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BCP9" } ] } ] }, { "uniprot_ac": "F1MDX6", "gene_name": "GLB1L3", "activity": [ { "ec_number": "3.2.1.23", "activity": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "F1MDX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MDX6" } ] }, { "ec_number": "3.2.1.23", "activity": "", "evidence": [ { "id": "F1MDX6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MDX6" } ] } ] } ], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" }, { "id": "PF21317", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF21317" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Beta-galactosidase 1-like first all-beta", "eco_id": "ECO_0000259", "start_pos": 440, "end_pos": 539, "start_aa": "Gly", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" }, { "id": "PF21467", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF21467" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Beta-galactosidase galactose-binding", "eco_id": "ECO_0000259", "start_pos": 563, "end_pos": 622, "start_aa": "Pro", "end_aa": "Asn", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P643", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P643" }, { "id": "PF01301", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01301" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Glycoside hydrolase 35 catalytic", "eco_id": "ECO_0000259", "start_pos": 69, "end_pos": 380, "start_aa": "Phe", "end_aa": "Phe", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "3.2.1.23", "ec_name": "Hydrolysis of terminal non-reducing beta-D-galactose residues in beta-D-galactosides.", "evidence": [ { "id": "3.2.1.23", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.2.1.23" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 404 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 526, "end_pos": 528 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "Q09YM5-1", "uniprot_ac": "Q09YM5", "uniprot_id": "Q09YM5_BOVIN", "mass": { "chemical_mass": 31840.0, "monoisotopic_mass": 31840.0 }, "refseq": { "ac": "NP_001162075", "name": "UL16 binding protein 13 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162075" }, "gene_names": [ { "name": "ULBP13", "type": "recommended", "evidence": [ { "id": "Q09YM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ] }, { "name": "ULBP13", "type": "synonym", "evidence": [ { "id": "NP_001162075", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162075" } ] } ], "protein_names": [ { "name": "UL16 binding protein 13 precursor", "type": "synonym", "evidence": [ { "id": "NP_001162075", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162075" } ] }, { "name": "UL16 binding protein 13", "type": "synonym", "evidence": [ { "id": "Q09YM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q09YM5/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "ULBP13", "url": "https://www.uniprot.org/uniprotkb/Q09YM5", "locus": {} } ], "crossref": [ { "id": "ENSBTAG00000001836", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000001836", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "ENSBTAG00000026437", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000026437", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "534680", "url": "https://www.ncbi.nlm.nih.gov/gene/534680", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR011161", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011161", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037055", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037055", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050208", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050208", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:534680", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:534680", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "Q09YM5", "url": "https://www.orthodb.org/?gene=Q09YM5", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR16675", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16675", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16675:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16675:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00129", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00129", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-163125", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-163125", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-198933", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "NP_001162075", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001162075", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F1MZE6", "url": "https://www.uniprot.org/uniprotkb/F1MZE6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MZE6-1", "url": "https://www.uniprot.org/uniprotkb/F1MZE6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q09YM5-1", "url": "https://www.uniprot.org/uniprotkb/Q09YM5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGGSKSSLGFLVLLLIVLLSGTSSDAHSLSYNFTIDLQPRDGQPWCEVQGEVDQKVFLSYDCDRANIKYMSPLGEEVKSMNAWETQTEALRGIGALLKKQMPNVTLEKHTNKGLLTLQARMTCWREDNGLINASWQFGFNGQLCLLFDSESGYWTMVHSKGKWMKEKWENDRAVTEFFKKVSMADCQCWFQDFLLRWEKMLKTAGSQTTGPSTMQPMAPDSSYIIWITTGVLASLVITGIIIACIHYKNSLLDQSLFLFCRRWCSQEARQVLCLPFSCSSV", "length": 281, "header": "tr|Q09YM5-1|Q09YM5_BOVIN Isoform 1 of UL16 binding protein 13 OS=Bos taurus OX=9913 GN=ULBP13 PE=4 SV=1 CANONICAL=Q09YM5-1" }, "isoforms": [ { "isoform_ac": "F1MZE6-1", "url": "https://www.uniprot.org/uniprotkb/Q09YM5/entry#F1MZE6-1", "sequence": { "sequence": "MGGSKSSLGFLVLLLIVLLSGTSSDAHSLSYNFTIDPRPRDGQPWCEVQGEVDQKVFLSYDCGRAKIKYMSPLGEEVKSMNAWETETDTLRDTVDLLKEQMPDITPEKHTDKGPLTLQARMTCWQEDNGHISGSWQFGFNGQLCLLFDSESGYWTMVHSKGRRMKEKWENDRAVTEFFKKVSMADCQRWYQDFLLSWEKMLKTTASPTTGPSTMQPMAPDSSYSIWIPTGVLTSLVIIIVLACIHYKKSLLDQSLFLFCRRWCSQEARQVLCLPFSCSSV", "length": 280, "header": "tr|F1MZE6-1|Q09YM5_BOVIN Computationally mapped isoform of UL16 binding protein 13 OS=Bos taurus OX=9913 GN=ULBP13 PE=4 SV=5 CANONICAL=Q09YM5-1" }, "locus": { "chromosome": "NKLS02000657.1", "start_pos": 102369, "end_pos": 42713, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000011321.8", "url": "https://www.ensembl.org/id/ENSBTAT00000011321.8" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000011321.8", "url": "https://www.ensembl.org/id/ENSBTAP00000011321.8" } ] } }, { "isoform_ac": "Q09YM5-1", "url": "https://www.uniprot.org/uniprotkb/Q09YM5/entry#Q09YM5-1", "sequence": { "sequence": "MGGSKSSLGFLVLLLIVLLSGTSSDAHSLSYNFTIDLQPRDGQPWCEVQGEVDQKVFLSYDCDRANIKYMSPLGEEVKSMNAWETQTEALRGIGALLKKQMPNVTLEKHTNKGLLTLQARMTCWREDNGLINASWQFGFNGQLCLLFDSESGYWTMVHSKGKWMKEKWENDRAVTEFFKKVSMADCQCWFQDFLLRWEKMLKTAGSQTTGPSTMQPMAPDSSYIIWITTGVLASLVITGIIIACIHYKNSLLDQSLFLFCRRWCSQEARQVLCLPFSCSSV", "length": 281, "header": "tr|Q09YM5-1|Q09YM5_BOVIN Isoform 1 of UL16 binding protein 13 OS=Bos taurus OX=9913 GN=ULBP13 PE=4 SV=1 CANONICAL=Q09YM5-1" }, "locus": { "chromosome": "NKLS02000657.1", "start_pos": 102369, "end_pos": 77280, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000037567.7", "url": "https://www.ensembl.org/id/ENSBTAT00000037567.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000037395.7", "url": "https://www.ensembl.org/id/ENSBTAP00000037395.7" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:534680", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:534680", "resource": "KEGG Pathway" }, { "id": "R-BTA-163125", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-163125", "resource": "Reactome", "description": "Post-translational modification: synthesis of GPI-anchored proteins" }, { "id": "R-BTA-198933", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-198933", "resource": "Reactome", "description": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "antigen processing and presentation of endogenous peptide antigen via MHC class Ib", "id": "GO:0002476", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002476", "evidence": [ { "database": "UniProtKB", "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ], "pmid": "" }, { "name": "antigen processing and presentation of endogenous peptide antigen via MHC class I via ER pathway, TAP-independent", "id": "GO:0002486", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002486", "evidence": [ { "database": "UniProtKB", "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ], "pmid": "" }, { "name": "positive regulation of T cell mediated cytotoxicity", "id": "GO:0001916", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001916", "evidence": [ { "database": "UniProtKB", "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ], "pmid": "" }, { "name": "natural killer cell mediated cytotoxicity", "id": "GO:0042267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042267", "evidence": [ { "database": "UniProtKB", "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "natural killer cell lectin-like receptor binding", "id": "GO:0046703", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046703", "evidence": [ { "database": "UniProtKB", "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ], "pmid": "" }, { "name": "receptor ligand activity", "id": "GO:0048018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048018", "evidence": [ { "database": "UniProtKB", "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "Q09YM5", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 103, "end_pos": 105, "annotation": "n_glycosylation_sequon" }, { "start_pos": 132, "end_pos": 134, "annotation": "n_glycosylation_sequon" }, { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "Q09YM5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q09YM5" }, { "id": "PF00129", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00129" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "MHC class I-like antigen recognition-like", "eco_id": "ECO_0000259", "start_pos": 26, "end_pos": 195, "start_aa": "Ala", "end_aa": "Leu", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 103, "end_pos": 105 }, { "start_pos": 132, "end_pos": 134 }, { "start_pos": 32, "end_pos": 34 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P762-1", "uniprot_ac": "A0ABI0P762", "uniprot_id": "A0ABI0P762_BOVIN", "mass": { "chemical_mass": 127911.0, "monoisotopic_mass": 127911.0 }, "refseq": { "ac": "XP_015327160", "name": "electrogenic sodium bicarbonate cotransporter 1 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015327160" }, "gene_names": [ { "name": "SLC4A4", "type": "recommended", "evidence": [ { "id": "A0ABI0P762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ] }, { "name": "NBC1", "type": "synonym", "evidence": [ { "id": "XP_015327160", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015327160" } ] }, { "name": "SLC4A4", "type": "synonym", "evidence": [ { "id": "XP_015327160", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015327160" } ] } ], "protein_names": [ { "name": "Anion exchange protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762/entry#names_and_taxonomy" } ] }, { "name": "electrogenic sodium bicarbonate cotransporter 1 isoform X1", "type": "synonym", "evidence": [ { "id": "XP_015327160", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015327160" } ] } ], "function": [ { "annotation": "Electrogenic sodium/bicarbonate cotransporter with a Na(+):HCO3(-) stoichiometry varying from 1:2 to 1:3. May regulate bicarbonate influx/efflux at the basolateral membrane of cells and regulate intracellular pH.", "evidence": [ { "database": "UniProtKB", "id": "A0A3Q1MD08", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MD08#function" }, { "database": "UniProtKB", "id": "ARBA00037277", "url": "https://www.uniprot.org/uniprotkb/ARBA00037277#function" }, { "database": "UniProtKB", "id": "A0A3Q1LSH1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LSH1#function" }, { "database": "UniProtKB", "id": "A0A3Q1LUF6", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LUF6#function" }, { "database": "UniProtKB", "id": "A0A3Q1LVR7", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LVR7#function" }, { "database": "UniProtKB", "id": "A0ABI0P208", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P208#function" }, { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762#function" }, { "database": "UniProtKB", "id": "A0ABZ3NNN0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNN0#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "SLC4A4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762", "locus": { "chromosome": "6", "start_pos": 86809057, "end_pos": 86449877, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000002348", "url": "https://www.ensembl.org/id/ENSBTAG00000002348" } ] } } ], "crossref": [ { "id": "ENSBTAG00000002348", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000002348", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "282360", "url": "https://www.ncbi.nlm.nih.gov/gene/282360", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003020", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003020", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011531", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011531", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013769", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013769", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016152", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016152", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "LCMAPAN", "url": "https://omabrowser.org/oma/group/LCMAPAN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A3Q1LUF6", "url": "https://www.orthodb.org/?gene=A0A3Q1LUF6", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "A0A3Q1LVR7", "url": "https://www.orthodb.org/?gene=A0A3Q1LVR7", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11453:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11453:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00955", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00955", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF07565", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07565", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-425381", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-425381", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "XP_015327160", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_015327160", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "72215", "url": "https://www.rhea-db.org/rhea/72215", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "72219", "url": "https://www.rhea-db.org/rhea/72219", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A3Q1LSH1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LSH1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LSH1-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LSH1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LUF6", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LUF6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LUF6-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LUF6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LVR7", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LVR7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LVR7-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LVR7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MD08", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MD08", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MD08-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MD08-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P208", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P208", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P208-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P208-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P762-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABZ3NNN0", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNN0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABZ3NNN0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNN0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCACVCVRVYIFMQWVFKELSTEAGFPQTTITSTPGTPNFLSWMEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHREKKEKERISENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDSPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHADCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTQFSCVCMPPDPVNISVSNDTTLAPEDLPTISSSNMYHNATFDWAFLTTKECLKYGGKLVGNNCGFVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVAPFGGNPWWVYLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDEKDHQHSLNAIHHADKIPFLRSLGMPSPRTPVKVVPQIRIELEPEDNDYFWRSKGTETTL", "length": 1136, "header": "tr|A0ABI0P762-1|A0ABI0P762_BOVIN Isoform 1 of Anion exchange protein OS=Bos taurus OX=9913 GN=SLC4A4 PE=3 SV=1 CANONICAL=A0ABI0P762-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1LSH1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762/entry#A0A3Q1LSH1-1", "sequence": { "sequence": "MSTENVEGKPTSSGDRGRPRSYTLLRVVQPMFNRSIFTSAVSPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDSPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHADCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTQFSCVCMPPDPGQNIMLSVYAYLLFGRSRRLHACKLSTWYYDPQKWVLFFPLRNHAAEFIVSLPEVS", "length": 646, "header": "tr|A0A3Q1LSH1-1|A0ABI0P762_BOVIN Computationally mapped isoform of Anion exchange protein OS=Bos taurus OX=9913 GN=SLC4A4 PE=3 SV=1 CANONICAL=A0ABI0P762-1" }, "locus": { "chromosome": "6", "start_pos": 86738277, "end_pos": 86602775, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000084190.3", "url": "https://www.ensembl.org/id/ENSBTAT00000084190.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000060194.2", "url": "https://www.ensembl.org/id/ENSBTAP00000060194.2" } ] } }, { "isoform_ac": "A0A3Q1LUF6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762/entry#A0A3Q1LUF6-1", "sequence": { "sequence": "MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHREKKEKERISENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNARSPLENSVPCLATRTLDDDPRVRRSPSVGWLSSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDSPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHADCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTQFSCVCMPPDPVNISVSNDTTLAPEDLPTISSSNMYHNATFDWAFLTTKECLKYGGKLVGNNCGFVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVAPFGGNPWWVYLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC", "length": 1027, "header": "tr|A0A3Q1LUF6-1|A0ABI0P762_BOVIN Computationally mapped isoform of Anion exchange protein OS=Bos taurus OX=9913 GN=SLC4A4 PE=3 SV=2 CANONICAL=A0ABI0P762-1" }, "locus": { "chromosome": "6", "start_pos": 86808296, "end_pos": 86503215, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000075854.3", "url": "https://www.ensembl.org/id/ENSBTAT00000075854.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000060761.2", "url": "https://www.ensembl.org/id/ENSBTAP00000060761.2" } ] } }, { "isoform_ac": "A0A3Q1LVR7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762/entry#A0A3Q1LVR7-1", "sequence": { "sequence": "MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHREKKEKERISENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNARSPLENSVPCLATRTLDDDPRVRRSPSVGWLSSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDSPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHADCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTQFSCVCMPPDPVNISVSNDTTLAPEDLPTISSSNMYHNATFDWAFLTTKECLKYGGKLVGNNCGFVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVAPFGGNPWWVYLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC", "length": 1111, "header": "tr|A0A3Q1LVR7-1|A0ABI0P762_BOVIN Computationally mapped isoform of Anion exchange protein OS=Bos taurus OX=9913 GN=SLC4A4 PE=3 SV=2 CANONICAL=A0ABI0P762-1" }, "locus": { "chromosome": "6", "start_pos": 86808296, "end_pos": 86503215, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000067087.3", "url": "https://www.ensembl.org/id/ENSBTAT00000067087.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000064753.2", "url": "https://www.ensembl.org/id/ENSBTAP00000064753.2" } ] } }, { "isoform_ac": "A0A3Q1MD08-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762/entry#A0A3Q1MD08-1", "sequence": { "sequence": "MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHREKKEKERISENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDSPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHADCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTQFSCVCMPPDPVNISVSNDTTLAPEDLPTISSSNMARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVAPFGGNPWWVYLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC", "length": 1015, "header": "tr|A0A3Q1MD08-1|A0ABI0P762_BOVIN Computationally mapped isoform of Anion exchange protein OS=Bos taurus OX=9913 GN=SLC4A4 PE=3 SV=1 CANONICAL=A0ABI0P762-1" }, "locus": { "chromosome": "6", "start_pos": 86808296, "end_pos": 86503215, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000080169.3", "url": "https://www.ensembl.org/id/ENSBTAT00000080169.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000068265.2", "url": "https://www.ensembl.org/id/ENSBTAP00000068265.2" } ] } }, { "isoform_ac": "A0ABI0P208-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762/entry#A0ABI0P208-1", "sequence": { "sequence": "MCACVCVRVYIFMQWVFKELSTEAGFPQTTITSTPGTPNFLSWMEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHREKKEKERISENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDSPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHADCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTQFSCVCMPPDPVNISVSNDTTLAPEDLPTISSSNMYHNATFDWAFLTTKECLKYGGKLVGNNCGFVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVAPFGGNPWWVYLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDRERSPTFLERHTSC", "length": 1122, "header": "tr|A0ABI0P208-1|A0ABI0P762_BOVIN Computationally mapped isoform of Anion exchange protein OS=Bos taurus OX=9913 GN=SLC4A4 PE=3 SV=1 CANONICAL=A0ABI0P762-1" }, "locus": { "chromosome": "6", "start_pos": 86808296, "end_pos": 86502749, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000154140.1", "url": "https://www.ensembl.org/id/ENSBTAT00000154140.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104510.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104510.1" } ] } }, { "isoform_ac": "A0ABI0P762-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762/entry#A0ABI0P762-1", "sequence": { "sequence": "MCACVCVRVYIFMQWVFKELSTEAGFPQTTITSTPGTPNFLSWMEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHREKKEKERISENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDSPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHADCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTQFSCVCMPPDPVNISVSNDTTLAPEDLPTISSSNMYHNATFDWAFLTTKECLKYGGKLVGNNCGFVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVAPFGGNPWWVYLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDEKDHQHSLNAIHHADKIPFLRSLGMPSPRTPVKVVPQIRIELEPEDNDYFWRSKGTETTL", "length": 1136, "header": "tr|A0ABI0P762-1|A0ABI0P762_BOVIN Isoform 1 of Anion exchange protein OS=Bos taurus OX=9913 GN=SLC4A4 PE=3 SV=1 CANONICAL=A0ABI0P762-1" }, "locus": { "chromosome": "6", "start_pos": 86809128, "end_pos": 86502749, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000135048.2", "url": "https://www.ensembl.org/id/ENSBTAT00000135048.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107617.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107617.1" } ] } }, { "isoform_ac": "A0ABZ3NNN0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762/entry#A0ABZ3NNN0-1", "sequence": { "sequence": "MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRRRRRHKRKTGHREKKEKERISENYSDKSDVENADESSSSILKPLISPAAERIRFILGEEDDSPAPPQLFTELDELLAVDGQEMEWKETARWIKFEEKVEQGGERWSKPHVATLSLHSLFELRTCMEKGSIMLDREASSLPQLVEMIVDHQIETGLLKPDLKDKVTYTLLRKHRHQTKKSNLRSLADIGKTVSSASRMFTNPDNGSPAMTHRNLTSSSLNDISDKPEKDQLKNKFMKKLPRDAEASNVLVGEVDFLDSPFIAFVRLQQAVMLGALTEVPVPTRFLFILLGPKGKAKSYHEIGRAIATLMSDEVFHDIAYKAKDRQDLIAGIDEFLDEVIVLPPGEWDPAIRIEPPKSLPSSDKRKNMYSGGENVQMNGDTPHDGGHGGGGHADCEELQRTGRFCGGLIKDIKRKAPFFASDFYDALNIQALSAILFIYLATVTNAITFGGLLGDATDNMQGVLESFLGTAVSGAIFCLFAGQPLTILSSTGPVLVFERLLFNFSKDHNFDYLEFRLWIGLWSAFLCLILVATDASFLVQYFTRFTEEGFSSLISFIFIYDAFKKMIKLADYYPINSNFKVGYNTQFSCVCMPPDPVNISVSNDTTLAPEDLPTISSSNMYHNATFDWAFLTTKECLKYGGKLVGNNCGFVPDITLMSFILFLGTYTSSMALKKFKTSPYFPTTARKLISDFAIILSILIFCVIDALVGVDTPKLIVPSEFKPTSPNRGWFVAPFGGNPWWVYLAAAIPALLVTILIFMDQQITAVIVNRKEHKLKKGAGYHLDLFWVAILMVVCSFMALPWYVAATVISIAHIDSLKMETETSAPGEQPKFLGVREQRVTGTLVFILTGLSVFMAPILKFIPMPVLYGVFLYMGVASLNGVQFMDRLKLLLMPLKHQPDFIYLRHVPLRRVHLFTFLQVLCLALLWILKSTVAAIIFPVMILALVAVRKGMDYLFSQHDLSFLDDVIPEKDKKKKEDEKKKKKKKGSLDSDNDDSDCPYSEKVPSIKIPMDIMEQQPFLSDSKPSDSE", "length": 1067, "header": "tr|A0ABZ3NNN0-1|A0ABZ3NNN0_BOVIN Computationally mapped isoform of Anion exchange protein OS=Bos taurus OX=9913 GN=SLC4A4 PE=3 SV=1 CANONICAL=A0ABI0P762-1" }, "locus": { "chromosome": "6", "start_pos": 86805742, "end_pos": 86503215, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000003032.7", "url": "https://www.ensembl.org/id/ENSBTAT00000003032.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000003032.7", "url": "https://www.ensembl.org/id/ENSBTAP00000003032.7" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "R-BTA-425381", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-425381", "resource": "Reactome", "description": "Bicarbonate transporters" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "monoatomic anion transmembrane transporter activity", "id": "GO:0008509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008509", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ], "pmid": "" }, { "name": "solute:inorganic anion antiporter activity", "id": "GO:0005452", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005452", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ], "pmid": "" }, { "name": "sodium:bicarbonate symporter activity", "id": "GO:0008510", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008510", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ], "pmid": "" }, { "name": "bicarbonate transport", "id": "GO:0015701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015701", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ], "pmid": "" }, { "name": "regulation of intracellular pH", "id": "GO:0051453", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051453", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P762", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 106, "end_pos": 108, "annotation": "n_glycosylation_sequon" }, { "start_pos": 286, "end_pos": 288, "annotation": "n_glycosylation_sequon" }, { "start_pos": 295, "end_pos": 297, "annotation": "n_glycosylation_sequon" }, { "start_pos": 584, "end_pos": 586, "annotation": "n_glycosylation_sequon" }, { "start_pos": 679, "end_pos": 681, "annotation": "n_glycosylation_sequon" }, { "start_pos": 684, "end_pos": 686, "annotation": "n_glycosylation_sequon" }, { "start_pos": 704, "end_pos": 706, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "72215", "name": "", "equation": "2 hydrogencarbonate(out) + Na(+)(out) = 2 hydrogencarbonate(in) + Na(+)(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "72215", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/72215" } ] }, { "id": "72219", "name": "", "equation": "3 hydrogencarbonate(out) + Na(+)(out) = 3 hydrogencarbonate(in) + Na(+)(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "72219", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/72219" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" }, { "id": "PF07565", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07565" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Band 3 cytoplasmic", "eco_id": "ECO_0000259", "start_pos": 150, "end_pos": 430, "start_aa": "Gln", "end_aa": "Pro", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P762", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P762" }, { "id": "PF00955", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00955" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Bicarbonate transporter-like transmembrane", "eco_id": "ECO_0000259", "start_pos": 484, "end_pos": 1049, "start_aa": "Arg", "end_aa": "Ile", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 106, "end_pos": 108 }, { "start_pos": 286, "end_pos": 288 }, { "start_pos": 295, "end_pos": 297 }, { "start_pos": 584, "end_pos": 586 }, { "start_pos": 679, "end_pos": 681 }, { "start_pos": 684, "end_pos": 686 }, { "start_pos": 704, "end_pos": 706 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5K5-1", "uniprot_ac": "A0ABI0P5K5", "uniprot_id": "A0ABI0P5K5_BOVIN", "mass": { "chemical_mass": 94948.0, "monoisotopic_mass": 94948.0 }, "refseq": {}, "gene_names": [ { "name": "CD22", "type": "recommended", "evidence": [ { "id": "A0ABI0P5K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ] } ], "protein_names": [ { "name": "B-cell receptor CD22", "type": "recommended", "evidence": [ { "id": "A0ABI0P5K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5/entry#names_and_taxonomy" } ] }, { "name": "Sialic acid-binding Ig-like lectin 2", "type": "synonym", "evidence": [ { "id": "A0ABI0P5K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Most highly expressed siglec (sialic acid-binding immunoglobulin-like lectin) on B-cells that plays a role in various aspects of B-cell biology including differentiation, antigen presentation, and trafficking to bone marrow. Binds to alpha 2,6-linked sialic acid residues of surface molecules such as CD22 itself, CD45 and IgM in a cis configuration. Can also bind to ligands on other cells as an adhesion molecule in a trans configuration. Acts as an inhibitory coreceptor on the surface of B-cells and inhibits B-cell receptor induced signaling, characterized by inhibition of the calcium mobilization and cellular activation. Mechanistically, the immunoreceptor tyrosine-based inhibitory motif domain is phosphorylated by the Src kinase LYN, which in turn leads to the recruitment of the protein tyrosine phosphatase 1/PTPN6, leading to the negative regulation of BCR signaling. If this negative signaling from is of sufficient strength, apoptosis of the B-cell can be induced.", "evidence": [ { "database": "UniProtKB", "id": "A0A3Q1NI55", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1NI55#function" }, { "database": "UniProtKB", "id": "ARBA00045430", "url": "https://www.uniprot.org/uniprotkb/ARBA00045430#function" }, { "database": "UniProtKB", "id": "F1MFW5", "url": "https://www.uniprot.org/uniprotkb/F1MFW5#function" }, { "database": "UniProtKB", "id": "A0ABI0P6Q7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Q7#function" }, { "database": "UniProtKB", "id": "A0ABI0NQS7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NQS7#function" }, { "database": "UniProtKB", "id": "A0ABI0NSY3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NSY3#function" }, { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "CD22", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5", "locus": { "chromosome": "18", "start_pos": 46049650, "end_pos": 46035918, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000011887", "url": "https://www.ensembl.org/id/ENSBTAG00000011887" } ] } } ], "crossref": [ { "id": "ENSBTAG00000011887", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000011887", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00096", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00096", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "514582", "url": "https://www.ncbi.nlm.nih.gov/gene/514582", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR056386", "url": "https://www.ebi.ac.uk/interpro/entry/IPR056386", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:514582", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:514582", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "DWNNQDL", "url": "https://omabrowser.org/oma/group/DWNNQDL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR46958", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46958", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46958:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46958:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08205", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08205", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF13895", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13895", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF13927", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13927", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF24518", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF24518", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "R-BTA-198933", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-198933", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-5690714", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5690714", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "R-BTA-983695", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-983695", "database": "Reactome", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A3Q1NI55", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1NI55", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1NI55-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1NI55-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NQS7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NQS7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NQS7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NQS7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NSY3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NSY3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NSY3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NSY3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5K5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6Q7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Q7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6Q7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Q7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MFW5", "url": "https://www.uniprot.org/uniprotkb/F1MFW5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MFW5-1", "url": "https://www.uniprot.org/uniprotkb/F1MFW5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MHLLGPSLLLLEYLAFSDSAWNFRHPKTLYAWDGACVWIPCTYSSVKGGGHTLDNLTVYHNFTYDKKTKHYNGTILYNKSLKTKESTPSQERVQFLGNNRNNCTLLINPVKVNDSGLLGLRVTSGTDKWMASLNLMYMFHAPQPHIELHQEIREDQEVTVTCSLNFACRDYQVHLQWSLEGSVTTSTILSPERVATQSHLSFQPKWTHDGKNLTCQLWDPMKQRILSEKTVLLEVKHAPNLEIQVSPQEAIVTEGESVTMRCQVISSNPPHWSVSWFKDRTKLKEQGTTLVLPEVTRTMSGQYTCQVSNDVGSRQSDVVDLQVHYPPEPSWVQLSPSSIKEGVTVELTCMSVANPPPANYTWYFNEQEIPGKNGRTFQIPQVLVKHAGRYSCLAENSLGPGSVDREADLNVQYPPKGVTTVIQNPTPIREGDSVTLSCTFNSSNPRVTRYNWNSPGSQDHTSQKLTIQKVTWDAQPVKCEACNQWCSWSPSVNLNVLYAPRDVNIQISPNTEIQSEKRVLLQCQYSSSRPADVHFFWKKDGSLLKEGKTLTFGQIFPEDSGTYHCLVNNSIGQTSSKAYELQVLYAPRRLRVSISPKDGVVEGKTAVLTCESDANPPISHYDWFDGKNQDLHYYGQMLRLEPVKLQHAGSYWCRGTNRLGQSQSPPTTLTVYYSAATISRRAALGVGFCLAIFLLAIWGVKLQRSWKRIQRQQGLQESSSGQSFFVRNLKARRTPQAERPASLGCYNPVMEDAVSYATLSFPLGETDTRRLRDAGSSEMREIPPSRDDRVTYAVVQNCQVADYENVTPEVLDDEGIHYSELVHFGNGKRALAQEGVEYVTLKH", "length": 843, "header": "tr|A0ABI0P5K5-1|A0ABI0P5K5_BOVIN Isoform 1 of B-cell receptor CD22 OS=Bos taurus OX=9913 GN=CD22 PE=3 SV=1 CANONICAL=A0ABI0P5K5-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1NI55-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5/entry#A0A3Q1NI55-1", "sequence": { "sequence": "MDGWKKGRSASPTWCWADGRGMAYPEKAHELLEFPILLCNQSLFSGDQGKGVGIGAQEELSGRCQRPGGSKTNSSWPRLLPRHSTMHLLGPSLLLLEYLAFSDSAWNFRHPKTLYAWDGACVWIPCTYSSVKGGGHTLDNLTVYHNFTYDKKTKHYNGTILYNKSLKTKESTPSQERVQFLGNNRNNCTLLINPVKVNDSGLLGLRVTSGTDKWMASLNLSISESAPQPHIELHQEIREDQEVTVTCSLNFACRDYQVHLQWSLEGSVTTSTILSPERVATQSHLSFQPKWTHDGKNLTCQLWDPMKQRILSEKTVLLEVKHAPNLEIQVSPQEAIVTEGESVTMRCQVISSNPPHWSVSWFKDRTKLKEQGTTLVLPEVTRTMSGQYTCQVSNDVGSRQSDVVDLQVHYPPEPSWVQLSPSSIKEGVTVELTCMSVANPPPANYTWYFNEQEIPGKNGRTFQIPQVLVKHAGRYSCLAENSLGPGSVDREADLNVQYPPKGVTTVIQNPTPIREGDSVTLSCTFNSSNPRVTRYNWNSPGSQDHTSQKLTIQKVTWDAQPVKCEACNQWCSWSPSVNLNVLYAPRDVNIQISPNTEIQSEKRVLLQCQYSSSRPADVHFFWKKDGSLLKEGKTLTFGQIFPEDSGTYHCLVNNSIGQTSSKAYELQVLYAPRRLRVSISPKDGVVEGKTAVLTCESDANPPISHYDWFDGKNQDLHYYGQMLRLEPVKLQHAGSYWCRGTNRLGQSQSPPTTLTVYYSAATISRRAALGVGFCLAIFLLAIWGVKLQRSWKRIQRQQGLQESSSGQSFFVRNLKARRTPQAERPASLGCYNPVMEDAVSYATLSFPLGETDTRRLRDAGSSEMREIPPSRDDRVTYAVVQNCQVADYENVTPEVLDDEGIHYSELVHFGNGKRALAQEGVEYVTLKH", "length": 928, "header": "tr|A0A3Q1NI55-1|A0ABI0P5K5_BOVIN Computationally mapped isoform of B-cell receptor CD22 OS=Bos taurus OX=9913 GN=CD22 PE=3 SV=1 CANONICAL=A0ABI0P5K5-1" }, "locus": { "chromosome": "18", "start_pos": 46048646, "end_pos": 46037871, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000081458.3", "url": "https://www.ensembl.org/id/ENSBTAT00000081458.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000071682.1", "url": "https://www.ensembl.org/id/ENSBTAP00000071682.1" } ] } }, { "isoform_ac": "A0ABI0NQS7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5/entry#A0ABI0NQS7-1", "sequence": { "sequence": "YSSWNFRHPKTLYAWDGACVWIPCTYSSVKGGGHTLDNLTVYHNFTYDKKTKHYNGTILYNKSLKTKESTPSQERVQFLGNNRNNCTLLINPVKVNDSGLLGLRVTSGTDKWMASLNLSISESAPQPHIELHQEIREDQEVTVTCSLNFACRDYQVHLQWSLEGSVTTSTILSPERVATQSHLSFQPKWTHDGKNLTCQLWDPMKQRILSEKTVLLEVKHAPNLEIQVSPQEAIVTEGESVTMRCQVISSNPPHWSVSWFKDRTKLKEQGTTLVLPEVTRTMSGQYTCQVSNDVGSRQSDVVDLQVHYPPEPSWVQLSPSSIKEGVTVELTCMSVANPPPANYTWYFNEQEIPGKNGRTFQIPQVLVKHAGRYSCLAENSLGPGSVDREADLNVQYPPKGVTTVIQNPTPIREGDSVTLSCTFNSSNPRVTRYNWNSPGSQDHTSQKLTIQKVTWDAQPVKCEACNQWCSWSPSVNLNVLYAPRDVNIQISPNTEIQSEKRVLLQCQYSSSRPADVHFFWKKDGSLLKEGKTLTFGQIFPEDSGTYHCLVNNSIGQTSSKAYELQVLYAPRRLRVSISPKDGVVEGKTAVLTCESDANPPISHYDWFDGKNQDLHYYGQMLRLEPVKLQHAGSYWCRGTNRLGQSQSPPTTLTVYYSAATISRRAALGVGFCLAIFLLAIWGVKLQRSWKRIQRQQGLQESSSGQSFFVRNLKARRTPQAERPASLGCYNPVMEDAVSYATLSFPLGETDTRRLRDAGSSEMREIPPSRDDRVTYAVVQNCQVADYENVTPEVLDDEGIHYSELVHFGNGKRALAQEGVEYVTLKH", "length": 826, "header": "tr|A0ABI0NQS7-1|A0ABI0P5K5_BOVIN Computationally mapped isoform of B-cell receptor CD22 OS=Bos taurus OX=9913 GN=CD22 PE=3 SV=1 CANONICAL=A0ABI0P5K5-1" }, "locus": { "chromosome": "18", "start_pos": 46048646, "end_pos": 46038451, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147277.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147277.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000105801.1", "url": "https://www.ensembl.org/id/ENSBTAP00000105801.1" } ] } }, { "isoform_ac": "A0ABI0NSY3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5/entry#A0ABI0NSY3-1", "sequence": { "sequence": "MHLLGPSLLLLEYLAFSDSAWNFRHPKTLYAWDGACVWIPCTYSSVKGGGHTLDNLTVYHNFTYDKKTKHYNGTILYNKSLKTKESTPSQERVQFLGNNRNNCTLLINPVKVNDSGLLGLRVTSGTDKWMASLNLSISESAPQPHIELHQEIREDQEVTVTCSLNFACRDYQVHLQWSLEGSVTTSTILSPERVATQSHLSFQPKWTHDGKNLTCQLWDPMKQRILSEKTVLLEVKHAPNLEIQVSPQEAIVTEGESVTMRCQVISSNPPHWSVSWFKDRTKLKEQGTTLVLPEVTRTMSGQYTCQVSNDVGSRQSDVVDLQVHYPPEPSWVQLSPSSIKEGVTVELTCMSVANPPPANYTWYFNEQEIPGKNGRTFQIPQVLVKHAGRYSCLAENSLGPGSRKPEGTDTDIRDPPKGVTTVIQNPTPIREGDSVTLSCTFNSSNPRVTRYNWNSPGSQDHTSQKLTIQKVTWDAQPVKCEACNQWCSWSPSVNLNVLYAPRDVNIQISPNTEIQSEKRVLLQCQYSSSRPADVHFFWKKDGSLLKEGKTLTFGQIFPEDSGTYHCLVNNSIGQTSSKAYELQVLYAPRRLRVSISPKDGVVEGKTAVLTCESDANPPISHYDWFDGKNQDLHYYGQMLRLEPVKLQHAGSYWCRGTNRLGQSQSPPTTLTVYYSAATISRRAALGVGFCLAIFLLAIWGVKLQRSWKRIQRQQGLQESSSGQSFFVRNLKARRTPQAERPASLGCYNPVMEDAVSYATLSFPLGETDTRRLRDAGSSEMREIPPSRDDRVTYAVVQNCQVADYENVTPEVLDDEGIHYSELVHFGNGKRALAQEGVEYVTLKH", "length": 844, "header": "tr|A0ABI0NSY3-1|A0ABI0P5K5_BOVIN Computationally mapped isoform of B-cell receptor CD22 OS=Bos taurus OX=9913 GN=CD22 PE=3 SV=1 CANONICAL=A0ABI0P5K5-1" }, "locus": { "chromosome": "18", "start_pos": 46048646, "end_pos": 46038126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000145970.1", "url": "https://www.ensembl.org/id/ENSBTAT00000145970.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107366.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107366.1" } ] } }, { "isoform_ac": "A0ABI0P5K5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5/entry#A0ABI0P5K5-1", "sequence": { "sequence": "MHLLGPSLLLLEYLAFSDSAWNFRHPKTLYAWDGACVWIPCTYSSVKGGGHTLDNLTVYHNFTYDKKTKHYNGTILYNKSLKTKESTPSQERVQFLGNNRNNCTLLINPVKVNDSGLLGLRVTSGTDKWMASLNLMYMFHAPQPHIELHQEIREDQEVTVTCSLNFACRDYQVHLQWSLEGSVTTSTILSPERVATQSHLSFQPKWTHDGKNLTCQLWDPMKQRILSEKTVLLEVKHAPNLEIQVSPQEAIVTEGESVTMRCQVISSNPPHWSVSWFKDRTKLKEQGTTLVLPEVTRTMSGQYTCQVSNDVGSRQSDVVDLQVHYPPEPSWVQLSPSSIKEGVTVELTCMSVANPPPANYTWYFNEQEIPGKNGRTFQIPQVLVKHAGRYSCLAENSLGPGSVDREADLNVQYPPKGVTTVIQNPTPIREGDSVTLSCTFNSSNPRVTRYNWNSPGSQDHTSQKLTIQKVTWDAQPVKCEACNQWCSWSPSVNLNVLYAPRDVNIQISPNTEIQSEKRVLLQCQYSSSRPADVHFFWKKDGSLLKEGKTLTFGQIFPEDSGTYHCLVNNSIGQTSSKAYELQVLYAPRRLRVSISPKDGVVEGKTAVLTCESDANPPISHYDWFDGKNQDLHYYGQMLRLEPVKLQHAGSYWCRGTNRLGQSQSPPTTLTVYYSAATISRRAALGVGFCLAIFLLAIWGVKLQRSWKRIQRQQGLQESSSGQSFFVRNLKARRTPQAERPASLGCYNPVMEDAVSYATLSFPLGETDTRRLRDAGSSEMREIPPSRDDRVTYAVVQNCQVADYENVTPEVLDDEGIHYSELVHFGNGKRALAQEGVEYVTLKH", "length": 843, "header": "tr|A0ABI0P5K5-1|A0ABI0P5K5_BOVIN Isoform 1 of B-cell receptor CD22 OS=Bos taurus OX=9913 GN=CD22 PE=3 SV=1 CANONICAL=A0ABI0P5K5-1" }, "locus": { "chromosome": "18", "start_pos": 46048646, "end_pos": 46038126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147728.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147728.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107045.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107045.1" } ] } }, { "isoform_ac": "A0ABI0P6Q7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5/entry#A0ABI0P6Q7-1", "sequence": { "sequence": "TCDPSPSLVLCSLWWVPEYLAFSDSAWNFRHPKTLYAWDGACVWIPCTYSSVKGGGHTLDNLTVYHNFTYDKKTKHYNGTILYNKSLKTKESTPSQERVQFLGNNRNNCTLLINPVKVNDSGLLGLRVTSGTDKWMASLNLSISESAPQPHIELHQEIREDQEVTVTCSLNFACRDYQVHLQWSLEGSVTTSTILSPERVATQSHLSFQPKWTHDGKNLTCQLWDPMKQRILSEKTVLLEVKHAPNLEIQVSPQEAIVTEGESVTMRCQVISSNPPHWSVSWFKDRTKLKEQGTTLVLPEVTRTMSGQYTCQVSNDVGSRQSDVVDLQVHYPPEPSWVQLSPSSIKEGVTVELTCMSVANPPPANYTWYFNEQEIPGKNGRTFQIPQVLVKHAGRYSCLAENSLGPGSVDREADLNVQYPPKGVTTVIQNPTPIREGDSVTLSCTFNSSNPRVTRYNWNSPGSQDHTSQKLTIQKVTWDAQPVKCEACNQWCSWSPSVNLNVLYAPRDVNIQISPNTEIQSEKRVLLQCQYSSSRPADVHFFWKKDGSLLKEGKTLTFGQIFPEDSGTYHCLVNNSIGQTSSKAYELQVLYAPRRLRVSISPKDGVVEGKTAVLTCESDANPPISHYDWFDGKNQDLHYYGQMLRLEPVKLQHAGSYWCRGTNRLGQSQSPPTTLTVYYSAATISRRAALGVGFCLAIFLLAIWGVKLQRSWKRIQRQQGLQESSSGQSFFVRNLKARRTPQAERPASLGCYNPVMEDAVSYATLSFPLGETDTRRLRDAGSSEMREIPPSRDDRVTYAVVQNCQADYENVTPEVLDDEGIHYSELVHFGNGKRALAQEGVEYVTLKH", "length": 848, "header": "tr|A0ABI0P6Q7-1|A0ABI0P6Q7_BOVIN Computationally mapped isoform of B-cell receptor CD22 OS=Bos taurus OX=9913 GN=CD22 PE=3 SV=1 CANONICAL=A0ABI0P5K5-1" }, "locus": { "chromosome": "18", "start_pos": 46048646, "end_pos": 46038652, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000149157.1", "url": "https://www.ensembl.org/id/ENSBTAT00000149157.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107526.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107526.1" } ] } }, { "isoform_ac": "F1MFW5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5/entry#F1MFW5-1", "sequence": { "sequence": "MRIQGKGVGIGAQEELSGRCQRPGGSKTNSSWPRLLPRHSTMHLLGPSLLLLEYLAFSDSAWNFRHPKTLYAWDGACVWIPCTYSSVKGGGHTLDNLTVYHNFTYDKKTKHYNGTILYNKSLKTKESTPSQERVQFLGNNRNNCTLLINPVKVNDSGLLGLRVTSGTDKWMASLNLSISESAPQPHIELHQEIREDQEVTVTCSLNFACRDYQVHLQWSLEGSVTTSTILSPERVATQSHLSFQPKWTHDGKNLTCQLWDPMKQRILSEKTVLLEVKHAPNLEIQVSPQEAIVTEGESVTMRCQVISSNPPHWSVSWFKDRTKLKEQGTTLVLPEVTRTMSGQYTCQVSNDVGSRQSDVVDLQVHYPPEPSWVQLSPSSIKEGVTVELTCMSVANPPPANYTWYFNEQEIPGKNGRTFQIPQVLVKHAGRYSCLAENSLGPGSVDREADLNVQYPPKGVTTVIQNPTPIREGDSVTLSCTFNSSNPRVTRYNWNSPGSQDHTSQKLTIQKVTWDAQPVKCEACNQWCSWSPSVNLNVLYAPRDVNIQISPNTEIQSEKRVLLQCQYSSSRPADVHFFWKKDGSLLKEGKTLTFGQIFPEDSGTYHCLVNNSIGQTSSKAYELQVLYAPRRLRVSISPKDGVVEGKTAVLTCESDANPPISHYDWFDGKNQDLHYYGQMLRLEPVKLQHAGSYWCRGTNRLGQSQSPPTTLTVYYSAATISRRAALGVGFCLAIFLLAIWGVKLQRSWKRIQRQQGLQESSSGQSFFVRNLKARRTPQAERPASLGCYNPVMEDAVSYATLSFPLGETDTRRLRDAGSSEMREIPPSRDDRVTYAVVQNCQVADYENVTPEVLDDEGIHYSELVHFGNGKRALAQEGVEYVTLKH", "length": 884, "header": "tr|F1MFW5-1|A0ABI0P5K5_BOVIN Computationally mapped isoform of B-cell receptor CD22 OS=Bos taurus OX=9913 GN=CD22 PE=3 SV=3 CANONICAL=A0ABI0P5K5-1" }, "locus": { "chromosome": "18", "start_pos": 46048646, "end_pos": 46035990, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000015781.8", "url": "https://www.ensembl.org/id/ENSBTAT00000015781.8" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000015781.7", "url": "https://www.ensembl.org/id/ENSBTAP00000015781.7" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:514582", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:514582", "resource": "KEGG Pathway" }, { "id": "R-BTA-198933", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-198933", "resource": "Reactome", "description": "Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell" }, { "id": "R-BTA-5690714", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-5690714", "resource": "Reactome", "description": "CD22 mediated BCR regulation" }, { "id": "R-BTA-983695", "name": "", "url": "https://www.reactome.org/PathwayBrowser/#R-BTA-983695", "resource": "Reactome", "description": "Antigen activates B Cell Receptor (BCR) leading to generation of second messengers" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZD88-1", "protein_name": "B-cell receptor CD22", "gene_name": "Cd22", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCVPCPWLLLILGHVASFRSATGWSVEHPQTLFAWEGACIQIPCKYKVPKPRSRLDSILLFQNYTFDNTTRDFTGKVLYNNTKASIETELYFSQQDRVTFLGNRSNNCTLKIDPIHANDSGKLGLRLISGTDKWMEHIHLNVSERPFQPYIQLPSEIRESQRVSLTCGLNFTCFGYDISLRWSLDGSEVSPVTSSITSSVENVYTESKLTFQPKWTDHGKSMMCQVWHFSQVLSERTVRLDVKYTPKLQITVNPTEVKEGNSVTMTCQVNSSNPSLSTKKVSWFKDGSFLKEQQEQEELTLHSVTKDMRGKYQCRASNNIGQGQSKEVALTVLYPPEPSKVHIYPSPAEEGQSVELICDSLASPRATNYTWYHNGEMVPGASHEKLQISNVSLWHAGKYSCLAENRLGCGKIEQEAELDVHYVPKAVTTVIQSVTPIREGDSVTLDCRYNSSNPEVTKYEWSPQGSGSEVTPGVLRIQKATWDSPPIKCAACNYKCSWSFPVSLNVHYAPRAVKILKVSPASEIHAGQHVLLQCDFSGSFPTEVRFFWKKNGNLVQEGRYLNFSSISPEDSGNYNCMVRNSIGETSSQAWSLQVLYAPRRLRVSISPGDSVMEGKKATLSCESDAHPPVFKYIWFDANDQDLHFSGQKLRLEPLRVQHTGSYRCQGINELGTGKSPPSTLTVYYSPETIGKRVALGLGFCLAICILAIWGMKIQKKWKHNRSQQGPQDNSSGQSFFVRNKKARRTRLTEGPQSQGCYNLAMDDTVSYAVLRFPESDTHGAGGARSPATQGPPPNDDDTVTYSVLQKRNMGDYENVSPNCPEDESIHYSELVQFGAGKRPQAKEDVDYVTLKH", "length": 852 }, "evidence": [ { "id": "A0ABI0P5K5", "url": "https://omabrowser.org/oma/group/A0ABI0P5K5/", "database": "OMA" } ], "glygen_name": "Rat", "common_name": "Rat" }, { "uniprot_canonical_ac": "P20273-1", "protein_name": "B-cell receptor CD22", "gene_name": "CD22", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILILAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVILKH", "length": 847 }, "evidence": [ { "id": "A0ABI0P5K5", "url": "https://omabrowser.org/oma/group/A0ABI0P5K5/", "database": "OMA" } ], "glygen_name": "Human", "common_name": "Human" }, { "uniprot_canonical_ac": "P35329-1", "protein_name": "B-cell receptor CD22", "gene_name": "Cd22", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRVHYLWLLLILGHVASARYSSANDWTVDHPQTLFAWEGACIRIPCKYKTPLPKARLDNILLFQNYEFDKATKKFTGTVLYNATKTEKDPESELYLSKQGRVTFLGNRIDNCTLKIHPIRANDSGNLGLRMTAGTERWMEPIHLNVSEKPFQPYIQMPSEIRESQSVTLTCGLNFSCFGYDILLKWFLEDSEITSITSSVTSITSSVTSSIKNVYTESKLTFQPKWTDHGKSVKCQVQHSSKVLSERTVRLDVKYTPKLEIKVNPTEVEKNNSVTMTCRVNSSNPKLRTVAVSWFKDGRPLEDQELEQEQQMSKLILHSVTKDMRGKYRCQASNDIGPGESEEVELTVHYAPEPSRVHIYPSPAEEGQSVELICESLASPSATNYTWYHNRKPIPGDTQEKLRIPKVSPWHAGNYSCLAENRLGHGKIDQEAKLDVHYAPKAVTTVIQSFTPILEGDSVTLVCRYNSSNPDVTSYRWNPQGSGSVLKPGVLRIQKVTWDSMPVSCAACNHKCSWALPVILNVHYAPRDVKVLKVSPASEIRAGQRVLLQCDFAESNPAEVRFFWKKNGSLVQEGRYLSFGSVSPEDSGNYNCMVNNSIGETLSQAWNLQVLYAPRRLRVSISPGDHVMEGKKATLSCESDANPPISQYTWFDSSGQDLHSSGQKLRLEPLEVQHTGSYRCKGTNGIGTGESPPSTLTVYYSPETIGKRVALGLGFCLTICILAIWGMKIQKKWKQNRSQQGLQENSSGQSFFVRNKKARRTPLSEGPQSQGCYNPAMDDTVSYAILRFPESDTHNTGDAGTPATQAPPPNNSDSVTYSVIQKRPMGDYENVNPSCPEDESIHYSELVQFGAGKRPQAKEDVDYVTLKH", "length": 868 }, "evidence": [ { "id": "A0ABI0P5K5", "url": "https://omabrowser.org/oma/group/A0ABI0P5K5/", "database": "OMA" } ], "glygen_name": "Mouse", "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "negative regulation of calcium-mediated signaling", "id": "GO:0050849", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050849", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "regulation of endocytosis", "id": "GO:0030100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030100", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "B cell activation", "id": "GO:0042113", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042113", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "regulation of B cell proliferation", "id": "GO:0030888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030888", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "negative regulation of B cell receptor signaling pathway", "id": "GO:0050859", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050859", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "negative regulation of immunoglobulin production", "id": "GO:0002638", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002638", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "recycling endosome", "id": "GO:0055037", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055037", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "external side of plasma membrane", "id": "GO:0009897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009897", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "neuronal cell body membrane", "id": "GO:0032809", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032809", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "CD4 receptor binding", "id": "GO:0042609", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042609", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "carbohydrate binding", "id": "GO:0030246", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030246", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "sialic acid binding", "id": "GO:0033691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033691", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" }, { "name": "protein phosphatase binding", "id": "GO:0019903", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019903", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 113, "end_pos": 115, "annotation": "n_glycosylation_sequon" }, { "start_pos": 212, "end_pos": 214, "annotation": "n_glycosylation_sequon" }, { "start_pos": 359, "end_pos": 361, "annotation": "n_glycosylation_sequon" }, { "start_pos": 441, "end_pos": 443, "annotation": "n_glycosylation_sequon" }, { "start_pos": 55, "end_pos": 57, "annotation": "n_glycosylation_sequon" }, { "start_pos": 568, "end_pos": 570, "annotation": "n_glycosylation_sequon" }, { "start_pos": 61, "end_pos": 63, "annotation": "n_glycosylation_sequon" }, { "start_pos": 72, "end_pos": 74, "annotation": "n_glycosylation_sequon" }, { "start_pos": 78, "end_pos": 80, "annotation": "n_glycosylation_sequon" }, { "start_pos": 805, "end_pos": 807, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K5" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 144, "end_pos": 227, "start_aa": "Pro", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 102, "end_pos": 104 }, { "start_pos": 113, "end_pos": 115 }, { "start_pos": 212, "end_pos": 214 }, { "start_pos": 359, "end_pos": 361 }, { "start_pos": 441, "end_pos": 443 }, { "start_pos": 55, "end_pos": 57 }, { "start_pos": 568, "end_pos": 570 }, { "start_pos": 61, "end_pos": 63 }, { "start_pos": 72, "end_pos": 74 }, { "start_pos": 78, "end_pos": 80 }, { "start_pos": 805, "end_pos": 807 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6R1J3-1", "uniprot_ac": "F6R1J3", "uniprot_id": "F6R1J3_BOVIN", "mass": { "chemical_mass": 62556.0, "monoisotopic_mass": 62556.0 }, "refseq": {}, "gene_names": [ { "name": "MFSD14A", "type": "recommended", "evidence": [ { "id": "F6R1J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6R1J3" } ] } ], "protein_names": [ { "name": "Solute carrier family 71 member 1", "type": "recommended", "evidence": [ { "id": "F6R1J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6R1J3/entry#names_and_taxonomy" } ] }, { "name": "Hippocampus abundant transcript 1 protein", "type": "synonym", "evidence": [ { "id": "F6R1J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6R1J3/entry#names_and_taxonomy" } ] }, { "name": "Major facilitator superfamily domain-containing 14A", "type": "synonym", "evidence": [ { "id": "F6R1J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6R1J3/entry#names_and_taxonomy" } ] }, { "name": "Putative tetracycline transporter-like protein", "type": "synonym", "evidence": [ { "id": "F6R1J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6R1J3/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Probable membrane-bound transporter. May play a role in neuronal nutrient sensing and energy homeostasis. Required for the final stages of spermatogenesis.", "evidence": [ { "database": "UniProtKB", "id": "A0A3Q1LZ27", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LZ27#function" }, { "database": "UniProtKB", "id": "ARBA00094115", "url": "https://www.uniprot.org/uniprotkb/ARBA00094115#function" }, { "database": "UniProtKB", "id": "F6R1J3", "url": "https://www.uniprot.org/uniprotkb/F6R1J3#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6R1J3", "url": "https://www.uniprot.org/uniprotkb/F6R1J3" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "MFSD14A", "url": "https://www.uniprot.org/uniprotkb/F6R1J3", "locus": { "chromosome": "3", "start_pos": 43182319, "end_pos": 43236046, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000015776", "url": "https://www.ensembl.org/id/ENSBTAG00000015776" } ] } } ], "crossref": [ { "id": "ENSBTAG00000015776", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000015776", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd17387", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd17387", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "516584", "url": "https://www.ncbi.nlm.nih.gov/gene/516584", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001958", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001958", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR005829", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005829", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011701", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011701", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020846", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020846", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036259", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036259", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:516584", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:516584", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "LGHLFMT", "url": "https://omabrowser.org/oma/group/LGHLFMT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "A0A3Q1LZ27", "url": "https://www.orthodb.org/?gene=A0A3Q1LZ27", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23504", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23504", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23504:SF77", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23504:SF77", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07690", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07690", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0A3Q1LZ27", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LZ27", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1LZ27-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1LZ27-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SW67", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SW67", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SW67-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SW67-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6R1J3", "url": "https://www.uniprot.org/uniprotkb/F6R1J3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6R1J3-1", "url": "https://www.uniprot.org/uniprotkb/F6R1J3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGKAPASPAPAALPSGRRWRPCGLEPTRAAAAGRNRRRAPPPAAPLAFAASSAPSRPREAVAALWKRPAATLPSRMLLPGWHLALRPHWGPVMRSPPFSTPFGISASALGCVRCGKHCPKPQGIGSPSVYHAVIVIFLEFFAWGLLTAPTLVVLHETFPKHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASWGAPISWEQADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKFSPESVAAFIAVLGILSIIAQTIVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAMSSITFPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVELKELPMTGTDLGTNTSPQHHFEQNSIIPGPPFLFGACSVLLALLVALFIPEHTNLSLRSSSWRKHCGSHSHPHSTQAPGEAKEPLLQDTNV", "length": 582, "header": "tr|F6R1J3-1|F6R1J3_BOVIN Isoform 1 of Solute carrier family 71 member 1 OS=Bos taurus OX=9913 GN=MFSD14A PE=3 SV=1 CANONICAL=F6R1J3-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1LZ27-1", "url": "https://www.uniprot.org/uniprotkb/F6R1J3/entry#A0A3Q1LZ27-1", "sequence": { "sequence": "MTQGKKKKRAANRSIMLAKKIIIKDGGTVLHETFPKHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASWGAPISWEQADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKFSPESVAAFIAVLGILSIIAQTIVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAMSSITFPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVELKELPMTGTDLGTNTSPQHHFEQNSIIPGPPFLFGACSVLLALLVALFIPEHTNLSLRSSSWRKHCGSHSHPHSTQAPGEAKEPLLQDTNV", "length": 458, "header": "tr|A0A3Q1LZ27-1|F6R1J3_BOVIN Computationally mapped isoform of Solute carrier family 71 member 1 OS=Bos taurus OX=9913 GN=MFSD14A PE=3 SV=1 CANONICAL=F6R1J3-1" }, "locus": { "chromosome": "3", "start_pos": 43235847, "end_pos": 43183355, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000068268.2", "url": "https://www.ensembl.org/id/ENSBTAT00000068268.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000066064.1", "url": "https://www.ensembl.org/id/ENSBTAP00000066064.1" } ] } }, { "isoform_ac": "A0AAA9SW67-1", "url": "https://www.uniprot.org/uniprotkb/F6R1J3/entry#A0AAA9SW67-1", "sequence": { "sequence": "MTQGKKKKRAANRSIMLAKKIIIKDGGTPQGIGSPSVYHAVIVIFLEFFAWGLLTAPTLVVLHETFPKHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASWGAPISWEQADPFAIMKFSPESVAAFIAVLGILSIIAQTIVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAMSSITFPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVELKELPMTGTDLGTNTSPQHHFEQNSIIPGPPFLFGACSVLLALLVALFIPEHTNLSLRSSSWRKHCGSHSHPHSTQAPGEAKEPLLQDTNV", "length": 452, "header": "tr|A0AAA9SW67-1|F6R1J3_BOVIN Computationally mapped isoform of Solute carrier family 71 member 1 OS=Bos taurus OX=9913 GN=MFSD14A PE=3 SV=1 CANONICAL=F6R1J3-1" }, "locus": { "chromosome": "3", "start_pos": 43235847, "end_pos": 43183355, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000112075.1", "url": "https://www.ensembl.org/id/ENSBTAT00000112075.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000088455.1", "url": "https://www.ensembl.org/id/ENSBTAP00000088455.1" } ] } }, { "isoform_ac": "F6R1J3-1", "url": "https://www.uniprot.org/uniprotkb/F6R1J3/entry#F6R1J3-1", "sequence": { "sequence": "MGKAPASPAPAALPSGRRWRPCGLEPTRAAAAGRNRRRAPPPAAPLAFAASSAPSRPREAVAALWKRPAATLPSRMLLPGWHLALRPHWGPVMRSPPFSTPFGISASALGCVRCGKHCPKPQGIGSPSVYHAVIVIFLEFFAWGLLTAPTLVVLHETFPKHTFLMNGLIQGVKGLLSFLSAPLIGALSDVWGRKSFLLLTVFFTCAPIPLMKISPWWYFAVISVSGVFAVTFSVVFAYVADITQEHERSMAYGLVSATFAASLVTSPAIGAYLGRVYGDSLVVVLATAIALLDICFILVAVPESLPEKMRPASWGAPISWEQADPFASLKKVGQDSIVLLICITVFLSYLPEAGQYSSFFLYLRQIMKFSPESVAAFIAVLGILSIIAQTIVLSLLMRSIGNKNTILLGLGFQILQLAWYGFGSEPWMMWAAGAVAAMSSITFPAVSALVSRTADADQQGVVQGMITGIRGLCNGLGPALYGFIFYIFHVELKELPMTGTDLGTNTSPQHHFEQNSIIPGPPFLFGACSVLLALLVALFIPEHTNLSLRSSSWRKHCGSHSHPHSTQAPGEAKEPLLQDTNV", "length": 582, "header": "tr|F6R1J3-1|F6R1J3_BOVIN Isoform 1 of Solute carrier family 71 member 1 OS=Bos taurus OX=9913 GN=MFSD14A PE=3 SV=1 CANONICAL=F6R1J3-1" }, "locus": { "chromosome": "3", "start_pos": 43235591, "end_pos": 43183355, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000020947.6", "url": "https://www.ensembl.org/id/ENSBTAT00000020947.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000020947.5", "url": "https://www.ensembl.org/id/ENSBTAP00000020947.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:516584", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:516584", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "F6R1J3", "url": "https://www.uniprot.org/uniprotkb/F6R1J3" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "transmembrane transporter activity", "id": "GO:0022857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022857", "evidence": [ { "database": "UniProtKB", "id": "F6R1J3", "url": "https://www.uniprot.org/uniprotkb/F6R1J3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 505, "end_pos": 507, "annotation": "n_glycosylation_sequon" }, { "start_pos": 545, "end_pos": 547, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "F6R1J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6R1J3" }, { "id": "PS50850", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50850" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Major facilitator superfamily (MFS) profile", "eco_id": "ECO_0000259", "start_pos": 128, "end_pos": 545, "start_aa": "Ser", "end_aa": "Asn", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 505, "end_pos": 507 }, { "start_pos": 545, "end_pos": 547 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6RY34-1", "uniprot_ac": "F6RY34", "uniprot_id": "F6RY34_BOVIN", "mass": { "chemical_mass": 38741.0, "monoisotopic_mass": 38741.0 }, "refseq": {}, "gene_names": [ { "name": "NUDT9", "type": "recommended", "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34" } ] } ], "protein_names": [ { "name": "ADP-ribose pyrophosphatase", "type": "recommended", "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#names_and_taxonomy" } ] }, { "name": "3.6.1.13", "type": "synonym", "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#names_and_taxonomy" } ] }, { "name": "ADP-ribose diphosphatase", "type": "synonym", "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#names_and_taxonomy" } ] }, { "name": "ADP-ribose phosphohydrolase", "type": "synonym", "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#names_and_taxonomy" } ] }, { "name": "Adenosine diphosphoribose pyrophosphatase", "type": "synonym", "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#names_and_taxonomy" } ] }, { "name": "Nucleoside diphosphate-linked moiety X motif 9", "type": "synonym", "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Hydrolyzes ADP-ribose (ADPR) to AMP and ribose 5'-phosphate. Has also a weak phosphohydrolase activity against NADH and FAD (in vitro).", "evidence": [ { "database": "UniProtKB", "id": "A0AAA9RUR7", "url": "https://www.uniprot.org/uniprotkb/A0AAA9RUR7#function" }, { "database": "UniProtKB", "id": "ARBA00094338", "url": "https://www.uniprot.org/uniprotkb/ARBA00094338#function" }, { "database": "UniProtKB", "id": "F6RY34", "url": "https://www.uniprot.org/uniprotkb/F6RY34#function" }, { "database": "UniProtKB", "id": "A0AAA9RV65", "url": "https://www.uniprot.org/uniprotkb/A0AAA9RV65#function" }, { "database": "UniProtKB", "id": "A0AAA9SLT6", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SLT6#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6RY34", "url": "https://www.uniprot.org/uniprotkb/F6RY34" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "NUDT9", "url": "https://www.uniprot.org/uniprotkb/F6RY34", "locus": { "chromosome": "6", "start_pos": 102357766, "end_pos": 102292170, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000011354", "url": "https://www.ensembl.org/id/ENSBTAG00000011354" } ] } } ], "crossref": [ { "id": "ENSBTAG00000011354", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000011354", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd03670", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03670", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000086", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000086", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015797", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015797", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039989", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039989", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR059114", "url": "https://www.ebi.ac.uk/interpro/entry/IPR059114", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:517589", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:517589", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "VQVYQGY", "url": "https://omabrowser.org/oma/group/VQVYQGY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR13030", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13030", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13030:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13030:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00293", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00293", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF25969", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF25969", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "10412", "url": "https://www.rhea-db.org/rhea/10412", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0AAA9RUR7", "url": "https://www.uniprot.org/uniprotkb/A0AAA9RUR7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9RUR7-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9RUR7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9RV65", "url": "https://www.uniprot.org/uniprotkb/A0AAA9RV65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9RV65-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9RV65-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SLT6", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SLT6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0AAA9SLT6-1", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SLT6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RY34", "url": "https://www.uniprot.org/uniprotkb/F6RY34", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RY34-1", "url": "https://www.uniprot.org/uniprotkb/F6RY34-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGGFLGKTLAAVSLPVALASVTVKSLGSCSVAACRNSLSSCRFHVNSNIMSGFNGTKENSHNKARTSPYPGSKVQRSQVPNDKVDWLVEWHDYNPVEYTAVSVLAGPQWADPQITESNFSPKFNEKDGQVERKSQNGLYEVKNGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDRSGNKITHPISGKNILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKSSAEKRELQEKLQKLFNQEHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLTLEAGDDAGKVKWMDISDKLKLYASHAQFIKSVAEKRDAHWSKDSETGCPGQ", "length": 350, "header": "tr|F6RY34-1|F6RY34_BOVIN Isoform 1 of ADP-ribose pyrophosphatase OS=Bos taurus OX=9913 GN=NUDT9 PE=3 SV=1 CANONICAL=F6RY34-1" }, "isoforms": [ { "isoform_ac": "A0AAA9RUR7-1", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#A0AAA9RUR7-1", "sequence": { "sequence": "MAGGFLGKTLAAVSLPVALASVTVKSLGSCSVAACRNSLSSCRFHVNSNIMSGFNGTKENSHNKARTSPYPGSKVQRSQVPNDKVDWLVEWHDYNPVEYTAVSVLAGPQWADPQITNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDRSGNKITHPISGKNILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKSSAEKRELQEKLQKLFNQEHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLTLEAGDDAGKVKWMDISDKLKLYASHAQFIKSVAEKRDAHWSKDSETGCPG", "length": 317, "header": "tr|A0AAA9RUR7-1|F6RY34_BOVIN Computationally mapped isoform of ADP-ribose pyrophosphatase OS=Bos taurus OX=9913 GN=NUDT9 PE=3 SV=1 CANONICAL=F6RY34-1" }, "locus": { "chromosome": "6", "start_pos": 102355045, "end_pos": 102320670, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000126619.2", "url": "https://www.ensembl.org/id/ENSBTAT00000126619.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000076986.1", "url": "https://www.ensembl.org/id/ENSBTAP00000076986.1" } ] } }, { "isoform_ac": "A0AAA9RV65-1", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#A0AAA9RV65-1", "sequence": { "sequence": "MDLYYVRYPLINSLSSCRFHVNSNIMSGFNGTKENSHNKARTSPYPGSKVQRSQVPNDKVDWLVEWHDYNPVEYTAVSVLAGPQWADPQITESNFSPKFNEKDGQVERKSQNGLYEVKNGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDRSGNKITHPISGKNILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKSSAEKRELQEKLQKLFNQEHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLTLEAGDDAGKVKWMDISDKLKLYASHAQFIKSVAEKRDAHWSKDSETGCPG", "length": 324, "header": "tr|A0AAA9RV65-1|F6RY34_BOVIN Computationally mapped isoform of ADP-ribose pyrophosphatase OS=Bos taurus OX=9913 GN=NUDT9 PE=3 SV=1 CANONICAL=F6RY34-1" }, "locus": { "chromosome": "6", "start_pos": 102355045, "end_pos": 102327831, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000109656.2", "url": "https://www.ensembl.org/id/ENSBTAT00000109656.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000076145.1", "url": "https://www.ensembl.org/id/ENSBTAP00000076145.1" } ] } }, { "isoform_ac": "A0AAA9SLT6-1", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#A0AAA9SLT6-1", "sequence": { "sequence": "MLHFNILPSFWSGLLRNSLSSCRFHVNSNIMSGFNGTKENSHNKARTSPYPGSKVQRSQVPNDKVDWLVEWHDYNPVEYTAVSVLAGPQWADPQITESNFSPKFNEKDGQVERKSQNGLYEVKNGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDRSGNKITHPISGKNILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKSSAEKRELQEKLQKLFNQEHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLTLEAGDDAGKVKWMDISDKLKLYASHAQFIKSVAEKRDAHWSKDSETGCPG", "length": 329, "header": "tr|A0AAA9SLT6-1|F6RY34_BOVIN Computationally mapped isoform of ADP-ribose pyrophosphatase OS=Bos taurus OX=9913 GN=NUDT9 PE=3 SV=1 CANONICAL=F6RY34-1" }, "locus": { "chromosome": "6", "start_pos": 102355045, "end_pos": 102292260, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000095956.2", "url": "https://www.ensembl.org/id/ENSBTAT00000095956.2" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000083675.1", "url": "https://www.ensembl.org/id/ENSBTAP00000083675.1" } ] } }, { "isoform_ac": "F6RY34-1", "url": "https://www.uniprot.org/uniprotkb/F6RY34/entry#F6RY34-1", "sequence": { "sequence": "MAGGFLGKTLAAVSLPVALASVTVKSLGSCSVAACRNSLSSCRFHVNSNIMSGFNGTKENSHNKARTSPYPGSKVQRSQVPNDKVDWLVEWHDYNPVEYTAVSVLAGPQWADPQITESNFSPKFNEKDGQVERKSQNGLYEVKNGRPRNPAGRTGLVGRGLLGRWGPNHAADPIITRWKRDRSGNKITHPISGKNILQFVAIKRKDCGEWAIPGGMVDPGEKISATLKREFGEEALNSLQKSSAEKRELQEKLQKLFNQEHLVIYKGYVDDPRNTDNAWMETEAVNYHDETGEIMDNLTLEAGDDAGKVKWMDISDKLKLYASHAQFIKSVAEKRDAHWSKDSETGCPGQ", "length": 350, "header": "tr|F6RY34-1|F6RY34_BOVIN Isoform 1 of ADP-ribose pyrophosphatase OS=Bos taurus OX=9913 GN=NUDT9 PE=3 SV=1 CANONICAL=F6RY34-1" }, "locus": { "chromosome": "6", "start_pos": 102355045, "end_pos": 102320670, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000015090.7", "url": "https://www.ensembl.org/id/ENSBTAT00000015090.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000015090.5", "url": "https://www.ensembl.org/id/ENSBTAP00000015090.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [ { "id": "bta:517589", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:517589", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ADP-ribose diphosphatase activity", "id": "GO:0047631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047631", "evidence": [ { "database": "UniProtKB", "id": "F6RY34", "url": "https://www.uniprot.org/uniprotkb/F6RY34" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 119, "end_pos": 121, "annotation": "n_glycosylation_sequon" }, { "start_pos": 297, "end_pos": 299, "annotation": "n_glycosylation_sequon" }, { "start_pos": 55, "end_pos": 57, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "10412", "name": "", "equation": "ADP-D-ribose + H2O = D-ribose 5-phosphate + AMP + 2 H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "A7YY53-1", "A0AAA9TPZ1-1", "F6RY34-1", "Q05B60-1", "A0ABI0NL40-1" ], "evidence": [ { "id": "10412", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/10412" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0AAA9TPZ1", "gene_name": "NUDT5", "activity": [ { "ec_number": "3.6.1.58", "activity": "8-oxo-GDP + H2O = 8-oxo-GMP + phosphate + H(+).", "evidence": [ { "id": "A0AAA9TPZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TPZ1" } ] }, { "ec_number": "3.6.1.13", "activity": "ADP-D-ribose + H2O = D-ribose 5-phosphate + AMP + 2 H(+).", "evidence": [ { "id": "A0AAA9TPZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TPZ1" } ] }, { "ec_number": "2.7.7.96", "activity": "D-ribose 5-phosphate + ATP + H(+) = ADP-D-ribose + diphosphate.", "evidence": [ { "id": "A0AAA9TPZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TPZ1" } ] }, { "ec_number": "3.6.1.58", "activity": "", "evidence": [ { "id": "A0AAA9TPZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TPZ1" } ] }, { "ec_number": "3.6.1.13", "activity": "", "evidence": [ { "id": "A0AAA9TPZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TPZ1" } ] }, { "ec_number": "2.7.7.96", "activity": "", "evidence": [ { "id": "A0AAA9TPZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9TPZ1" } ] } ] }, { "uniprot_ac": "A0ABI0NL40", "gene_name": "ADPRM", "activity": [ { "ec_number": "3.6.1.13", "activity": "ADP-D-ribose + H2O = D-ribose 5-phosphate + AMP + 2 H(+).", "evidence": [ { "id": "A0ABI0NL40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NL40" } ] }, { "ec_number": "3.6.1.16", "activity": "CDP-glycerol + H2O = sn-glycerol 3-phosphate + CMP + 2 H(+).", "evidence": [ { "id": "A0ABI0NL40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NL40" } ] }, { "ec_number": "3.6.1.53", "activity": "ADP-D-ribose + H2O = D-ribose 5-phosphate + AMP + 2 H(+).", "evidence": [ { "id": "A0ABI0NL40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NL40" } ] }, { "ec_number": "3.6.1.13", "activity": "", "evidence": [ { "id": "A0ABI0NL40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NL40" } ] }, { "ec_number": "3.6.1.53", "activity": "", "evidence": [ { "id": "A0ABI0NL40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NL40" } ] }, { "ec_number": "3.6.1.16", "activity": "", "evidence": [ { "id": "A0ABI0NL40", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NL40" } ] } ] }, { "uniprot_ac": "A7YY53", "gene_name": "ADPRM", "activity": [ { "ec_number": "3.6.1.16", "activity": "CDP-glycerol + H2O = sn-glycerol 3-phosphate + CMP + 2 H(+).", "evidence": [ { "id": "A7YY53", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A7YY53" } ] }, { "ec_number": "3.6.1.53", "activity": "ADP-D-ribose + H2O = D-ribose 5-phosphate + AMP + 2 H(+).", "evidence": [ { "id": "A7YY53", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A7YY53" } ] }, { "ec_number": "3.6.1.16", "activity": "", "evidence": [ { "id": "A7YY53", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A7YY53" } ] }, { "ec_number": "3.6.1.53", "activity": "", "evidence": [ { "id": "A7YY53", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A7YY53" } ] } ] }, { "uniprot_ac": "F6RY34", "gene_name": "NUDT9", "activity": [ { "ec_number": "3.6.1.13", "activity": "ADP-D-ribose + H2O = D-ribose 5-phosphate + AMP + 2 H(+).", "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34" } ] }, { "ec_number": "3.6.1.13", "activity": "", "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34" } ] } ] }, { "uniprot_ac": "Q05B60", "gene_name": "NUDT14", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q05B60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05B60" } ] }, { "ec_number": "3.6.1.13", "activity": "ADP-D-ribose + H2O = D-ribose 5-phosphate + AMP + 2 H(+).", "evidence": [ { "id": "Q05B60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05B60" } ] }, { "ec_number": "3.6.1.13", "activity": "", "evidence": [ { "id": "Q05B60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05B60" } ] }, { "ec_number": "3.6.1.45", "activity": "UDP-sugar + H2O = UMP + alpha-D-aldose 1-phosphate.", "evidence": [ { "id": "Q05B60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05B60" } ] }, { "ec_number": "3.6.1.45", "activity": "", "evidence": [ { "id": "Q05B60", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q05B60" } ] } ] } ], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "F6RY34", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RY34" }, { "id": "PS51462", "database": "PROSITE", "url": "https://prosite.expasy.org/PS51462" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Nudix hydrolase", "eco_id": "ECO_0000259", "start_pos": 178, "end_pos": 334, "start_aa": "Trp", "end_aa": "Lys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "3.6.1.13", "ec_name": "ADP-D-ribose + H2O = D-ribose 5-phosphate + AMP + 2 H(+).", "evidence": [ { "id": "3.6.1.13", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:3.6.1.13" }, { "id": "3.6.1.13", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.6.1.13" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 119, "end_pos": 121 }, { "start_pos": 297, "end_pos": 299 }, { "start_pos": 55, "end_pos": 57 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7E0-1", "uniprot_ac": "A0ABI0P7E0", "uniprot_id": "A0ABI0P7E0_BOVIN", "mass": { "chemical_mass": 44226.0, "monoisotopic_mass": 44226.0 }, "refseq": {}, "gene_names": [ { "name": "STRA8", "type": "recommended", "evidence": [ { "id": "A0ABI0P7E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" } ] } ], "protein_names": [ { "name": "Stimulated by retinoic acid 8", "type": "synonym", "evidence": [ { "id": "A0ABI0P7E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "STRA8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0", "locus": { "chromosome": "4", "start_pos": 98886073, "end_pos": 98862169, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000001346", "url": "https://www.ensembl.org/id/ENSBTAG00000001346" } ] } } ], "crossref": [ { "id": "ENSBTAG00000001346", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000001346", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "785714", "url": "https://www.ncbi.nlm.nih.gov/gene/785714", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR033537", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033537", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036638", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036638", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR057021", "url": "https://www.ebi.ac.uk/interpro/entry/IPR057021", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:785714", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:785714", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "E1BAX3", "url": "https://www.orthodb.org/?gene=E1BAX3", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR35254", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35254", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR35254:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR35254:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF23175", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF23175", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0NMS7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NMS7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NMS7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NMS7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7E0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7E0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E1BAX3", "url": "https://www.uniprot.org/uniprotkb/E1BAX3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E1BAX3-1", "url": "https://www.uniprot.org/uniprotkb/E1BAX3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSSPPGSSVHGILQGQAKPSTLQLLMETARKGGNAGRRMMPRVLQELEQRVARRRLSQARHRATLSGLFGNLRKAVYSHSDLTASKWQVLNKAKNHIQELEQTLDNLLKLKGYFNLEDGNANSLEEAKKKYASMYSRNPSLVSNKVHWKGSDTWCSIEAAGKDVEEEEEEEEEEEDQEEEEEDEEVEEEQEKKVELSRSSVTLLPDLLEFERYLNFYKRTMDFLIRNEFISSNEVTLPIVSAAISHLWQTFSEERKTFILQALERTQKGLVGSCPEPACPEGSVKDSGVDSQGASCSLISTPEEILFEDAFNVASFLDKSEAPGTSSPSTSLAVCNSKKPEDKFHLYVQIVDFFKDFCCVDTQVKQEPDLPVDDEMIMLRCTETFDDEDL", "length": 391, "header": "tr|A0ABI0P7E0-1|A0ABI0P7E0_BOVIN Isoform 1 of Stimulated by retinoic acid 8 OS=Bos taurus OX=9913 GN=STRA8 PE=4 SV=1 CANONICAL=A0ABI0P7E0-1" }, "isoforms": [ { "isoform_ac": "A0ABI0NMS7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0/entry#A0ABI0NMS7-1", "sequence": { "sequence": "MSPAFHNKRVHKGQAKPSTLQLLMETARKGGNAGRRMMPRVLQELEQRVARRRLSQARHRATLSGLFGNLRKAVYSHSDLTASKWQVLNKAKNHIQELEQTLDNLLKLKGYFNLEDGNANSLEEAKKKYASMYSRNPSLVSNKVHWKGSDTWCSIEAAGKDVEEEEEEEEEEEDQEEEEEDEEVEEEQEKKVELSRSSVTLLPDLLEFERYLNFYKRTMDFLIRNEFISSNEVTLPIVSAAISHLWQTFSEERKTFILQALERTQKGLVGSCPEPACPEGSVKDSGVDSQGASCSLISTPEEILFEDAFNVASFLDKSEAPGTSSPSTSLAVCNSKKPEDKFHLYVQIVDFFKDFCCVDTQVKQEPDLPVDDEMIMLRCTETFDDEDL", "length": 388, "header": "tr|A0ABI0NMS7-1|A0ABI0P7E0_BOVIN Computationally mapped isoform of Stimulated by retinoic acid 8 OS=Bos taurus OX=9913 GN=STRA8 PE=4 SV=1 CANONICAL=A0ABI0P7E0-1" }, "locus": { "chromosome": "4", "start_pos": 98885069, "end_pos": 98846116, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000137596.1", "url": "https://www.ensembl.org/id/ENSBTAT00000137596.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106907.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106907.1" } ] } }, { "isoform_ac": "A0ABI0P7E0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0/entry#A0ABI0P7E0-1", "sequence": { "sequence": "MDSSPPGSSVHGILQGQAKPSTLQLLMETARKGGNAGRRMMPRVLQELEQRVARRRLSQARHRATLSGLFGNLRKAVYSHSDLTASKWQVLNKAKNHIQELEQTLDNLLKLKGYFNLEDGNANSLEEAKKKYASMYSRNPSLVSNKVHWKGSDTWCSIEAAGKDVEEEEEEEEEEEDQEEEEEDEEVEEEQEKKVELSRSSVTLLPDLLEFERYLNFYKRTMDFLIRNEFISSNEVTLPIVSAAISHLWQTFSEERKTFILQALERTQKGLVGSCPEPACPEGSVKDSGVDSQGASCSLISTPEEILFEDAFNVASFLDKSEAPGTSSPSTSLAVCNSKKPEDKFHLYVQIVDFFKDFCCVDTQVKQEPDLPVDDEMIMLRCTETFDDEDL", "length": 391, "header": "tr|A0ABI0P7E0-1|A0ABI0P7E0_BOVIN Isoform 1 of Stimulated by retinoic acid 8 OS=Bos taurus OX=9913 GN=STRA8 PE=4 SV=1 CANONICAL=A0ABI0P7E0-1" }, "locus": { "chromosome": "4", "start_pos": 98885069, "end_pos": 98865378, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144579.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144579.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107461.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107461.1" } ] } }, { "isoform_ac": "E1BAX3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0/entry#E1BAX3-1", "sequence": { "sequence": "METARKGGNAGRRMMPRVLQELEQRVARRRLSQARHRATLSGLFGNLRKAVYSHSDLTASKWQVLNKAKNHIQELEQTLDNLLKLKGYFNLEDGNANSLEEAKKKYASMYSRNPSLVSNKVHWKGSDTWCSIEAAGKDVEEEEEEEEEEEDQEEEEEDEEVEEEQEKKVELSRSSVTLLPDLLEFERYLNFYKRTMDFLIRNEFISSNEVTLPIVSAAISHLWQTFSEERKTFILQALERTQKGLVGSCPEPACPEGSVKDSGVDSQGASCSLISTPEEILFEDAFNVASFLDKSEAPGTSSPSTSLAVCNSKKPEDKFHLYVQIVDFFKDFCCVDTQVKQEPDLPVDDEMIMLRCTETFDDEDL", "length": 365, "header": "tr|E1BAX3-1|A0ABI0P7E0_BOVIN Computationally mapped isoform of Stimulated by retinoic acid 8 OS=Bos taurus OX=9913 GN=STRA8 PE=4 SV=4 CANONICAL=A0ABI0P7E0-1" }, "locus": { "chromosome": "4", "start_pos": 98885069, "end_pos": 98866127, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000001772.8", "url": "https://www.ensembl.org/id/ENSBTAT00000001772.8" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000001772.7", "url": "https://www.ensembl.org/id/ENSBTAP00000001772.7" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:785714", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:785714", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" } ], "pmid": "" }, { "name": "cellular response to retinoic acid", "id": "GO:0071300", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071300", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" } ], "pmid": "" }, { "name": "oogenesis", "id": "GO:0048477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048477", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" } ], "pmid": "" }, { "name": "meiotic cell cycle", "id": "GO:0051321", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051321", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" } ], "pmid": "" }, { "name": "activation of meiosis", "id": "GO:0090427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090427", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7E0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E0" }, { "id": "PF23175", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF23175" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "STRA8 bHLH", "eco_id": "ECO_0000259", "start_pos": 43, "end_pos": 116, "start_aa": "Arg", "end_aa": "Asn", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0A3Q1MF93-1", "uniprot_ac": "A0A3Q1MF93", "uniprot_id": "A0A3Q1MF93_BOVIN", "mass": { "chemical_mass": 34052.0, "monoisotopic_mass": 34052.0 }, "refseq": { "ac": "XP_024830806", "name": "ADP-ribosyltransferase 5 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024830806" }, "gene_names": [ { "name": "LOC112441637", "type": "recommended", "evidence": [ { "id": "A0A3Q1MF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93" } ] }, { "name": "LOC407148", "type": "recommended", "evidence": [ { "id": "A0A3Q1MF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93" } ] }, { "name": "LOC112441637", "type": "synonym", "evidence": [ { "id": "A0A3Q1MF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93" } ] }, { "name": "LOC407148", "type": "synonym", "evidence": [ { "id": "XP_024830806", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024830806" } ] } ], "protein_names": [ { "name": "NAD(P)(+)--arginine ADP-ribosyltransferase", "type": "recommended", "evidence": [ { "id": "A0A3Q1MF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93/entry#names_and_taxonomy" } ] }, { "name": "2.4.2.31", "type": "synonym", "evidence": [ { "id": "A0A3Q1MF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93/entry#names_and_taxonomy" } ] }, { "name": "ADP-ribosyltransferase 5 isoform X1", "type": "synonym", "evidence": [ { "id": "XP_024830806", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024830806" } ] }, { "name": "Mono(ADP-ribosyl)transferase", "type": "synonym", "evidence": [ { "id": "A0A3Q1MF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0A3Q1MF93", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC112441637", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93", "locus": {} } ], "crossref": [ { "id": "ENSBTAG00000037826", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000037826", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "407148", "url": "https://www.ncbi.nlm.nih.gov/gene/407148", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000768", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000768", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050999", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050999", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PEMLEKC", "url": "https://omabrowser.org/oma/group/PEMLEKC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "F1MCE4", "url": "https://www.orthodb.org/?gene=F1MCE4", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10339", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10339", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10339:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10339:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01129", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01129", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_024830806", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024830806", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19149", "url": "https://www.rhea-db.org/rhea/19149", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A3Q1MF93", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A3Q1MF93-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MCE4", "url": "https://www.uniprot.org/uniprotkb/F1MCE4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F1MCE4-1", "url": "https://www.uniprot.org/uniprotkb/F1MCE4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLAALLITLSCLSLHTLGSHGQGVTIQYLSLAPDTFDDDYVGCSEEMEEKAVLLLEKEMADHALLRESWETAQKAWEKKRPGLTLPPGFRSQHGIAIIVYTSSSNALYWELNQAVRTGGGSWESYMKHFPFKALHFYLTRALQLLRGGGGCSREPGQVVFRGVGTIRFEPKSVGDSIRLGQFTSSSLDETVAHGFGNATFFSIRTCFGVPIQNLSVFPKEREVLIPPHEVFVVTDFFQNKTHNLVTLSSTNHICSHFNCAYLGEKKRKSCESVPIGGQADSLSKGAFSLLSWKTLLLASWGFQLLGAGL", "length": 309, "header": "tr|A0A3Q1MF93-1|A0A3Q1MF93_BOVIN Isoform 1 of NAD(P)(+)--arginine ADP-ribosyltransferase OS=Bos taurus OX=9913 GN=LOC112441637 PE=3 SV=1 CANONICAL=A0A3Q1MF93-1" }, "isoforms": [ { "isoform_ac": "A0A3Q1MF93-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93/entry#A0A3Q1MF93-1", "sequence": { "sequence": "MLAALLITLSCLSLHTLGSHGQGVTIQYLSLAPDTFDDDYVGCSEEMEEKAVLLLEKEMADHALLRESWETAQKAWEKKRPGLTLPPGFRSQHGIAIIVYTSSSNALYWELNQAVRTGGGSWESYMKHFPFKALHFYLTRALQLLRGGGGCSREPGQVVFRGVGTIRFEPKSVGDSIRLGQFTSSSLDETVAHGFGNATFFSIRTCFGVPIQNLSVFPKEREVLIPPHEVFVVTDFFQNKTHNLVTLSSTNHICSHFNCAYLGEKKRKSCESVPIGGQADSLSKGAFSLLSWKTLLLASWGFQLLGAGL", "length": 309, "header": "tr|A0A3Q1MF93-1|A0A3Q1MF93_BOVIN Isoform 1 of NAD(P)(+)--arginine ADP-ribosyltransferase OS=Bos taurus OX=9913 GN=LOC112441637 PE=3 SV=1 CANONICAL=A0A3Q1MF93-1" }, "locus": { "chromosome": "15", "start_pos": 51495256, "end_pos": 51492696, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000072669.3", "url": "https://www.ensembl.org/id/ENSBTAT00000072669.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000072855.2", "url": "https://www.ensembl.org/id/ENSBTAP00000072855.2" } ] } }, { "isoform_ac": "F1MCE4-1", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93/entry#F1MCE4-1", "sequence": { "sequence": "RYLSIEKRFWGVTIQYLSLAPDTFDDDYVGCSEEMEEKAVLLLEKEMADHALLRESWETAQKAWEKKRPGLTLPPGFRSQHGIAIIVYTSSSNALYWELNQAVRTGGGSWESYMKHFPFKALHFYLTRALQLLRGGGGCSREPGQVVFRGVGTIRFEPKSVGDSIRLGQFTSSSLDETVAHGFGNATFFSIRTCFGVPIQNLSVFPKEREVLIPPHEVFVVTDFFQNKTHNLVTLSSTNHICSHFNCAYLGEKKRKSCESVPIGGQADSLSKGAFSLLSWKTLLLASWGFQLLGAGL", "length": 297, "header": "tr|F1MCE4-1|A0A3Q1MF93_BOVIN Computationally mapped isoform of NAD(P)(+)--arginine ADP-ribosyltransferase OS=Bos taurus OX=9913 GN=LOC112441637 PE=3 SV=4 CANONICAL=A0A3Q1MF93-1" }, "locus": { "chromosome": "15", "start_pos": 51477644, "end_pos": 51476001, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000012265.8", "url": "https://www.ensembl.org/id/ENSBTAT00000012265.8" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000012265.7", "url": "https://www.ensembl.org/id/ENSBTAP00000012265.7" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "nucleotidyltransferase activity", "id": "GO:0016779", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016779", "evidence": [ { "database": "UniProtKB", "id": "A0A3Q1MF93", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93" } ], "pmid": "" }, { "name": "NAD+-protein-arginine ADP-ribosyltransferase activity", "id": "GO:0106274", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106274", "evidence": [ { "database": "UniProtKB", "id": "A0A3Q1MF93", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 197, "end_pos": 199, "annotation": "n_glycosylation_sequon" }, { "start_pos": 213, "end_pos": 215, "annotation": "n_glycosylation_sequon" }, { "start_pos": 239, "end_pos": 241, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19149", "name": "", "equation": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "F6RR68-1", "E1BAP6-1", "E1BI74-1", "A0AAA9S718-1", "A0A3Q1MF93-1", "F1MHV9-1", "Q0VC22-1", "A0A3Q1MZC4-1", "A0AAA9SJA1-1" ], "evidence": [ { "id": "19149", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19149" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A3Q1MF93", "gene_name": "LOC112441637", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+).", "evidence": [ { "id": "A0A3Q1MF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "A0A3Q1MF93", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MF93" } ] } ] }, { "uniprot_ac": "A0A3Q1MZC4", "gene_name": "", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+).", "evidence": [ { "id": "A0A3Q1MZC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MZC4" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "A0A3Q1MZC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0A3Q1MZC4" } ] } ] }, { "uniprot_ac": "A0AAA9S718", "gene_name": "SMCO3", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+).", "evidence": [ { "id": "A0AAA9S718", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9S718" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "A0AAA9S718", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9S718" } ] } ] }, { "uniprot_ac": "A0AAA9SJA1", "gene_name": "SIRT6", "activity": [ { "ec_number": "2.3.1.286", "activity": "N(6)-acetyl-L-lysyl-[protein] + NAD(+) + H2O = 2''-O-acetyl-ADP-D-ribose + nicotinamide + L-lysyl-[protein].", "evidence": [ { "id": "A0AAA9SJA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SJA1" } ] }, { "ec_number": "2.3.1.286", "activity": "", "evidence": [ { "id": "A0AAA9SJA1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0AAA9SJA1" } ] } ] }, { "uniprot_ac": "E1BAP6", "gene_name": "", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+).", "evidence": [ { "id": "E1BAP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BAP6" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "E1BAP6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BAP6" } ] } ] }, { "uniprot_ac": "E1BI74", "gene_name": "", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+).", "evidence": [ { "id": "E1BI74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BI74" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "E1BI74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/E1BI74" } ] } ] }, { "uniprot_ac": "F1MHV9", "gene_name": "LOC618664", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+).", "evidence": [ { "id": "F1MHV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MHV9" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "F1MHV9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F1MHV9" } ] } ] }, { "uniprot_ac": "F6RR68", "gene_name": "ART1", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+).", "evidence": [ { "id": "F6RR68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RR68" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "F6RR68", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6RR68" } ] } ] }, { "uniprot_ac": "Q0VC22", "gene_name": "ART5", "activity": [ { "ec_number": "2.4.2.31", "activity": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+).", "evidence": [ { "id": "Q0VC22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q0VC22" } ] }, { "ec_number": "2.4.2.31", "activity": "", "evidence": [ { "id": "Q0VC22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q0VC22" } ] } ] } ], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [ { "ec_number": "2.4.2.31", "ec_name": "L-arginyl-[protein] + NAD(+) = N(omega)-(ADP-D-ribosyl)-L-arginyl-[protein] + nicotinamide + H(+).", "evidence": [ { "id": "2.4.2.31", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/?query=ec:2.4.2.31" }, { "id": "2.4.2.31", "database": "BRENDA Enzymes", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.2.31" } ] } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 197, "end_pos": 199 }, { "start_pos": 213, "end_pos": 215 }, { "start_pos": 239, "end_pos": 241 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5E7-1", "uniprot_ac": "A0ABI0P5E7", "uniprot_id": "A0ABI0P5E7_BOVIN", "mass": { "chemical_mass": 57887.0, "monoisotopic_mass": 57887.0 }, "refseq": {}, "gene_names": [ { "name": "CENPU", "type": "recommended", "evidence": [ { "id": "A0ABI0P5E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7" } ] } ], "protein_names": [ { "name": "Centromere protein U", "type": "recommended", "evidence": [ { "id": "A0ABI0P5E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7/entry#names_and_taxonomy" } ] }, { "name": "MLF1-interacting protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P5E7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5E7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "CENPU", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7", "locus": {} } ], "crossref": [ { "id": "617866", "url": "https://www.ncbi.nlm.nih.gov/gene/617866", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR025214", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025214", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:617866", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:617866", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR32222", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR32222", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR32222:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR32222:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13097", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13097", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0NIV6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NIV6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NIV6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NIV6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NLS0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLS0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NLS0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLS0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P2E3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P2E3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P2E3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P2E3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5E7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5E7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGRSPGPQTDGAGRWGRGRVGGGAFLHARPGLAAGSSARFGGSFCVGAERCGLEWIGHGLRGCRTHQAPLSMGFYRQEYWSRLPFPFPGDLRNQQWNLGLLGCRQILYQLIFISARFSKNHSGRTHSMKDKAGRKHRPLDVFDFPDHSQLSSLSRLGENEKDEESYETFDPPLHSTAIYADEEEFSKQCGSHLPSTPQEKEAKRSSDTSEIEASENESVKISAKKPRRKLKPISDESESPEESDVRRKVKPTENISTQHEAVSATALPGLSEKPAEAVTPQKTGPQSAESSAEKATLATEHQLETQKNKMLPGKRKKPRSYTTDTSDCAPVWCLKEKKASDIMELDVFLSAFENILLEYEQKIDSRVCKAAINKFHSNLKEELIKMVQEIQMLKTLKRKNAKIISNIEKKRQRLIEVQDELLQVEPELKQLQIKYEELQERKASLRKAAYFLSNLKQLHQDYSDVQEEEPSVKETYDSSSLPALLFKARPLLGAEHHLQNINYQLENLLDQK", "length": 512, "header": "tr|A0ABI0P5E7-1|A0ABI0P5E7_BOVIN Isoform 1 of Centromere protein U OS=Bos taurus OX=9913 GN=CENPU PE=3 SV=1 CANONICAL=A0ABI0P5E7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0NIV6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7/entry#A0ABI0NIV6-1", "sequence": { "sequence": "MHQGPVLKKDAPLAHFCRMPALAVDVTSGTRVMAGARFSKNHSGRTHSMKDKAGRKHRPLDVFDFPDHSQLSSLSRLGENEKDEESYETFDPPLHSTAIYADEEEFSKQCGSHLPSTPQEKEAKRSSDTSEIEASENESVKISAKKPRRKLKPISDESESPEESDVRRKVKPTENISTQHEAVSATALPGLSEKPAEAVTPQKTGPQSAESSAEKATLATEHQLETQKNKMLPGKRKKPRSYTTDTSDCAPVWCLKEKKASDIMELDVFLSAFENILLEYEQKIDSRVCKAAINKFHSNLKEELIKMVQEIQMLKTLKRKNAKIISNIEKKRQRLIEVQDELLQVEPELKQLQIKYEELQERKASLRKAAYFLSNLKQLHQDYSDVQEEEPSVKETYDSSSLPALLFKARPLLGAEHHLQNINYQLENLLDQK", "length": 433, "header": "tr|A0ABI0NIV6-1|A0ABI0P5E7_BOVIN Computationally mapped isoform of Centromere protein U OS=Bos taurus OX=9913 GN=CENPU PE=3 SV=1 CANONICAL=A0ABI0P5E7-1" }, "locus": { "chromosome": "27", "start_pos": 15162685, "end_pos": 15119969, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144914.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144914.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104194.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104194.1" } ] } }, { "isoform_ac": "A0ABI0NLS0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7/entry#A0ABI0NLS0-1", "sequence": { "sequence": "MDRPRPARLSHARFSKNHSGRTHSMKDKAGRKHRPLDVFDFPDHSQLSSLSRLGENEKDEESYETFDPPLHSTAIYADEEEFSKQCGSHLPSTPQEKEAKRSSDTSEIEASENESVKISAKKPRRKLKPISDESESPEESDVRRKVKPTENISTQHEAVSATALPGLSEKPAEAVTPQKTGPQSAESSAEKATLATEHQLETQKNKMLPGKRKKPRSYTTDTSDCAPVWCLKEKKASDIMELDVFLSAFENILLEYEQKIDSRVCKAAINKFHSNLKEELIKMVQEIQMLKTLKRKNAKIISNIEKKRQRLIEVQDELLQVEPELKQLQIKYEELQERKASLRKAAYFLSNLKQLHQDYSDVQEEEPSVKETYDSSSLPALLFKARPLLGAEHHLQNINYQLENLLDQK", "length": 409, "header": "tr|A0ABI0NLS0-1|A0ABI0P5E7_BOVIN Computationally mapped isoform of Centromere protein U OS=Bos taurus OX=9913 GN=CENPU PE=3 SV=1 CANONICAL=A0ABI0P5E7-1" }, "locus": { "chromosome": "27", "start_pos": 15165355, "end_pos": 15119969, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000151562.1", "url": "https://www.ensembl.org/id/ENSBTAT00000151562.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106214.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106214.1" } ] } }, { "isoform_ac": "A0ABI0P2E3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7/entry#A0ABI0P2E3-1", "sequence": { "sequence": "MGFYRQEYWSRLPFPFPGDLRNQQWNLGLLGCRQILYQLIFISARFSKNHSGRTHSMKDKAGRKHRPLDVFDFPDHSQLSSLSRLGENEKDEESYETFDPPLHSTAIYADEEEFSKQCGSHLPSTPQEKEAKRSSDTSEIEASENESVKISAKKPRRKLKPISDESESPEESDVRRKVKPTENISTQHEAVSATALPGLSEKPAEAVTPQKTGPQSAESSAEKATLATEHQLETQKNKMLPGKRKKPRSYTTDTSDCAPVWCLKEKKASDIMELDVFLSAFENILLEYEQKIDSRVCKAAINKFHSNLKEELIKMVQEIQMLKTLKRKNAKIISNIEKKRQRLIEVQDELLQVEPELKQLQIKYEELQERKASLRKAAYFLSNLKQLHQDYSDVQEEEPSVKETYDSSSLPALLFKARPLLGAEHHLQNINYQLENLLDQK", "length": 441, "header": "tr|A0ABI0P2E3-1|A0ABI0P5E7_BOVIN Computationally mapped isoform of Centromere protein U OS=Bos taurus OX=9913 GN=CENPU PE=3 SV=1 CANONICAL=A0ABI0P5E7-1" }, "locus": { "chromosome": "27", "start_pos": 15164322, "end_pos": 15119969, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000141674.1", "url": "https://www.ensembl.org/id/ENSBTAT00000141674.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000105261.1", "url": "https://www.ensembl.org/id/ENSBTAP00000105261.1" } ] } }, { "isoform_ac": "A0ABI0P5E7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7/entry#A0ABI0P5E7-1", "sequence": { "sequence": "MGRSPGPQTDGAGRWGRGRVGGGAFLHARPGLAAGSSARFGGSFCVGAERCGLEWIGHGLRGCRTHQAPLSMGFYRQEYWSRLPFPFPGDLRNQQWNLGLLGCRQILYQLIFISARFSKNHSGRTHSMKDKAGRKHRPLDVFDFPDHSQLSSLSRLGENEKDEESYETFDPPLHSTAIYADEEEFSKQCGSHLPSTPQEKEAKRSSDTSEIEASENESVKISAKKPRRKLKPISDESESPEESDVRRKVKPTENISTQHEAVSATALPGLSEKPAEAVTPQKTGPQSAESSAEKATLATEHQLETQKNKMLPGKRKKPRSYTTDTSDCAPVWCLKEKKASDIMELDVFLSAFENILLEYEQKIDSRVCKAAINKFHSNLKEELIKMVQEIQMLKTLKRKNAKIISNIEKKRQRLIEVQDELLQVEPELKQLQIKYEELQERKASLRKAAYFLSNLKQLHQDYSDVQEEEPSVKETYDSSSLPALLFKARPLLGAEHHLQNINYQLENLLDQK", "length": 512, "header": "tr|A0ABI0P5E7-1|A0ABI0P5E7_BOVIN Isoform 1 of Centromere protein U OS=Bos taurus OX=9913 GN=CENPU PE=3 SV=1 CANONICAL=A0ABI0P5E7-1" }, "locus": { "chromosome": "27", "start_pos": 15165516, "end_pos": 15119969, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000138830.1", "url": "https://www.ensembl.org/id/ENSBTAT00000138830.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106386.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106386.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:617866", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:617866", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5E7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7" } ], "pmid": "" }, { "name": "chromosome, centromeric region", "id": "GO:0000775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000775", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5E7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 120, "end_pos": 122, "annotation": "n_glycosylation_sequon" }, { "start_pos": 216, "end_pos": 218, "annotation": "n_glycosylation_sequon" }, { "start_pos": 254, "end_pos": 256, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 120, "end_pos": 122 }, { "start_pos": 216, "end_pos": 218 }, { "start_pos": 254, "end_pos": 256 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P609-1", "uniprot_ac": "A0ABI0P609", "uniprot_id": "A0ABI0P609_BOVIN", "mass": { "chemical_mass": 89794.0, "monoisotopic_mass": 89794.0 }, "refseq": {}, "gene_names": [ { "name": "CKAP2L", "type": "recommended", "evidence": [ { "id": "A0ABI0P609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609" } ] } ], "protein_names": [ { "name": "Cytoskeleton associated protein 2 like", "type": "synonym", "evidence": [ { "id": "A0ABI0P609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P609", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "CKAP2L", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609", "locus": {} } ], "crossref": [ { "id": "507498", "url": "https://www.ncbi.nlm.nih.gov/gene/507498", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR029197", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029197", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR052855", "url": "https://www.ebi.ac.uk/interpro/entry/IPR052855", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR47078", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47078", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR47078:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR47078:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15297", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15297", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0NK22", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NK22", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NK22-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NK22-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NMH8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NMH8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NMH8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NMH8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NX27", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NX27", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NX27-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NX27-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P609", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P609-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRADASAALRLSLQARPLKKNCRLRIMVRPGLSAAAEERQRKLQEYLAAKGKLKCQNTKDKVLTKTKQSLPSWDVHPRPEKQTSSPDQSSCLAVYDPPYLKAKNNCPNPPHSKSTIGPKKDVTNHVALPVKTTRSINIKLQSRPANITRSQRPKLEPPKLGKRLTSESVSSNPNGKPPGNSQQLRGFGSSTDGKQPRKTMGSLNVQKLKTTKQQVTDQRTAKGTDPVDNTHVENESLGGCLKEMNKENLPQDLPNSERKPNPESWTINKPQTNQTKSSLASTREVLDKSSVNSAALKEGVIKPFVEETQISVPPGKSQKLSRVADLIRPGGKPPKTLPSHFVQTLNRTQATKKTVVKDIKSIKVNRSKYERPNEAKLQSYTVTEQKVKHSKPSTHPSVLQGGCNHRHPNIKQDHKPTQACCRPQTSYALQKSKAISQRPNLTVGSFNSVIPSTPSIRANGATGNKCNNSCQQRARTLDSKFKSAPPQKCFLNKTAPRTQAGGPTISGRGVPNGAQTNPCKKIAAEDRRKQLEEWRKSKGKIYKRPPMELKTKRKIIEEMNISFWKSMEKEEEEKKAQLELSNKINNTLTECLQLIERGVLSNEVFAILSSIPEAEKFAKFWICKAKLLASKGTFDVIGLYEEAIRNGATPIQELREVVLNILQDRNRTTEGMTSNSLVAETNITSIEELAKKTESGASCLSPKESEQMSVTPQITKSEQDGHPGIKLQIAPIPRINGMPEVQDMKLITPVRRSARIERAVSRYPEMLQEHDLVVASLNELLEVEETECFIFRKNEALPVTLGFPVSES", "length": 808, "header": "tr|A0ABI0P609-1|A0ABI0P609_BOVIN Isoform 1 of Cytoskeleton associated protein 2 like OS=Bos taurus OX=9913 GN=CKAP2L PE=3 SV=1 CANONICAL=A0ABI0P609-1" }, "isoforms": [ { "isoform_ac": "A0ABI0NK22-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609/entry#A0ABI0NK22-1", "sequence": { "sequence": "MAPGWGLKGRANRNASISFGPALPYFRLAGFKPTGANESGRKRGAPAFSPGAAFEEKLSFENHGASWTLRRRGRAAEKAAGVPSSQGKTEVPKHQTIGPKKDVTNHVALPVKTTRSINIKLQSRPANITRSQRPKLEPPKLGKRLTSESVSSNPNGKPPGNSQQLRGFGSSTDGKQPRKTMGSLNVQKLKTTKQQVTDQRTAKGTDPVDNTHVENESLGGCLKEMNKENLPQDLPNSERKPNPESWTINKPQTNQTKSSLASTREVLDKSSVNSAALKEGVIKPFVEETQISVPPGKSQKLSRVADLIRPGGKPPKTLPSHFVQTLNRTQATKKTVVKDIKSIKVNRSKYERPNEAKLQSYTVTEQKVKHSKPSTHPSVLQGGCNHRHPNIKQDHKPTQACCRPQTSYALQKSKAISQRPNLTVGSFNSVIPSTPSIRANGATGNKCNNSCQQRARTLDSKFKSAPPQKCFLNKTAPRTQAGGPTISGRGVPNGAQTNPCKKIAAEDRRKQLEEWRKSKGKIYKRPPMELKTKRKIIEEMNISFWKSMEKEEEEKKAQLELSNKINNTLTECLQLIERGVLSNEVFAILSSIPEAEKFAKFWICKAKLLASKGTFDVIGLYEEAIRNGATPIQELREVVLNILQDRNRTTEGMTSNSLVAETNITSIEELAKKTESGASCLSPKESEQMSVTPQITKSEQDGHPGIKLQIAPIPRINGMPEVQDMKLITPVRRSARIERAVSRYPEMLQEHDLVVASLNELLEVEETECFIFRKNEALPVTLGFPVSES", "length": 789, "header": "tr|A0ABI0NK22-1|A0ABI0P609_BOVIN Computationally mapped isoform of Cytoskeleton associated protein 2 like OS=Bos taurus OX=9913 GN=CKAP2L PE=3 SV=1 CANONICAL=A0ABI0P609-1" }, "locus": { "chromosome": "11", "start_pos": 46474121, "end_pos": 46452681, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139038.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139038.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104933.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104933.1" } ] } }, { "isoform_ac": "A0ABI0NMH8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609/entry#A0ABI0NMH8-1", "sequence": { "sequence": "GIKPGSPALAEERQRKLQEYLALCKSCCPDVTNHVALPVKTTRSINIKLQSRPANITRSQRPKLEPPKLGKRLTSESVSSNPNGKPPGNSQQLRGFGSSTDGKQPRKTMGSLNVQKLKTTKQQVTDQRTAKGTDPVDNTHVENESLGGCLKEMNKENLPQDLPNSERKPNPESWTINKPQTNQTKSSLASTREVLDKSSVNSAALKEGVIKPFVEETQISVPPGKSQKLSRVADLIRPGGKPPKTLPSHFVQTLNRTQATKKTVVKDIKSIKVNRSKYERPNEAKLQSYTVTEQKVKHSKPSTHPSVLQGGCNHRHPNIKQDHKPTQACCRPQTSYALQKSKAISQRPNLTVGSFNSVIPSTPSIRANGATGNKCNNSCQQRARTLDSKFKSAPPQKCFLNKTAPRTQAGGPTISGRGVPNGAQTNPCKKIAAEDRRKQLEEWRKSKGKIYKRPPMELKTKRKIIEEMNISFWKSMEKEEEEKKAQLELSNKINNTLTECLQLIERGVLSNEVFAILSSIPEAEKFAKFWICKAKLLASKGTFDVIGLYEEAIRNGATPIQELREVVLNILQDRNRTTEGMTSNSLVAETNITSIEELAKKTESGASCLSPKESEQMSVTPQITKSEQDGHPGIKLQIAPIPRINGMPEVQDMKLITPVRRSARIERAVSRYPEMLQEHDLVVASLNELLEVEETECFIFRKNEALPVTLGFPVSES", "length": 717, "header": "tr|A0ABI0NMH8-1|A0ABI0P609_BOVIN Computationally mapped isoform of Cytoskeleton associated protein 2 like OS=Bos taurus OX=9913 GN=CKAP2L PE=3 SV=1 CANONICAL=A0ABI0P609-1" }, "locus": { "chromosome": "11", "start_pos": 46472119, "end_pos": 46452681, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152264.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152264.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106698.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106698.1" } ] } }, { "isoform_ac": "A0ABI0NX27-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609/entry#A0ABI0NX27-1", "sequence": { "sequence": "MRADASAALRLSLQARPLKKNCRLRIMVRPGLSAAAEERQRKLQEYLAAKGKLKCQNTKPYLKAKNNCPNPPHSKSTIGPKKDVTNHVALPVKTTRSINIKLQSRPANITRSQRPKLEPPKLGKRLTSESVSSNPNGKPPGNSQQLRGFGSSTDGKQPRKTMGSLNVQKLKTTKQQVTDQRTAKGTDPVDNTHVENESLGGCLKEMNKENLPQDLPNSERKPNPESWTINKPQTNQTKSSLASTREVLDKSSVNSAALKEGVIKPFVEETQISVPPGKSQKLSRVADLIRPGGKPPKTLPSHFVQTLNRTQATKKTVVKDIKSIKVNRSKYERPNEAKLQSYTVTEQKVKHSKPSTHPSVLQGGCNHRHPNIKQDHKPTQACCRPQTSYALQKSKAISQRPNLTVGSFNSVIPSTPSIRANGATGNKCNNSCQQRARTLDSKFKSAPPQKCFLNKTAPRTQAGGPTISGRGVPNGAQTNPCKKIAAEDRRKQLEEWRKSKGKIYKRPPMELKTKRKIIEEMNISFWKSMEKEEEEKKAQLELSNKINNTLTECLQLIERGVLSNEVFAILSSIPEAEKFAKFWICKAKLLASKGTFDVIGLYEEAIRNGATPIQELREVVLNILQDRNRTTEGMTSNSLVAETNITSIEELAKKTESGASCLSPKESEQMSVTPQITKSEQDGHPGIKLQIAPIPRINGMPEVQDMKLITPVRRSARIERAVSRYPEMLQEHDLVVASLNELLEVEETECFIFRKNEALPVTLGFPVSES", "length": 770, "header": "tr|A0ABI0NX27-1|A0ABI0P609_BOVIN Computationally mapped isoform of Cytoskeleton associated protein 2 like OS=Bos taurus OX=9913 GN=CKAP2L PE=3 SV=1 CANONICAL=A0ABI0P609-1" }, "locus": { "chromosome": "11", "start_pos": 46474012, "end_pos": 46452681, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000151616.1", "url": "https://www.ensembl.org/id/ENSBTAT00000151616.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104495.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104495.1" } ] } }, { "isoform_ac": "A0ABI0P609-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609/entry#A0ABI0P609-1", "sequence": { "sequence": "MRADASAALRLSLQARPLKKNCRLRIMVRPGLSAAAEERQRKLQEYLAAKGKLKCQNTKDKVLTKTKQSLPSWDVHPRPEKQTSSPDQSSCLAVYDPPYLKAKNNCPNPPHSKSTIGPKKDVTNHVALPVKTTRSINIKLQSRPANITRSQRPKLEPPKLGKRLTSESVSSNPNGKPPGNSQQLRGFGSSTDGKQPRKTMGSLNVQKLKTTKQQVTDQRTAKGTDPVDNTHVENESLGGCLKEMNKENLPQDLPNSERKPNPESWTINKPQTNQTKSSLASTREVLDKSSVNSAALKEGVIKPFVEETQISVPPGKSQKLSRVADLIRPGGKPPKTLPSHFVQTLNRTQATKKTVVKDIKSIKVNRSKYERPNEAKLQSYTVTEQKVKHSKPSTHPSVLQGGCNHRHPNIKQDHKPTQACCRPQTSYALQKSKAISQRPNLTVGSFNSVIPSTPSIRANGATGNKCNNSCQQRARTLDSKFKSAPPQKCFLNKTAPRTQAGGPTISGRGVPNGAQTNPCKKIAAEDRRKQLEEWRKSKGKIYKRPPMELKTKRKIIEEMNISFWKSMEKEEEEKKAQLELSNKINNTLTECLQLIERGVLSNEVFAILSSIPEAEKFAKFWICKAKLLASKGTFDVIGLYEEAIRNGATPIQELREVVLNILQDRNRTTEGMTSNSLVAETNITSIEELAKKTESGASCLSPKESEQMSVTPQITKSEQDGHPGIKLQIAPIPRINGMPEVQDMKLITPVRRSARIERAVSRYPEMLQEHDLVVASLNELLEVEETECFIFRKNEALPVTLGFPVSES", "length": 808, "header": "tr|A0ABI0P609-1|A0ABI0P609_BOVIN Isoform 1 of Cytoskeleton associated protein 2 like OS=Bos taurus OX=9913 GN=CKAP2L PE=3 SV=1 CANONICAL=A0ABI0P609-1" }, "locus": { "chromosome": "11", "start_pos": 46474012, "end_pos": 46452681, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000140055.1", "url": "https://www.ensembl.org/id/ENSBTAT00000140055.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107292.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107292.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 453, "start_aa": "Thr", "end_pos": 453, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr453", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 504, "start_aa": "Thr", "end_pos": 504, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr504", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P609", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 146, "end_pos": 148, "annotation": "n_glycosylation_sequon" }, { "start_pos": 234, "end_pos": 236, "annotation": "n_glycosylation_sequon" }, { "start_pos": 273, "end_pos": 275, "annotation": "n_glycosylation_sequon" }, { "start_pos": 346, "end_pos": 348, "annotation": "n_glycosylation_sequon" }, { "start_pos": 365, "end_pos": 367, "annotation": "n_glycosylation_sequon" }, { "start_pos": 440, "end_pos": 442, "annotation": "n_glycosylation_sequon" }, { "start_pos": 467, "end_pos": 469, "annotation": "n_glycosylation_sequon" }, { "start_pos": 492, "end_pos": 494, "annotation": "n_glycosylation_sequon" }, { "start_pos": 560, "end_pos": 562, "annotation": "n_glycosylation_sequon" }, { "start_pos": 585, "end_pos": 587, "annotation": "n_glycosylation_sequon" }, { "start_pos": 666, "end_pos": 668, "annotation": "n_glycosylation_sequon" }, { "start_pos": 682, "end_pos": 684, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P609" }, { "id": "PF15297", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15297" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Cytoskeleton-associated protein 2 C-terminal", "eco_id": "ECO_0000259", "start_pos": 520, "end_pos": 706, "start_aa": "Lys", "end_aa": "Glu", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 453, 504 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 146, "end_pos": 148 }, { "start_pos": 234, "end_pos": 236 }, { "start_pos": 273, "end_pos": 275 }, { "start_pos": 346, "end_pos": 348 }, { "start_pos": 365, "end_pos": 367 }, { "start_pos": 440, "end_pos": 442 }, { "start_pos": 467, "end_pos": 469 }, { "start_pos": 492, "end_pos": 494 }, { "start_pos": 560, "end_pos": 562 }, { "start_pos": 585, "end_pos": 587 }, { "start_pos": 666, "end_pos": 668 }, { "start_pos": 682, "end_pos": 684 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7C7-1", "uniprot_ac": "A0ABI0P7C7", "uniprot_id": "A0ABI0P7C7_BOVIN", "mass": { "chemical_mass": 99529.0, "monoisotopic_mass": 99529.0 }, "refseq": {}, "gene_names": [ { "name": "ADAM8", "type": "recommended", "evidence": [ { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" } ] } ], "protein_names": [ { "name": "ADAM metallopeptidase domain 8", "type": "recommended", "evidence": [ { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7C7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "ADAM8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7", "locus": {} } ], "crossref": [ { "id": "cd04269", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd04269", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001590", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001590", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001762", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001762", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002870", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002870", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006586", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006586", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018358", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018358", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034027", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034027", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036436", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036436", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11905", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11905", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11905:SF20", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11905:SF20", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00200", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00200", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF01421", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01421", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF01562", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01562", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08516", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08516", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF23106", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF23106", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0NLG8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLG8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NLG8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLG8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NRZ1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NRZ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NRZ1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NRZ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7C7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7C7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLRGGRGASWLAVAPLLLSCLLCSGQLCGRPCSPSSWCFCPNRVRLPLNFCYQCRRSRGGTCSHRPSRTPDPWAPEGQRAPHARQTPAMRGLGLLLFAALGLQEVAPRAALPHVEQYEVVRPRRLPAPRARRALPSHLGLYPESVSYVLGARGHTFTLHLRKNRDLVGSGYVETYTAANGSQVTEQLQRQDHCFYQGHVEGHPHSAASLSTCAGLRGFFQAGPAVRLIEPLAEAGEEGPHALYLAQHLQQEAGTCGVNDSSLESILGPRVSAAFRPRWSEPRETRYVELFVVTDSKEFQRFGSREAVRQRVLEVVNHVDKLYQELNFRVVLVGLEMWNGGDKIQISSQPDATLDNFLAWRTRELVGRQAHDNVQLITGVDFTGTTVGLAKVSTMCSSSSGAVNQDHSQNPIGVASTMAHEMGHNLGMDHDENVAGCYCPVPREGGGCVMAASIGSQYPRKFSQCSQADLETFVEKPRTACLLDAPDLDRLVGGPVCGNGFLERGEQCDCGRPEDCQNRCCNASTCLLAEGAECAHGTCCHECRVKPAGELCRPVKDQCDLGEHCDGQQPTCPEDAFRENGTPCPGGYCYNGACPTLARRCQDLWGPGSRVAVETCFLYSISKGCGAGVPLPFGRVNKCGTLFCEGGQKTPERGYCTLTISSGVCRVIVQDGSTEYEPVPKGTKCGEQQVCWDGFCQGLHVYRSRNCSAQCNSHGECNHKGQCHCRPGWAPPHCAEPLADARAAPGSLRTHVLVGVGALVVLALILAGVLIYRKARSPVRRRNVAPKTAMGLSNPLFHEGLSKPAKGGAQAPPGGSPELALYSQPHKPTASSVTPKRPPPAPPGSLQPPAAKASPPSPLPVYPPQAPGQLRPAPPAKPLPVLKPKQVIKPTCAPPMPPIKPGARGAQPGPTQGAADPKVALKPPVQRR", "length": 927, "header": "tr|A0ABI0P7C7-1|A0ABI0P7C7_BOVIN Isoform 1 of ADAM metallopeptidase domain 8 OS=Bos taurus OX=9913 GN=ADAM8 PE=4 SV=1 CANONICAL=A0ABI0P7C7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0NLG8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7/entry#A0ABI0NLG8-1", "sequence": { "sequence": "MLRGGRGASWLAVAPLLLSCLLCSGQLCGRPCSPSSWCFCPNRVRLPLNFCYQCRRSRGGTCSHRPSRTPDPWAPEGQRAPHARQTPAMRGLGLLLFAALGLQEVAPRAALPHVEQYEVVRPRRLPAPRARRALPSHLGLYPESVSYVLGARGHTFTLHLRKNRDLVGSGYVETYTAANGSQVTEQLQRQDHCFYQGHVEGHPHSAASLSTCAGLRGFFQAGPAVRLIEPLAEAGEEGPHALYLAQHLQQEAGTCGVNDSSLESILGPRVSAAFRPRWSEPRETRYVELFVVTDSKEFQRFGSREAVRQRVLEVVNHVDKLYQELNFRVVLVGLEMWNGGDKIQISSQPDATLDNFLAWRTRELVGRQAHDNVQLITGVDFTGTTVGLAKVSTMCSSSSGAVNQDHSQNPIGVASTMAHEMGHNLGMDHDENVAGCYCPVPREGGGCVMAASIGSQYPRKFSQCSQADLETFVEKPRTACLLDAPDLDRLVGGPVCGNGFLERGEQCDCGRPEDCQNRCCNASTCLLAEGAECAHGTCCHECRVKPAGELCRPVKDQCDLGEHCDGQQPTCPEDAFRENGTPCPGGYCYNGACPTLARRCQDLWGPGSRVAVETCFLYSISKGCGAGVPLPFGRVNKCGTLFCEGGQKTPERGYCTLTISSGVCRVIVQDGSTEYEPVPKGTKCGEQQVCWDGFCQGLHVYRSRNCSAQCNSHGECNHKGQCHCRPGWAPPHCAEPLADARAAPGSLRTHVLVGVGALVVLALILAGVLIYRKARSPVRRRNVAPKTAMGLSNPLFHEGLSKPAKGGAQAPPGGSPELALYSQPHKPTASSVTPKRPPPAPPGSLQPPAAKASPPSPLPVYPPQAPGQVIKPTCAPPMPPIKPGARGAQPGPTQGAADPKVALKPPVQRR", "length": 910, "header": "tr|A0ABI0NLG8-1|A0ABI0P7C7_BOVIN Computationally mapped isoform of ADAM metallopeptidase domain 8 OS=Bos taurus OX=9913 GN=ADAM8 PE=4 SV=1 CANONICAL=A0ABI0P7C7-1" }, "locus": { "chromosome": "26", "start_pos": 25744981, "end_pos": 25732361, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000140124.1", "url": "https://www.ensembl.org/id/ENSBTAT00000140124.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000105924.1", "url": "https://www.ensembl.org/id/ENSBTAP00000105924.1" } ] } }, { "isoform_ac": "A0ABI0NRZ1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7/entry#A0ABI0NRZ1-1", "sequence": { "sequence": "MRGLGLLLFAALGLQEVAPRAALPHVEQYEVVRPRRLPAPRARRALPSHLGLYPESVSYVLGARGHTFTLHLRKNRDLVGSGYVETYTAANGSQVTEQLQRQDHCFYQGHVEGHPHSAASLSTCAGLRGFFQAGPAVRLIEPLAEAGEEGPHALYLAQHLQQEAGTCGVNDSSLESILGPRVSAAFRPRWSEPRETRYVELFVVTDSKEFQRFGSREAVRQRVLEVVNHVDKLYQELNFRVVLVGLEMWNGGDKIQISSQPDATLDNFLAWRTRELVGRQAHDNVQLITGVDFTGTTVGLAKVSTMCSSSSGAVNQDHSQNPIGVASTMAHEMGHNLGMDHDENVAGCYCPVPREGGGCVMAASIGSQYPRKFSQCSQADLETFVEKPRTACLLDAPDLDRLVGGPVCGNGFLERGEQCDCGRPEVKPAGELCRPVKDQCDLGEHCDGQQPTCPEDAFRENGTPCPGGYCYNGACPTLARRCQDLWGPGSRVAVETCFLYSISKGCGAGVPLPFGRVNKCGTLFCEGGQKTPERGYCTLTISSGVCRVIVQDGSTEYEPVPKGTKCGEQQVCWDGFCQGLHVYRSRNCSAQCNSHGECNHKGQCHCRPGWAPPHCAEPLADARAAPGSLRTHVLVGVGALVVLALILAGVLIYRKARSPVRRRNVAPKTAMGLSNPLFHEGLSKPAKGGAQAPPGGSPELALYSQPHKPTASSVTPKRPPPAPPGSLQPPAAKASPPSPLPVYPPQAPGQLRPAPPAKPLPVLKPKQVIKPTCAPPMPPIKPGARGAQPGPTQGAADPKVALKPPVQRR", "length": 809, "header": "tr|A0ABI0NRZ1-1|A0ABI0P7C7_BOVIN Computationally mapped isoform of ADAM metallopeptidase domain 8 OS=Bos taurus OX=9913 GN=ADAM8 PE=4 SV=1 CANONICAL=A0ABI0P7C7-1" }, "locus": { "chromosome": "26", "start_pos": 25744981, "end_pos": 25733665, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139621.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139621.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000105563.1", "url": "https://www.ensembl.org/id/ENSBTAP00000105563.1" } ] } }, { "isoform_ac": "A0ABI0P7C7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7/entry#A0ABI0P7C7-1", "sequence": { "sequence": "MLRGGRGASWLAVAPLLLSCLLCSGQLCGRPCSPSSWCFCPNRVRLPLNFCYQCRRSRGGTCSHRPSRTPDPWAPEGQRAPHARQTPAMRGLGLLLFAALGLQEVAPRAALPHVEQYEVVRPRRLPAPRARRALPSHLGLYPESVSYVLGARGHTFTLHLRKNRDLVGSGYVETYTAANGSQVTEQLQRQDHCFYQGHVEGHPHSAASLSTCAGLRGFFQAGPAVRLIEPLAEAGEEGPHALYLAQHLQQEAGTCGVNDSSLESILGPRVSAAFRPRWSEPRETRYVELFVVTDSKEFQRFGSREAVRQRVLEVVNHVDKLYQELNFRVVLVGLEMWNGGDKIQISSQPDATLDNFLAWRTRELVGRQAHDNVQLITGVDFTGTTVGLAKVSTMCSSSSGAVNQDHSQNPIGVASTMAHEMGHNLGMDHDENVAGCYCPVPREGGGCVMAASIGSQYPRKFSQCSQADLETFVEKPRTACLLDAPDLDRLVGGPVCGNGFLERGEQCDCGRPEDCQNRCCNASTCLLAEGAECAHGTCCHECRVKPAGELCRPVKDQCDLGEHCDGQQPTCPEDAFRENGTPCPGGYCYNGACPTLARRCQDLWGPGSRVAVETCFLYSISKGCGAGVPLPFGRVNKCGTLFCEGGQKTPERGYCTLTISSGVCRVIVQDGSTEYEPVPKGTKCGEQQVCWDGFCQGLHVYRSRNCSAQCNSHGECNHKGQCHCRPGWAPPHCAEPLADARAAPGSLRTHVLVGVGALVVLALILAGVLIYRKARSPVRRRNVAPKTAMGLSNPLFHEGLSKPAKGGAQAPPGGSPELALYSQPHKPTASSVTPKRPPPAPPGSLQPPAAKASPPSPLPVYPPQAPGQLRPAPPAKPLPVLKPKQVIKPTCAPPMPPIKPGARGAQPGPTQGAADPKVALKPPVQRR", "length": 927, "header": "tr|A0ABI0P7C7-1|A0ABI0P7C7_BOVIN Isoform 1 of ADAM metallopeptidase domain 8 OS=Bos taurus OX=9913 GN=ADAM8 PE=4 SV=1 CANONICAL=A0ABI0P7C7-1" }, "locus": { "chromosome": "26", "start_pos": 25744981, "end_pos": 25732361, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000150323.1", "url": "https://www.ensembl.org/id/ENSBTAT00000150323.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107433.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107433.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 910, "start_aa": "Thr", "end_pos": 910, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr910", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "metalloendopeptidase activity", "id": "GO:0004222", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004222", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7C7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7C7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7C7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7C7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 179, "end_pos": 181, "annotation": "n_glycosylation_sequon" }, { "start_pos": 258, "end_pos": 260, "annotation": "n_glycosylation_sequon" }, { "start_pos": 521, "end_pos": 523, "annotation": "n_glycosylation_sequon" }, { "start_pos": 579, "end_pos": 581, "annotation": "n_glycosylation_sequon" }, { "start_pos": 705, "end_pos": 707, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" }, { "id": "PS50214", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50214" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Disintegrin", "eco_id": "ECO_0000259", "start_pos": 493, "end_pos": 579, "start_aa": "Gly", "end_aa": "Asn", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" }, { "id": "PS50026", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50026" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "EGF-like", "eco_id": "ECO_0000259", "start_pos": 702, "end_pos": 734, "start_aa": "Arg", "end_aa": "Ala", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" }, { "id": "PS50215", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50215" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Peptidase M12B", "eco_id": "ECO_0000259", "start_pos": 285, "end_pos": 485, "start_aa": "Arg", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [ { "evidence": [ { "id": "A0ABI0NRZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NRZ1#function" }, { "id": "A0ABI0NRZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NRZ1" }, { "id": "PRU00276", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00276" } ], "binding_site_uniprot": 331, "amino_acid": "Leu", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "catalytic", "eco_id": "ECO_0000256", "start_pos": 331, "end_pos": 331, "start_aa": "Leu", "end_aa": "Leu", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0NRZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NRZ1#function" }, { "id": "A0ABI0NRZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NRZ1" }, { "id": "PRU00276", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00276" } ], "binding_site_uniprot": 335, "amino_acid": "Glu", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "catalytic", "eco_id": "ECO_0000256", "start_pos": 335, "end_pos": 335, "start_aa": "Glu", "end_aa": "Glu", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0NRZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NRZ1#function" }, { "id": "A0ABI0NRZ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NRZ1" }, { "id": "PRU00276", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00276" } ], "binding_site_uniprot": 341, "amino_acid": "Asp", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "catalytic", "eco_id": "ECO_0000256", "start_pos": 341, "end_pos": 341, "start_aa": "Asp", "end_aa": "Asp", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0NLG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLG8#function" }, { "id": "A0ABI0NLG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLG8" }, { "id": "PRU00276", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00276" }, { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7#function" }, { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" } ], "binding_site_uniprot": 419, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "catalytic", "eco_id": "ECO_0000256", "start_pos": 419, "end_pos": 419, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0NLG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLG8#function" }, { "id": "A0ABI0NLG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLG8" }, { "id": "PRU00276", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00276" }, { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7#function" }, { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" } ], "binding_site_uniprot": 423, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "catalytic", "eco_id": "ECO_0000256", "start_pos": 423, "end_pos": 423, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0NLG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLG8#function" }, { "id": "A0ABI0NLG8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NLG8" }, { "id": "PRU00276", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00276" }, { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7#function" }, { "id": "A0ABI0P7C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C7" } ], "binding_site_uniprot": 429, "amino_acid": "His", "chebi_lig_id": "CHEBI_29105", "ligand": "Zn(2+)", "ligand_label": "", "uniprotkb_ligand_comment": "catalytic", "eco_id": "ECO_0000256", "start_pos": 429, "end_pos": 429, "start_aa": "His", "end_aa": "His", "glycosite_overlap": "" } ], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 910 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 179, "end_pos": 181 }, { "start_pos": 258, "end_pos": 260 }, { "start_pos": 521, "end_pos": 523 }, { "start_pos": 579, "end_pos": 581 }, { "start_pos": 705, "end_pos": 707 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5F6-1", "uniprot_ac": "A0ABI0P5F6", "uniprot_id": "A0ABI0P5F6_BOVIN", "mass": { "chemical_mass": 30930.0, "monoisotopic_mass": 30930.0 }, "refseq": {}, "gene_names": [ { "name": "IL1A", "type": "recommended", "evidence": [ { "id": "A0ABI0P5F6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ] } ], "protein_names": [ { "name": "Interleukin-1", "type": "recommended", "evidence": [ { "id": "A0ABI0P5F6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Cytokine constitutively present intracellularly in nearly all resting non-hematopoietic cells that plays an important role in inflammation and bridges the innate and adaptive immune systems. After binding to its receptor IL1R1 together with its accessory protein IL1RAP, forms the high affinity interleukin-1 receptor complex. Signaling involves the recruitment of adapter molecules such as MYD88, IRAK1 or IRAK4. In turn, mediates the activation of NF-kappa-B and the three MAPK pathways p38, p42/p44 and JNK pathways. Within the cell, acts as an alarmin and cell death results in its liberation in the extracellular space after disruption of the cell membrane to induce inflammation and alert the host to injury or damage. In addition to its role as a danger signal, which occurs when the cytokine is passively released by cell necrosis, directly senses DNA damage and acts as signal for genotoxic stress without loss of cell integrity.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0NMI5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NMI5#function" }, { "database": "UniProtKB", "id": "ARBA00034090", "url": "https://www.uniprot.org/uniprotkb/ARBA00034090#function" }, { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "IL1A", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6", "locus": {} } ], "crossref": [ { "id": "cd23295", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd23295", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000975", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000975", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003295", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003295", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003502", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003502", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008996", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008996", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020877", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020877", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR10078", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10078", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10078:SF33", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10078:SF33", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00340", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00340", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF02394", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02394", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0NMI5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NMI5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NMI5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NMI5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5F6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKVPDLFEDLKNCYSENEDYSSEIDHLSLNQKSFYDASYEPLREDQMNKFMSLDTSETSKTSKLSFKENVVMVAASGKILKKRRLSLNQFITDDDLEAIANNTEEEIIKPRSAHYSFQSNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEKP", "length": 269, "header": "tr|A0ABI0P5F6-1|A0ABI0P5F6_BOVIN Isoform 1 of Interleukin-1 OS=Bos taurus OX=9913 GN=IL1A PE=3 SV=1 CANONICAL=A0ABI0P5F6-1" }, "isoforms": [ { "isoform_ac": "A0ABI0NMI5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6/entry#A0ABI0NMI5-1", "sequence": { "sequence": "IFCFPSSQKSFYDASYEPLREDQMNKFMSLDTSETSKTSKLSFKENVVMVAASGKILKKRRLSLNQFITDDDLEAIANNTEEEIIKPRSAHYSFQSNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEK", "length": 244, "header": "tr|A0ABI0NMI5-1|A0ABI0P5F6_BOVIN Computationally mapped isoform of Interleukin-1 OS=Bos taurus OX=9913 GN=IL1A PE=3 SV=1 CANONICAL=A0ABI0P5F6-1" }, "locus": { "chromosome": "11", "start_pos": 46490640, "end_pos": 46483710, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000142193.1", "url": "https://www.ensembl.org/id/ENSBTAT00000142193.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106725.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106725.1" } ] } }, { "isoform_ac": "A0ABI0P5F6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6/entry#A0ABI0P5F6-1", "sequence": { "sequence": "MAKVPDLFEDLKNCYSENEDYSSEIDHLSLNQKSFYDASYEPLREDQMNKFMSLDTSETSKTSKLSFKENVVMVAASGKILKKRRLSLNQFITDDDLEAIANNTEEEIIKPRSAHYSFQSNVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQLPVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPKLFIATKQEKLVHMASGPPSITDFQILEKP", "length": 269, "header": "tr|A0ABI0P5F6-1|A0ABI0P5F6_BOVIN Isoform 1 of Interleukin-1 OS=Bos taurus OX=9913 GN=IL1A PE=3 SV=1 CANONICAL=A0ABI0P5F6-1" }, "locus": { "chromosome": "11", "start_pos": 46492850, "end_pos": 46483704, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000143122.1", "url": "https://www.ensembl.org/id/ENSBTAT00000143122.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106964.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106964.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "fever generation", "id": "GO:0001660", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001660", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ], "pmid": "" }, { "name": "positive regulation of cell division", "id": "GO:0051781", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051781", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ], "pmid": "" }, { "name": "interleukin-1 receptor binding", "id": "GO:0005149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005149", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 141, "end_pos": 143, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5F6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F6" }, { "id": "PF02394", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02394" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Interleukin-1 propeptide", "eco_id": "ECO_0000259", "start_pos": 1, "end_pos": 109, "start_aa": "Met", "end_aa": "Ile", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 102, "end_pos": 104 }, { "start_pos": 141, "end_pos": 143 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7A1-1", "uniprot_ac": "A0ABI0P7A1", "uniprot_id": "A0ABI0P7A1_BOVIN", "mass": { "chemical_mass": 36846.0, "monoisotopic_mass": 36846.0 }, "refseq": {}, "gene_names": [ { "name": "LOC132344488", "type": "recommended", "evidence": [ { "id": "A0ABI0P7A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1" } ] } ], "protein_names": [ { "name": "Testis-specific Y-encoded protein 3-like", "type": "recommended", "evidence": [ { "id": "A0ABI0P7A1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7A1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC132344488", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1", "locus": {} } ], "crossref": [ { "id": "IPR002164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11875", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11875", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00956", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00956", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0NQP8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NQP8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NQP8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NQP8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6D7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6D7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7A1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7A1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESETGPEEGGSTPGSWILVVSPGLHEGGALGPTSSVWAAEAMQAAGGAPGEEAALFWVEAVEEGAAVEEGEVAGLGQEFQLLVLDVMEEVEVVAYEEQEQVSSEEHVHDHPRPGALSDRPALEALAALQLELEPVNKKAERAHARLKHKTSQRRKVHLEHRSAIIQGIRGFWVEVFMNHPQMSVLMSKQDADMLHFMTNLEVEEFRHPTHHCKITLSFRRNRYFQNEVIVKEYLMKVTGYHASRSTPVQWHQGFEWKAYRRRHHDSSVNFFNWFFDHNFTGSDWIAEIIIRDLWPNPLQYYVRRKAAPQKVPGGREEPDPPSF", "length": 324, "header": "tr|A0ABI0P7A1-1|A0ABI0P7A1_BOVIN Isoform 1 of Testis-specific Y-encoded protein 3-like OS=Bos taurus OX=9913 GN=LOC132344488 PE=3 SV=1 CANONICAL=A0ABI0P7A1-1" }, "isoforms": [ { "isoform_ac": "A0ABI0NQP8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1/entry#A0ABI0NQP8-1", "sequence": { "sequence": "MQAAGGAPGEEAALFWVEAVEEGAAVEEGEVAGLGQEFQLLVLDVMEEVEVVAYEEQEQVSSEEHVHDHPRPGALSDRPALEALAALQLELEPVNKKAERAHARLKHKTSQRRKVHLEHRSAIIQGIRGFWVEVFMNHPQMSVLMSKQDADMLHFMTNLEVEEFRHPTRHCKITLSFRRNRYFQNEVIVKEYLMKVTGYHASRSTPVQWHQGFEWKAYRRRHHDSSVNFFNWFFDHNFTGSDWIAEIIIRDLWPNPLQYYVRRKAAPQKVPGGREEPDPPSF", "length": 282, "header": "tr|A0ABI0NQP8-1|A0ABI0P7A1_BOVIN Computationally mapped isoform of Testis-specific Y-encoded protein 3-like OS=Bos taurus OX=9913 GN=LOC132344488 PE=3 SV=1 CANONICAL=A0ABI0P7A1-1" }, "locus": { "chromosome": "Y", "start_pos": 18434134, "end_pos": 18399739, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000148862.1", "url": "https://www.ensembl.org/id/ENSBTAT00000148862.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104599.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104599.1" } ] } }, { "isoform_ac": "A0ABI0P6D7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1/entry#A0ABI0P6D7-1", "sequence": { "sequence": "MESETGPEEGGSTPGSWILVVSPGLHEGGALGPTSSVWAAEAMQAAGGAPGEEAALFWVEAVEEGAAVEEGEVAGLGQEFQLLVLDVMEEVEVVAYEEQEQVSSEEHVHDHPRPGALSDRPALEALAALQLELEPVNKKAERAHARLKHKTSQRRKVHLEHRSAIIQGIRGFWVEVVSLGVVLVEEFRHPTHHCKITLSFRRNRYFQNEVIVKEYLMKVTGYHASRSTPVQWHQGFEWKAYRRRHHDSSVNFFNWFFDHNFTGSDWIAEIIIRDLWPNPLQYYVRRKAAPQKVPGGREEPDPPSF", "length": 305, "header": "tr|A0ABI0P6D7-1|A0ABI0P6D7_BOVIN Computationally mapped isoform of Testis-specific Y-encoded protein 3-like OS=Bos taurus OX=9913 GN=LOC132344488 PE=3 SV=1 CANONICAL=A0ABI0P7A1-1" }, "locus": { "chromosome": "Y", "start_pos": 18434260, "end_pos": 18415441, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000138889.1", "url": "https://www.ensembl.org/id/ENSBTAT00000138889.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107036.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107036.1" } ] } }, { "isoform_ac": "A0ABI0P7A1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1/entry#A0ABI0P7A1-1", "sequence": { "sequence": "MESETGPEEGGSTPGSWILVVSPGLHEGGALGPTSSVWAAEAMQAAGGAPGEEAALFWVEAVEEGAAVEEGEVAGLGQEFQLLVLDVMEEVEVVAYEEQEQVSSEEHVHDHPRPGALSDRPALEALAALQLELEPVNKKAERAHARLKHKTSQRRKVHLEHRSAIIQGIRGFWVEVFMNHPQMSVLMSKQDADMLHFMTNLEVEEFRHPTHHCKITLSFRRNRYFQNEVIVKEYLMKVTGYHASRSTPVQWHQGFEWKAYRRRHHDSSVNFFNWFFDHNFTGSDWIAEIIIRDLWPNPLQYYVRRKAAPQKVPGGREEPDPPSF", "length": 324, "header": "tr|A0ABI0P7A1-1|A0ABI0P7A1_BOVIN Isoform 1 of Testis-specific Y-encoded protein 3-like OS=Bos taurus OX=9913 GN=LOC132344488 PE=3 SV=1 CANONICAL=A0ABI0P7A1-1" }, "locus": { "chromosome": "Y", "start_pos": 18434260, "end_pos": 18415441, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000143637.1", "url": "https://www.ensembl.org/id/ENSBTAT00000143637.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107669.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107669.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 34, "start_aa": "Thr", "end_pos": 34, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr34", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7A1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "nucleosome assembly", "id": "GO:0006334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006334", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7A1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7A1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 279, "end_pos": 281, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 34 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 279, "end_pos": 281 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5V1-1", "uniprot_ac": "A0ABI0P5V1", "uniprot_id": "A0ABI0P5V1_BOVIN", "mass": { "chemical_mass": 45158.0, "monoisotopic_mass": 45158.0 }, "refseq": {}, "gene_names": [ { "name": "PALM2", "type": "recommended", "evidence": [ { "id": "A0ABI0P5V1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1" } ] } ], "protein_names": [ { "name": "Paralemmin 2", "type": "synonym", "evidence": [ { "id": "A0ABI0P5V1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5V1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "PALM2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1", "locus": { "chromosome": "8", "start_pos": 99721951, "end_pos": 99206606, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000014471", "url": "https://www.ensembl.org/id/ENSBTAG00000014471" } ] } } ], "crossref": [ { "id": "IPR004965", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004965", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR10498", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10498", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10498:SF10", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10498:SF10", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03285", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF03285", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0NUU7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NUU7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0NUU7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0NUU7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5V1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5V1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPRMIKSKSLEEKRKRQTEIEGKRQELDEQILLLQHSKSKVLREKWLLQGIPAGTAEEEEARRRQSEEDEFRVKQLEDNIQRLEQEIQALESEESQISAKEQIILEKLKETEKSFKDFQKSFSSADGDAVNHISSQLPDLPILCSRTAEPSPEQDGTSRAAAVYAMEINVEKDKQTGETKILSTSTIGPEGVHQRGVKVFDDGTKVVYEVHSGGTIVENGVHTLSSKDVEELIQKAGQSSLRGGHVSERTGIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQAPAPSTEGPEANLDQPVTMIFMGYQNIEDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPISDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM", "length": 407, "header": "tr|A0ABI0P5V1-1|A0ABI0P5V1_BOVIN Isoform 1 of Paralemmin 2 OS=Bos taurus OX=9913 GN=PALM2 PE=4 SV=1 CANONICAL=A0ABI0P5V1-1" }, "isoforms": [ { "isoform_ac": "A0ABI0NUU7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1/entry#A0ABI0NUU7-1", "sequence": { "sequence": "MEIPDGSSNQEKRKRQTEIEGKRQELDEQILLLQHSKSKVLREKWLLQGIPAGTAEEEEARRRQSEEDEFRVKQLEDNIQRLEQEIQALESEESQISAKEQIILEKLKETEKSFKDFQKSFSSADGDAVNHISSQLPDLPILCSRTAEPSPEQDGTSRAAAVYAMEINVEKDKQTGETKILSTSTIGPEGVHQRGVKVFDDGTKVVYEVHSGGTIVENGVHTLSSKDVEELIQKAGQSSLRGGHVSERTGIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQAPAPSTEGPEANLDQPVTMIFMGYQNIEDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPISDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM", "length": 406, "header": "tr|A0ABI0NUU7-1|A0ABI0P5V1_BOVIN Computationally mapped isoform of Paralemmin 2 OS=Bos taurus OX=9913 GN=PALM2 PE=4 SV=1 CANONICAL=A0ABI0P5V1-1" }, "locus": { "chromosome": "8", "start_pos": 99503022, "end_pos": 99345964, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139107.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139107.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107531.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107531.1" } ] } }, { "isoform_ac": "A0ABI0P5V1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1/entry#A0ABI0P5V1-1", "sequence": { "sequence": "MPRMIKSKSLEEKRKRQTEIEGKRQELDEQILLLQHSKSKVLREKWLLQGIPAGTAEEEEARRRQSEEDEFRVKQLEDNIQRLEQEIQALESEESQISAKEQIILEKLKETEKSFKDFQKSFSSADGDAVNHISSQLPDLPILCSRTAEPSPEQDGTSRAAAVYAMEINVEKDKQTGETKILSTSTIGPEGVHQRGVKVFDDGTKVVYEVHSGGTIVENGVHTLSSKDVEELIQKAGQSSLRGGHVSERTGIADGSLSHPKEHMLCKEAKLEMVHKSRKDHSSGNPGQQAPAPSTEGPEANLDQPVTMIFMGYQNIEDEEETKKVLGYDETIKAELVLIDEDDEKSLREKTVTDVSTIDGNAAELVSGRPISDTTEPSSPEGKEESLATEPAPGTQKKKRCQCCVVM", "length": 407, "header": "tr|A0ABI0P5V1-1|A0ABI0P5V1_BOVIN Isoform 1 of Paralemmin 2 OS=Bos taurus OX=9913 GN=PALM2 PE=4 SV=1 CANONICAL=A0ABI0P5V1-1" }, "locus": { "chromosome": "8", "start_pos": 99503022, "end_pos": 99410664, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000142007.1", "url": "https://www.ensembl.org/id/ENSBTAT00000142007.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106708.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106708.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5V1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of cell shape", "id": "GO:0008360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008360", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5V1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5V1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7P4-1", "uniprot_ac": "A0ABI0P7P4", "uniprot_id": "A0ABI0P7P4_BOVIN", "mass": { "chemical_mass": 89674.0, "monoisotopic_mass": 89674.0 }, "refseq": {}, "gene_names": [ { "name": "EPS8L1", "type": "recommended", "evidence": [ { "id": "A0ABI0P7P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4" } ] } ], "protein_names": [ { "name": "Epidermal growth factor receptor kinase substrate 8-like protein 1", "type": "recommended", "evidence": [ { "id": "A0ABI0P7P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4/entry#names_and_taxonomy" } ] }, { "name": "Epidermal growth factor receptor pathway substrate 8-related protein 1", "type": "synonym", "evidence": [ { "id": "A0ABI0P7P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Stimulates guanine exchange activity of SOS1. May play a role in membrane ruffling and remodeling of the actin cytoskeleton.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P203", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P203#function" }, { "database": "UniProtKB", "id": "ARBA00058563", "url": "https://www.uniprot.org/uniprotkb/ARBA00058563#function" }, { "database": "UniProtKB", "id": "A0ABI0P7P4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7P4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "EPS8L1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4", "locus": {} } ], "crossref": [ { "id": "cd01210", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01210", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11764", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11764", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "514504", "url": "https://www.ncbi.nlm.nih.gov/gene/514504", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011993", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011993", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013625", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013625", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013761", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013761", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033928", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033928", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035462", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035462", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036028", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036028", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039801", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039801", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041418", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041418", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR055093", "url": "https://www.ebi.ac.uk/interpro/entry/IPR055093", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:514504", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:514504", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR12287", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12287", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12287:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12287:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00018", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00018", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08416", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08416", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF18016", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF18016", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF22975", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF22975", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P1Z3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P1Z3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P1Z3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P1Z3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P203", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P203", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P203-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P203-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7P4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7P4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPEESVNFVILLESCWALNLSYHRHWNYRGKFSKEEGRGLRAPVETETPEGGLRVPGAAFFGTMSTTSGPEASLKQSAKSIYEQRKRYSIEVMSDFSTNEVNHLVTFSLGEDAIHTVEDASQKLALMDSQGRIWAQDMLLSVSASHVTLLDPVSKEELESYPVSAIVRCDTVRPPGQKRPLLLLVCQEPERAQPDVHFFQGRCVGVESIREEIQRALHNYRSGCGERRAAALRATRMQPQQHPSPVAEAAPLPHCPMFRAAIHTVQPAAGRGRPQAEPIPEAEETCRPSREEVCPSSDPASPDLGPRGPDLASLQAEREVDILNHVFDDVESFVSRLQKSAEATRVLEQRERSRRTRHQEAGESLLALRAKPPSGAEYTDVLQKIKYAFSLLARLRGNIANPTSQELLHFLFGPLQMIIDTLGGPQLASGVRRPHLTSEAVKLLRENVTQRENTLWTSLGDSWTHPGVDLPPEEGPPYRPEFYSAWEPPAMDPQGRAWEDPVEKQLQHERRRQQQSAPQVAVNGHPDEEPEAEPQGPEPAGKWVLCNYDFQARNSSELSVKEWDILEVLDDQRKWWKVQDQRGQEGYVPYNILTPHPGPRGGRSLENSTAVPPPPPAPAPGLAPPAPPASASAPAPPPPPLLPAAPALAPGLAQTQGPAPASARSPRDSCENLNNLDSGKKEKFSPMLMLSINKELQARLAQGLTGPSRAAPGPRAPESQLSPHSSASEVCAWLQAKGFSSGTIAALGELSGAQLFSLPKEKFRALSPEEGARVYSQITVQRSLLEDKENVSELEAVMKKQKKRMENEIETEVF", "length": 814, "header": "tr|A0ABI0P7P4-1|A0ABI0P7P4_BOVIN Isoform 1 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Bos taurus OX=9913 GN=EPS8L1 PE=3 SV=1 CANONICAL=A0ABI0P7P4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P1Z3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4/entry#A0ABI0P1Z3-1", "sequence": { "sequence": "MSTTSGPEASLKQSAKSIYEQRKRYSIEVMSDFSTNEVNEELESYPVSAIVRCDTVRPPGQKRPLLLLVCQEPERAQPDVHFFQGRCVGVESIREEIQRALHNYRSGCGERRAAALRATRMQPQQHPSPVAEAAPLPHCPMFRAAIHTVQPAAGRGRPQAEPIPEAEETCRPSREEVCPSSDPASPDLGPRGPDLASLQAEREVDILNHVFDDVESFVSRLQKSAEATRVLEQRERSRRTRHQEAGESLLALRAKPPSGAEYTDVLQKIKYAFSLLARLRGNIANPTSQELLHFLFGPLQMIIDTLGGPQLASGVRRPHLTSEAVKLLRENVTQRENTLWTSLGDSWTHPGVDLPPEEGPPYRPEFYSAWEPPAMDPQGRAWEDPVEKQLQHERRRQQQSAPQVAVNGHPDEEPEAEPQGPEPAGKWVLCNYDFQARNSSELSVKEWDILEVLDDQRKWWKVQDQRGQEGYVPYNILTPHPGPRGGRSLENSTAVPPPPPAPAPGLAPPAPPASASAPAPPPPPLLPAAPALAPGLAQTQGPAPASARSPRDSCENLNNLDSGKKEKFSPMLMLSINKELQARLAQGLTGPSRAAPGPRAPESQLSPHSSASEVCAWLQAKGFSSGTIAALGELSGAQLFSLPKEKFRALSPEEGARVYSQITVQRSLLEDKENVSELEAVMKKQKKRMENEIETEVF", "length": 698, "header": "tr|A0ABI0P1Z3-1|A0ABI0P7P4_BOVIN Computationally mapped isoform of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Bos taurus OX=9913 GN=EPS8L1 PE=3 SV=1 CANONICAL=A0ABI0P7P4-1" }, "locus": { "chromosome": "18", "start_pos": 62323276, "end_pos": 62311787, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000150778.1", "url": "https://www.ensembl.org/id/ENSBTAT00000150778.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104606.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104606.1" } ] } }, { "isoform_ac": "A0ABI0P203-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4/entry#A0ABI0P203-1", "sequence": { "sequence": "MSTTSGPEASLKQSAKSIYEQRKRYSIEVMSDFSTNEVNHLVTFSLGEDAIHTVEDASQKLALMDSQGRIWAQDMLLSVSASHVTLLDPVSKEELESYPVSAIVRCDTVRPPGQKRPLLLLVCQEPERAQPDVHFFQGRCVGVESIREEIQRALHNYRSGCGERRAAALRATRMQPQQHPSPVAEAAPLPHCPMFRAAIHTVQPAAGRGRPQAEPIPEAEETCRPSREEVCPSSDPASPDLGPRGPDLASLQAEREVDILNHVFDDVESFVSRLQKSAEATRVLEQRERSRRTRHQEAGESLLALRAKPPSGAEYTDVLQKIKYAFSLLARLRGNIANPTSQELLHFLFGPLQMIIDTLGGPQLASGVRRPHLTSEAVKLLRENVTQRENTLWTSLGDSWTHPGVDLPPEEGPPYRPEFYSAWEPPAMDPQGRAWEDPVEKQLQHERRRQQQSAPQVAVNGHPDEEPEAEPQGPEPAGKWVLCNYDFQARNSSELSVKEWDILEVLDDQRKWWKVQDQRGQEGYVPYNILTPHPGPRGGRSLENSTAVPPPPPAPAPGLAPPAPPASASAPAPPPPPLLPAAPALAPGLAQTQGPAPASARSPRDSCENLNNLDSGKKEKFSPMLMLSINKELQARLAQGLTGPSRAAPGPRAPESQLSPHSSASEVCAWLQAKGFSSGTIAALGELSGAQLFSLPKEKFRALSPEEGARVYSQITVQRSLLEDKENVSELEAVMKKQKKRMENEIETEVF", "length": 751, "header": "tr|A0ABI0P203-1|A0ABI0P7P4_BOVIN Computationally mapped isoform of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Bos taurus OX=9913 GN=EPS8L1 PE=3 SV=1 CANONICAL=A0ABI0P7P4-1" }, "locus": { "chromosome": "18", "start_pos": 62323276, "end_pos": 62311787, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000151110.1", "url": "https://www.ensembl.org/id/ENSBTAT00000151110.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104375.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104375.1" } ] } }, { "isoform_ac": "A0ABI0P7P4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4/entry#A0ABI0P7P4-1", "sequence": { "sequence": "MPEESVNFVILLESCWALNLSYHRHWNYRGKFSKEEGRGLRAPVETETPEGGLRVPGAAFFGTMSTTSGPEASLKQSAKSIYEQRKRYSIEVMSDFSTNEVNHLVTFSLGEDAIHTVEDASQKLALMDSQGRIWAQDMLLSVSASHVTLLDPVSKEELESYPVSAIVRCDTVRPPGQKRPLLLLVCQEPERAQPDVHFFQGRCVGVESIREEIQRALHNYRSGCGERRAAALRATRMQPQQHPSPVAEAAPLPHCPMFRAAIHTVQPAAGRGRPQAEPIPEAEETCRPSREEVCPSSDPASPDLGPRGPDLASLQAEREVDILNHVFDDVESFVSRLQKSAEATRVLEQRERSRRTRHQEAGESLLALRAKPPSGAEYTDVLQKIKYAFSLLARLRGNIANPTSQELLHFLFGPLQMIIDTLGGPQLASGVRRPHLTSEAVKLLRENVTQRENTLWTSLGDSWTHPGVDLPPEEGPPYRPEFYSAWEPPAMDPQGRAWEDPVEKQLQHERRRQQQSAPQVAVNGHPDEEPEAEPQGPEPAGKWVLCNYDFQARNSSELSVKEWDILEVLDDQRKWWKVQDQRGQEGYVPYNILTPHPGPRGGRSLENSTAVPPPPPAPAPGLAPPAPPASASAPAPPPPPLLPAAPALAPGLAQTQGPAPASARSPRDSCENLNNLDSGKKEKFSPMLMLSINKELQARLAQGLTGPSRAAPGPRAPESQLSPHSSASEVCAWLQAKGFSSGTIAALGELSGAQLFSLPKEKFRALSPEEGARVYSQITVQRSLLEDKENVSELEAVMKKQKKRMENEIETEVF", "length": 814, "header": "tr|A0ABI0P7P4-1|A0ABI0P7P4_BOVIN Isoform 1 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Bos taurus OX=9913 GN=EPS8L1 PE=3 SV=1 CANONICAL=A0ABI0P7P4-1" }, "locus": { "chromosome": "18", "start_pos": 62324138, "end_pos": 62311787, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147120.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147120.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107496.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107496.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:514504", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:514504", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7P4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 19, "end_pos": 21, "annotation": "n_glycosylation_sequon" }, { "start_pos": 447, "end_pos": 449, "annotation": "n_glycosylation_sequon" }, { "start_pos": 554, "end_pos": 556, "annotation": "n_glycosylation_sequon" }, { "start_pos": 607, "end_pos": 609, "annotation": "n_glycosylation_sequon" }, { "start_pos": 790, "end_pos": 792, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7P4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7P4" }, { "id": "PS50002", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50002" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "SH3", "eco_id": "ECO_0000259", "start_pos": 539, "end_pos": 598, "start_aa": "Pro", "end_aa": "Gly", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 19, "end_pos": 21 }, { "start_pos": 447, "end_pos": 449 }, { "start_pos": 554, "end_pos": 556 }, { "start_pos": 607, "end_pos": 609 }, { "start_pos": 790, "end_pos": 792 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6G7-1", "uniprot_ac": "A0ABI0P6G7", "uniprot_id": "A0ABI0P6G7_BOVIN", "mass": { "chemical_mass": 43473.0, "monoisotopic_mass": 43473.0 }, "refseq": {}, "gene_names": [ { "name": "SDF4", "type": "recommended", "evidence": [ { "id": "A0ABI0P6G7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7" } ] } ], "protein_names": [ { "name": "45 kDa calcium-binding protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6G7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7/entry#names_and_taxonomy" } ] }, { "name": "Stromal cell-derived factor 4", "type": "synonym", "evidence": [ { "id": "A0ABI0P6G7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6G7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "SDF4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7", "locus": {} } ], "crossref": [ { "id": "cd16225", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16225", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027240", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027240", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR10827", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10827", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10827:SF98", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10827:SF98", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13499", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13499", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P383", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P383", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P383-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P383-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6G7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6G7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKPTDTSLLLATLAACPAAQTPAAMASRQAPLCGLAPCCLWLLGVVLLMNASARPANHSSARERAGNREENEILPPDHLNGVKLEMDGHLNKDFHQEVFLGKDMDDFEEDAEPRKSRRKLMVIFSKVDLNTDRRISAKEMQKWIMQKTAEHFQEAVAESRAHFRAVDPDGDGHVSWDEYKVKFLVTKGHNEREVAEKIKNKWDLNIDEETQEVLENLKDRWYQADNPPPDLLLTESEFLSFLHPEHSRGMLQFMVKEIIRDLDQDGDKKLSLSEFISLPVGTVENQQGQDVDDSWVRDRKREFEELIDANHDGIVTMAELEDYMDPMNEFSALNEAKQMIAIADENQNHYLEPEEVLKYSEFFTGSKLVDYARSVHEEF", "length": 379, "header": "tr|A0ABI0P6G7-1|A0ABI0P6G7_BOVIN Isoform 1 of 45 kDa calcium-binding protein OS=Bos taurus OX=9913 GN=SDF4 PE=3 SV=1 CANONICAL=A0ABI0P6G7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P383-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7/entry#A0ABI0P383-1", "sequence": { "sequence": "MASRQAPLCGLAPCCLWLLGVVLLMNASARPANHSSARERAGNREENEILPPDHLNGVKLEMDGHLNKDFHQEVFLGKDMDDFEEDAEPRKSRRKLMVIFSKVDLNTDRRISAKEMQKWIMQKTAEHFQEAVAESRAHFRAVDPDGDGHVSWDEYKVKFLVTKGHNEREVAEKIKNKWDLNIDEETQEVLENLKDRWYQADNPPPDLLLTESEFLSFLHPEHSRGMLQFMVKEIIRDLDQDGDKKLSLSEFISLPVGTVENQQGQDVDDSWVRDRKREFEELIDANHDGIVTMAELEDYMDPMNEFSALNEAKQMIAIADENQNHYLEPEEVLKYMDA", "length": 338, "header": "tr|A0ABI0P383-1|A0ABI0P6G7_BOVIN Computationally mapped isoform of 45 kDa calcium-binding protein OS=Bos taurus OX=9913 GN=SDF4 PE=3 SV=1 CANONICAL=A0ABI0P6G7-1" }, "locus": { "chromosome": "16", "start_pos": 51285255, "end_pos": 51273221, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000141252.1", "url": "https://www.ensembl.org/id/ENSBTAT00000141252.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000105144.1", "url": "https://www.ensembl.org/id/ENSBTAP00000105144.1" } ] } }, { "isoform_ac": "A0ABI0P6G7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7/entry#A0ABI0P6G7-1", "sequence": { "sequence": "MKPTDTSLLLATLAACPAAQTPAAMASRQAPLCGLAPCCLWLLGVVLLMNASARPANHSSARERAGNREENEILPPDHLNGVKLEMDGHLNKDFHQEVFLGKDMDDFEEDAEPRKSRRKLMVIFSKVDLNTDRRISAKEMQKWIMQKTAEHFQEAVAESRAHFRAVDPDGDGHVSWDEYKVKFLVTKGHNEREVAEKIKNKWDLNIDEETQEVLENLKDRWYQADNPPPDLLLTESEFLSFLHPEHSRGMLQFMVKEIIRDLDQDGDKKLSLSEFISLPVGTVENQQGQDVDDSWVRDRKREFEELIDANHDGIVTMAELEDYMDPMNEFSALNEAKQMIAIADENQNHYLEPEEVLKYSEFFTGSKLVDYARSVHEEF", "length": 379, "header": "tr|A0ABI0P6G7-1|A0ABI0P6G7_BOVIN Isoform 1 of 45 kDa calcium-binding protein OS=Bos taurus OX=9913 GN=SDF4 PE=3 SV=1 CANONICAL=A0ABI0P6G7-1" }, "locus": { "chromosome": "16", "start_pos": 51282610, "end_pos": 51271368, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000143584.1", "url": "https://www.ensembl.org/id/ENSBTAT00000143584.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106949.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106949.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "Golgi lumen", "id": "GO:0005796", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005796", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6G7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6G7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 50, "end_pos": 52, "annotation": "n_glycosylation_sequon" }, { "start_pos": 57, "end_pos": 59, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6G7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G7" }, { "id": "PS50222", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50222" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "EF-hand", "eco_id": "ECO_0000259", "start_pos": 115, "end_pos": 150, "start_aa": "Lys", "end_aa": "Glu", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 50, "end_pos": 52 }, { "start_pos": 57, "end_pos": 59 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7V3-1", "uniprot_ac": "A0ABI0P7V3", "uniprot_id": "A0ABI0P7V3_BOVIN", "mass": { "chemical_mass": 60810.0, "monoisotopic_mass": 60810.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "C2H2-type domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P7V3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "May function as a transcription factor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7V3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3#function" }, { "database": "UniProtKB", "id": "ARBA00003729", "url": "https://www.uniprot.org/uniprotkb/ARBA00003729#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7V3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3", "locus": {} } ], "crossref": [ { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025243", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025243", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050527", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050527", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR24388", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24388", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24388:SF56", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24388:SF56", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13836", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13836", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P3D7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P3D7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P3D7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P3D7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7V3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7V3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPPWMSCEEEQEPEPQKSEGETKLVNDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVISNILNRVTPGSCSRRNRYGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPIIIEPLSKADSKNISPQIMPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRLSTSETNSTSPKRPTLSDGVIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTAFPKDNVHCKPVSPVGGNVLTKTDFPSVSSQNKFADPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTAFKCHSCLKVLKNVEFMNHMKHHLELERLRGDSWKYHTTCQHCHRQFPTPFQLCHIESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAHFRAYHGNTKNLLCPFCLQIFKTEALYICHYKQHWAKRFHQCSKCRLQFLTCKEKREHKTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPGLVEVASITVNASDSEPSPPKSKSRRSKKPG", "length": 542, "header": "tr|A0ABI0P7V3-1|A0ABI0P7V3_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7V3-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P3D7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3/entry#A0ABI0P3D7-1", "sequence": { "sequence": "MEPPWMSCEEEQEPEPQKSEGETKLVNDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVISNILNRVTPGSCSRRNRYGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPIIIEPLSKADSKNISPQIMPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRLSTSETNSTSPKRPTLSDGVIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTAFPKDNVHCKPVSPVGGNVLTKTDFPSVSSQNKFADPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTAFKCHSCLKVLKNVEFMNHMKHHLELERLRGDSWKYHTTCQHCHRQFPTPFQLCHIESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQQLQIIILCRCGCTFQSIPW", "length": 424, "header": "tr|A0ABI0P3D7-1|A0ABI0P7V3_BOVIN Computationally mapped isoform of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7V3-1" }, "locus": { "chromosome": "Y", "start_pos": 53946154, "end_pos": 53944875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152068.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152068.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000105324.1", "url": "https://www.ensembl.org/id/ENSBTAP00000105324.1" } ] } }, { "isoform_ac": "A0ABI0P7V3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3/entry#A0ABI0P7V3-1", "sequence": { "sequence": "MEPPWMSCEEEQEPEPQKSEGETKLVNDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVISNILNRVTPGSCSRRNRYGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPIIIEPLSKADSKNISPQIMPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRLSTSETNSTSPKRPTLSDGVIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTAFPKDNVHCKPVSPVGGNVLTKTDFPSVSSQNKFADPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTAFKCHSCLKVLKNVEFMNHMKHHLELERLRGDSWKYHTTCQHCHRQFPTPFQLCHIESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAHFRAYHGNTKNLLCPFCLQIFKTEALYICHYKQHWAKRFHQCSKCRLQFLTCKEKREHKTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPGLVEVASITVNASDSEPSPPKSKSRRSKKPG", "length": 542, "header": "tr|A0ABI0P7V3-1|A0ABI0P7V3_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7V3-1" }, "locus": { "chromosome": "Y", "start_pos": 53946503, "end_pos": 53944875, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147597.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147597.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107363.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107363.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 68, "start_aa": "Thr", "end_pos": 68, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr68", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Thr", "end_pos": 96, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr96", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7V3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7V3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7V3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7V3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 131, "end_pos": 133, "annotation": "n_glycosylation_sequon" }, { "start_pos": 184, "end_pos": 186, "annotation": "n_glycosylation_sequon" }, { "start_pos": 522, "end_pos": 524, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7V3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7V3" }, { "id": "PS50157", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50157" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "C2H2-type", "eco_id": "ECO_0000259", "start_pos": 343, "end_pos": 370, "start_aa": "Thr", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 68, 96 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 131, "end_pos": 133 }, { "start_pos": 184, "end_pos": 186 }, { "start_pos": 522, "end_pos": 524 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P599-1", "uniprot_ac": "A0ABI0P599", "uniprot_id": "A0ABI0P599_BOVIN", "mass": { "chemical_mass": 14966.0, "monoisotopic_mass": 14966.0 }, "refseq": { "ac": "NP_001192312", "name": "required for drug-induced death protein 1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192312" }, "gene_names": [ { "name": "C16H1orf115", "type": "recommended", "evidence": [ { "id": "A0ABI0P599", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P599" } ] }, { "name": "C16H1orf115", "type": "synonym", "evidence": [ { "id": "NP_001192312", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192312" } ] } ], "protein_names": [ { "name": "Chromosome 16 C1orf115 homolog", "type": "synonym", "evidence": [ { "id": "A0ABI0P599", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P599/entry#names_and_taxonomy" } ] }, { "name": "required for drug-induced death protein 1", "type": "synonym", "evidence": [ { "id": "NP_001192312", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192312" } ] }, { "name": "uncharacterized protein C1orf115 homolog", "type": "synonym", "evidence": [ { "id": "NP_001192312", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192312" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P599", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P599" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "C16H1orf115", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P599", "locus": {} } ], "crossref": [ { "id": "618454", "url": "https://www.ncbi.nlm.nih.gov/gene/618454", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR031667", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031667", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:618454", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:618454", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR14680", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14680", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14680:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14680:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15828", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15828", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001192312", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192312", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P599", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P599", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P599-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P599-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTVGARLRSKAASSLPRCGPLTRGRGRTEGDEEAAAILEHLENGAEAAESEASARRPGSRGARRVHLAVLPERYEPLEEQVPSEKPKKRYRKKLKKYGKNVGKVITKGCRYIVVGLQGFAAAYSAPFGVATSVVSFVR", "length": 138, "header": "tr|A0ABI0P599-1|A0ABI0P599_BOVIN Isoform 1 of Chromosome 16 C1orf115 homolog OS=Bos taurus OX=9913 GN=C16H1orf115 PE=4 SV=1 CANONICAL=A0ABI0P599-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P599-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P599/entry#A0ABI0P599-1", "sequence": { "sequence": "MTVGARLRSKAASSLPRCGPLTRGRGRTEGDEEAAAILEHLENGAEAAESEASARRPGSRGARRVHLAVLPERYEPLEEQVPSEKPKKRYRKKLKKYGKNVGKVITKGCRYIVVGLQGFAAAYSAPFGVATSVVSFVR", "length": 138, "header": "tr|A0ABI0P599-1|A0ABI0P599_BOVIN Isoform 1 of Chromosome 16 C1orf115 homolog OS=Bos taurus OX=9913 GN=C16H1orf115 PE=4 SV=1 CANONICAL=A0ABI0P599-1" }, "locus": { "chromosome": "16", "start_pos": 24186536, "end_pos": 24176386, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147379.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147379.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106443.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106443.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:618454", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:618454", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5A4-1", "uniprot_ac": "A0ABI0P5A4", "uniprot_id": "A0ABI0P5A4_BOVIN", "mass": { "chemical_mass": 35093.0, "monoisotopic_mass": 35093.0 }, "refseq": { "ac": "NP_001376870", "name": "olfactory receptor family 4 subfamily D member 2", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376870" }, "gene_names": [ { "name": "OR4D2", "type": "recommended", "evidence": [ { "id": "A0ABI0P5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4" } ] }, { "name": "OR4D2", "type": "synonym", "evidence": [ { "id": "NP_001376870", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376870" } ] } ], "protein_names": [ { "name": "Olfactory receptor family 4 subfamily D member 2", "type": "synonym", "evidence": [ { "id": "A0ABI0P5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor family 4 subfamily D member 2", "type": "synonym", "evidence": [ { "id": "NP_001376870", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376870" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001376870", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376870" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5A4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5A4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR4D2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4", "locus": {} } ], "crossref": [ { "id": "cd15936", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15936", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "514319", "url": "https://www.ncbi.nlm.nih.gov/gene/514319", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050427", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050427", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001376870", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376870", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P5A4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5A4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQPGNLTCVSEFVFLGLSQTHELHLFLFLVFLLVYTTTVMGNLLIMVMVSSDSRLHTPMYFLLRNLAVIDLCFSSVTAPKMLVDFLAEKKTISYQGCMTQIFFFHFLGGAMVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVGLVVASWVGGFIHSISQVALMLPLPFCGPNVLDNFYCDVPQVLRLACTDTSVLEFLVISNSGMLDVIWFLLLLVSYSAILVMLRSHSGQARRKAASTCTTHIIVMSMVFIPSIYLYARPFTSFSMDKAVSISHTVMTPMLNPMIYTLRNQEMQAAVKRLGRHWLLCKRE", "length": 311, "header": "tr|A0ABI0P5A4-1|A0ABI0P5A4_BOVIN Isoform 1 of Olfactory receptor family 4 subfamily D member 2 OS=Bos taurus OX=9913 GN=OR4D2 PE=3 SV=1 CANONICAL=A0ABI0P5A4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5A4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4/entry#A0ABI0P5A4-1", "sequence": { "sequence": "MQPGNLTCVSEFVFLGLSQTHELHLFLFLVFLLVYTTTVMGNLLIMVMVSSDSRLHTPMYFLLRNLAVIDLCFSSVTAPKMLVDFLAEKKTISYQGCMTQIFFFHFLGGAMVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVGLVVASWVGGFIHSISQVALMLPLPFCGPNVLDNFYCDVPQVLRLACTDTSVLEFLVISNSGMLDVIWFLLLLVSYSAILVMLRSHSGQARRKAASTCTTHIIVMSMVFIPSIYLYARPFTSFSMDKAVSISHTVMTPMLNPMIYTLRNQEMQAAVKRLGRHWLLCKRE", "length": 311, "header": "tr|A0ABI0P5A4-1|A0ABI0P5A4_BOVIN Isoform 1 of Olfactory receptor family 4 subfamily D member 2 OS=Bos taurus OX=9913 GN=OR4D2 PE=3 SV=1 CANONICAL=A0ABI0P5A4-1" }, "locus": { "chromosome": "19", "start_pos": 9021775, "end_pos": 9020843, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000151731.1", "url": "https://www.ensembl.org/id/ENSBTAT00000151731.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106211.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106211.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5A4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5A4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5A4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5A4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A4" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 41, "end_pos": 287, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5A9-1", "uniprot_ac": "A0ABI0P5A9", "uniprot_id": "A0ABI0P5A9_BOVIN", "mass": { "chemical_mass": 47867.0, "monoisotopic_mass": 47867.0 }, "refseq": {}, "gene_names": [ { "name": "LOC132344715", "type": "recommended", "evidence": [ { "id": "A0ABI0P5A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9" } ] } ], "protein_names": [ { "name": "HSF-type DNA-binding domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5A9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC132344715", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9", "locus": {} } ], "crossref": [ { "id": "IPR000232", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000232", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR10015", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10015", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10015:SF336", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10015:SF336", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00447", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00447", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5A9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5A9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAHIPSEIQDGPPKDESTDSETSIRSLYDYTLTRDSVLRSMIEEYAFQALSEDLVIKRPCYKYSVSETDEVTNFLSLTFPQKLWNIVESDQFESIWWDERGTCIVIHEELFKKEVLERKAPFRIFETKSMKSLIRQLNLYGFSKKRQTFQRSASLPVFLEEENNISLLSKLQTYYNPNFKRGHPQLLLRVQRRERRVGINNVSQISSLVQDNKKHVKASVNEDDRNSEFIPEISRESAFSASTRLPVPFIQKPHTIQIVTNTNALSPCDLPNHPSPISVRQTEQILVNQPAVLKKLSIFNWHSHSSYTQVNGPIEDFATTTTSTSQNHIVSPLQSTYSGLMVEPSKFPVRHSDMSGHDNPFPNLQETGNSWFSVPTSTYTSASSLSSQLINNHHYMETMLIKTDLPNTCQIMEPKED", "length": 417, "header": "tr|A0ABI0P5A9-1|A0ABI0P5A9_BOVIN Isoform 1 of HSF-type DNA-binding domain-containing protein OS=Bos taurus OX=9913 GN=LOC132344715 PE=3 SV=1 CANONICAL=A0ABI0P5A9-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5A9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9/entry#A0ABI0P5A9-1", "sequence": { "sequence": "MAHIPSEIQDGPPKDESTDSETSIRSLYDYTLTRDSVLRSMIEEYAFQALSEDLVIKRPCYKYSVSETDEVTNFLSLTFPQKLWNIVESDQFESIWWDERGTCIVIHEELFKKEVLERKAPFRIFETKSMKSLIRQLNLYGFSKKRQTFQRSASLPVFLEEENNISLLSKLQTYYNPNFKRGHPQLLLRVQRRERRVGINNVSQISSLVQDNKKHVKASVNEDDRNSEFIPEISRESAFSASTRLPVPFIQKPHTIQIVTNTNALSPCDLPNHPSPISVRQTEQILVNQPAVLKKLSIFNWHSHSSYTQVNGPIEDFATTTTSTSQNHIVSPLQSTYSGLMVEPSKFPVRHSDMSGHDNPFPNLQETGNSWFSVPTSTYTSASSLSSQLINNHHYMETMLIKTDLPNTCQIMEPKED", "length": 417, "header": "tr|A0ABI0P5A9-1|A0ABI0P5A9_BOVIN Isoform 1 of HSF-type DNA-binding domain-containing protein OS=Bos taurus OX=9913 GN=LOC132344715 PE=3 SV=1 CANONICAL=A0ABI0P5A9-1" }, "locus": { "chromosome": "Y", "start_pos": 37869147, "end_pos": 37867467, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000153881.1", "url": "https://www.ensembl.org/id/ENSBTAT00000153881.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106715.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106715.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5A9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5A9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5A9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 164, "end_pos": 166, "annotation": "n_glycosylation_sequon" }, { "start_pos": 201, "end_pos": 203, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5A9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5A9" }, { "id": "SM00415", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM00415" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "HSF-type DNA-binding", "eco_id": "ECO_0000259", "start_pos": 70, "end_pos": 193, "start_aa": "Glu", "end_aa": "Arg", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 164, "end_pos": 166 }, { "start_pos": 201, "end_pos": 203 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5C0-1", "uniprot_ac": "A0ABI0P5C0", "uniprot_id": "A0ABI0P5C0_BOVIN", "mass": { "chemical_mass": 32291.0, "monoisotopic_mass": 32291.0 }, "refseq": {}, "gene_names": [ { "name": "LOC132344459", "type": "recommended", "evidence": [ { "id": "A0ABI0P5C0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0" } ] } ], "protein_names": [ { "name": "Short stature homeobox", "type": "recommended", "evidence": [ { "id": "A0ABI0P5C0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5C0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC132344459", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0", "locus": {} } ], "crossref": [ { "id": "cd00086", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00086", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000047", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000047", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001356", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001356", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003654", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003654", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009057", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009057", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017970", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017970", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR052631", "url": "https://www.ebi.ac.uk/interpro/entry/IPR052631", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR46255", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46255", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46255:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46255:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00046", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00046", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF03826", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF03826", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5C0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5C0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEELTAFVSKSFDQKSKDGSGGGSGGGGGGKKESITYREVLESGLARSRELGVSESNLHDITEAGGHCPVHLFKDHVDTEKDKLKEFGSGRAAEGIYDCKDKRDDVKSEDEDGQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMHKGVILGTASHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLMFPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL", "length": 294, "header": "tr|A0ABI0P5C0-1|A0ABI0P5C0_BOVIN Isoform 1 of Short stature homeobox OS=Bos taurus OX=9913 GN=LOC132344459 PE=4 SV=1 CANONICAL=A0ABI0P5C0-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5C0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0/entry#A0ABI0P5C0-1", "sequence": { "sequence": "MEELTAFVSKSFDQKSKDGSGGGSGGGGGGKKESITYREVLESGLARSRELGVSESNLHDITEAGGHCPVHLFKDHVDTEKDKLKEFGSGRAAEGIYDCKDKRDDVKSEDEDGQTKLKQRRSRTNFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQMHKGVILGTASHLDACRVAPYVNMGALRMPFQQVQAQLQLEGVAHAHPHLHPHLAAHAPYLMFPPPPFGLPIASLAESASAAAVVAAAAKSNSKNSSIADLRLKARKHAEALGL", "length": 294, "header": "tr|A0ABI0P5C0-1|A0ABI0P5C0_BOVIN Isoform 1 of Short stature homeobox OS=Bos taurus OX=9913 GN=LOC132344459 PE=4 SV=1 CANONICAL=A0ABI0P5C0-1" }, "locus": { "chromosome": "Y", "start_pos": 298818, "end_pos": 287432, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144427.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144427.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106468.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106468.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5C0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5C0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5C0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 125, "end_pos": 127, "annotation": "n_glycosylation_sequon" }, { "start_pos": 275, "end_pos": 277, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5C0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0" }, { "id": "PS50071", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50071" }, { "id": "PRU00108", "database": "PROSITE", "url": "https://prosite.expasy.org/PRU00108" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Homeobox", "eco_id": "ECO_0000259", "start_pos": 117, "end_pos": 177, "start_aa": "Leu", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P5C0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5C0" }, { "id": "PS50803", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50803" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "OAR", "eco_id": "ECO_0000259", "start_pos": 276, "end_pos": 289, "start_aa": "Ser", "end_aa": "Ala", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 125, "end_pos": 127 }, { "start_pos": 275, "end_pos": 277 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5D2-1", "uniprot_ac": "A0ABI0P5D2", "uniprot_id": "A0ABI0P5D2_BOVIN", "mass": { "chemical_mass": 11586.0, "monoisotopic_mass": 11586.0 }, "refseq": {}, "gene_names": [ { "name": "TRBV16", "type": "recommended", "evidence": [ { "id": "A0ABI0P5D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D2" } ] } ], "protein_names": [ { "name": "T cell receptor beta variable 16", "type": "synonym", "evidence": [ { "id": "A0ABI0P5D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D2/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5D2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "TRBV16", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D2", "locus": {} } ], "crossref": [ { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF14", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF14", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5D2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5D2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "EAEVTQTPGHLVQGKGLEVKMYCVPKKGHIYVFWYQQILTKEFKFLISFQNDKVLDDKEMPKRFSAECPSNSPCSLKIQSTEPQDSALYFCASSDCTVRNTG", "length": 102, "header": "tr|A0ABI0P5D2-1|A0ABI0P5D2_BOVIN Isoform 1 of T cell receptor beta variable 16 OS=Bos taurus OX=9913 GN=TRBV16 PE=4 SV=1 CANONICAL=A0ABI0P5D2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5D2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D2/entry#A0ABI0P5D2-1", "sequence": { "sequence": "EAEVTQTPGHLVQGKGLEVKMYCVPKKGHIYVFWYQQILTKEFKFLISFQNDKVLDDKEMPKRFSAECPSNSPCSLKIQSTEPQDSALYFCASSDCTVRNTG", "length": 102, "header": "tr|A0ABI0P5D2-1|A0ABI0P5D2_BOVIN Isoform 1 of T cell receptor beta variable 16 OS=Bos taurus OX=9913 GN=TRBV16 PE=4 SV=1 CANONICAL=A0ABI0P5D2-1" }, "locus": { "chromosome": "4", "start_pos": 105792900, "end_pos": 105792595, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000153273.1", "url": "https://www.ensembl.org/id/ENSBTAT00000153273.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106595.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106595.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5D2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D2" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 2, "end_pos": 102, "start_aa": "Ala", "end_aa": "Gly", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5D3-1", "uniprot_ac": "A0ABI0P5D3", "uniprot_id": "A0ABI0P5D3_BOVIN", "mass": { "chemical_mass": 13551.0, "monoisotopic_mass": 13551.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5D3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D3/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5D3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D3" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D3", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR052051", "url": "https://www.ebi.ac.uk/interpro/entry/IPR052051", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR19433", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19433", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19433:SF132", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19433:SF132", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5D3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5D3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "DAKTTQPSSMDCAEGEDVNLPCNHSTICGNVYIHWYRQNPNQSPLYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLREAHWDRRGCTCAVSLVGRSRRGRVAGAVTRQI", "length": 123, "header": "tr|A0ABI0P5D3-1|A0ABI0P5D3_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5D3-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5D3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D3/entry#A0ABI0P5D3-1", "sequence": { "sequence": "DAKTTQPSSMDCAEGEDVNLPCNHSTICGNVYIHWYRQNPNQSPLYVIHGLRGTVNSSMASLTIASDRKSSTLVLPQVTLRDAAVYYCVLREAHWDRRGCTCAVSLVGRSRRGRVAGAVTRQI", "length": 123, "header": "tr|A0ABI0P5D3-1|A0ABI0P5D3_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5D3-1" }, "locus": { "chromosome": "10", "start_pos": 23690937, "end_pos": 23690569, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000146495.1", "url": "https://www.ensembl.org/id/ENSBTAT00000146495.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106936.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106936.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5D3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5D3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 23, "end_pos": 25, "annotation": "n_glycosylation_sequon" }, { "start_pos": 41, "end_pos": 43, "annotation": "n_glycosylation_sequon" }, { "start_pos": 56, "end_pos": 58, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5D3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5D3" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 1, "end_pos": 88, "start_aa": "Asp", "end_aa": "Cys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 23, "end_pos": 25 }, { "start_pos": 41, "end_pos": 43 }, { "start_pos": 56, "end_pos": 58 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5E9-1", "uniprot_ac": "A0ABI0P5E9", "uniprot_id": "A0ABI0P5E9_BOVIN", "mass": { "chemical_mass": 34913.0, "monoisotopic_mass": 34913.0 }, "refseq": {}, "gene_names": [ { "name": "LOC781494", "type": "recommended", "evidence": [ { "id": "A0ABI0P5E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E9" } ] } ], "protein_names": [ { "name": "MARVEL domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5E9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC781494", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E9", "locus": {} } ], "crossref": [ { "id": "IPR008253", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008253", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR17068", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17068", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR17068:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17068:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01284", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01284", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5E9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5E9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSRRIIPEEDDVDTLCYFLRLPQVISICLAFSLVASMGNERGAVGNWCLAIWCLCFTVTVFISMYECFYCDWILPFFWYKLHITYACYATLFCLLTSIMYPIFYVQYLPYGPSRDRAIAASAFSCIACVLYAIDVAYTWKHYKFKNIPCYVHTLPGLLKILESAVACVIFVFISNTSLYLHQPALKWCVVVYSICFVQVAVAMLLKLSGWENRLPLWLPIFHLGQTMLSFLLYVSAMVLWPLYQFDEKLGGQPHWYSDMSCVDELTDYGCVWDQRLAVAILTAINLLMYVADLVYWTRQVL", "length": 302, "header": "tr|A0ABI0P5E9-1|A0ABI0P5E9_BOVIN Isoform 1 of MARVEL domain-containing protein OS=Bos taurus OX=9913 GN=LOC781494 PE=3 SV=1 CANONICAL=A0ABI0P5E9-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5E9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E9/entry#A0ABI0P5E9-1", "sequence": { "sequence": "MSSRRIIPEEDDVDTLCYFLRLPQVISICLAFSLVASMGNERGAVGNWCLAIWCLCFTVTVFISMYECFYCDWILPFFWYKLHITYACYATLFCLLTSIMYPIFYVQYLPYGPSRDRAIAASAFSCIACVLYAIDVAYTWKHYKFKNIPCYVHTLPGLLKILESAVACVIFVFISNTSLYLHQPALKWCVVVYSICFVQVAVAMLLKLSGWENRLPLWLPIFHLGQTMLSFLLYVSAMVLWPLYQFDEKLGGQPHWYSDMSCVDELTDYGCVWDQRLAVAILTAINLLMYVADLVYWTRQVL", "length": 302, "header": "tr|A0ABI0P5E9-1|A0ABI0P5E9_BOVIN Isoform 1 of MARVEL domain-containing protein OS=Bos taurus OX=9913 GN=LOC781494 PE=3 SV=1 CANONICAL=A0ABI0P5E9-1" }, "locus": { "chromosome": "21", "start_pos": 19765947, "end_pos": 19765042, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000149807.1", "url": "https://www.ensembl.org/id/ENSBTAT00000149807.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106622.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106622.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5E9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 176, "end_pos": 178, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5E9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5E9" }, { "id": "PS51225", "database": "PROSITE", "url": "https://prosite.expasy.org/PS51225" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "MARVEL", "eco_id": "ECO_0000259", "start_pos": 12, "end_pos": 144, "start_aa": "Asp", "end_aa": "Lys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 176, "end_pos": 178 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5F2-1", "uniprot_ac": "A0ABI0P5F2", "uniprot_id": "A0ABI0P5F2_BOVIN", "mass": { "chemical_mass": 11052.0, "monoisotopic_mass": 11052.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F2/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F2", "locus": {} } ], "crossref": [ { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5F2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5F2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "EAEVTQTPRHLIKTTGQTATLRCSPMSGHSSVSWYQQAQSQGPQLIFEFYETLQRAKGNFSNRFLAKQFPDFSSELNVNSLDQTDSALYLCASSLAQLC", "length": 99, "header": "tr|A0ABI0P5F2-1|A0ABI0P5F2_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5F2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5F2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F2/entry#A0ABI0P5F2-1", "sequence": { "sequence": "EAEVTQTPRHLIKTTGQTATLRCSPMSGHSSVSWYQQAQSQGPQLIFEFYETLQRAKGNFSNRFLAKQFPDFSSELNVNSLDQTDSALYLCASSLAQLC", "length": 99, "header": "tr|A0ABI0P5F2-1|A0ABI0P5F2_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5F2-1" }, "locus": { "chromosome": "4", "start_pos": 105738966, "end_pos": 105738670, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000151777.1", "url": "https://www.ensembl.org/id/ENSBTAT00000151777.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106263.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106263.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5F2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 59, "end_pos": 61, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5F2" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 2, "end_pos": 99, "start_aa": "Ala", "end_aa": "Cys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 59, "end_pos": 61 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5G4-1", "uniprot_ac": "A0ABI0P5G4", "uniprot_id": "A0ABI0P5G4_BOVIN", "mass": { "chemical_mass": 60882.0, "monoisotopic_mass": 60882.0 }, "refseq": { "ac": "XP_059740302", "name": "zinc finger protein 280B-like", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740302" }, "gene_names": [ { "name": "LOC132344679", "type": "recommended", "evidence": [ { "id": "A0ABI0P5G4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4" } ] }, { "name": "LOC132344679", "type": "synonym", "evidence": [ { "id": "XP_059740302", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740302" } ] } ], "protein_names": [ { "name": "C2H2-type domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5G4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4/entry#names_and_taxonomy" } ] }, { "name": "zinc finger protein 280B-like", "type": "synonym", "evidence": [ { "id": "XP_059740302", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740302" } ] } ], "function": [ { "annotation": "May function as a transcription factor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4#function" }, { "database": "UniProtKB", "id": "ARBA00003729", "url": "https://www.uniprot.org/uniprotkb/ARBA00003729#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC132344679", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4", "locus": {} } ], "crossref": [ { "id": "132344679", "url": "https://www.ncbi.nlm.nih.gov/gene/132344679", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025243", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025243", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050527", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050527", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR24388", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24388", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24388:SF56", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24388:SF56", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13836", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13836", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_059740302", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740302", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P5G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5G4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPPWMSCEEEQEPEPQKSEGETKLVNDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVISNILNRVTPGSCSRRNRCGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPIIIESLSKADSKNISPQIMPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRVSTSETNSTSPKRPTLSDGVIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTAFPKDNVHCKPVSPVGGNVLTKTDFPSVSSQNKFADPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTAFKCHSCLKVLKNVEFMNHMKHHLELERLRGDSWKYHTTCQHCHRQFPTPFQLQCHIESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAHFRAYHGNTKNLLCPFCLQIFKTEALYICHYRQHWAKRFHQCSKCRLQFLTCKEKREHKTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPGLVEVASITVNASDSEPSPPKSKSRRSKKPG", "length": 543, "header": "tr|A0ABI0P5G4-1|A0ABI0P5G4_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN=LOC132344679 PE=4 SV=1 CANONICAL=A0ABI0P5G4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5G4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4/entry#A0ABI0P5G4-1", "sequence": { "sequence": "MEPPWMSCEEEQEPEPQKSEGETKLVNDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVISNILNRVTPGSCSRRNRCGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPIIIESLSKADSKNISPQIMPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRVSTSETNSTSPKRPTLSDGVIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTAFPKDNVHCKPVSPVGGNVLTKTDFPSVSSQNKFADPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTAFKCHSCLKVLKNVEFMNHMKHHLELERLRGDSWKYHTTCQHCHRQFPTPFQLQCHIESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAHFRAYHGNTKNLLCPFCLQIFKTEALYICHYRQHWAKRFHQCSKCRLQFLTCKEKREHKTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPGLVEVASITVNASDSEPSPPKSKSRRSKKPG", "length": 543, "header": "tr|A0ABI0P5G4-1|A0ABI0P5G4_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN=LOC132344679 PE=4 SV=1 CANONICAL=A0ABI0P5G4-1" }, "locus": { "chromosome": "Y", "start_pos": 30536998, "end_pos": 30535370, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000141972.1", "url": "https://www.ensembl.org/id/ENSBTAT00000141972.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106647.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106647.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 68, "start_aa": "Thr", "end_pos": 68, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr68", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Thr", "end_pos": 96, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr96", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 131, "end_pos": 133, "annotation": "n_glycosylation_sequon" }, { "start_pos": 184, "end_pos": 186, "annotation": "n_glycosylation_sequon" }, { "start_pos": 523, "end_pos": 525, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5G4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5G4" }, { "id": "PS50157", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50157" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "C2H2-type", "eco_id": "ECO_0000259", "start_pos": 343, "end_pos": 371, "start_aa": "Thr", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 68, 96 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 131, "end_pos": 133 }, { "start_pos": 184, "end_pos": 186 }, { "start_pos": 523, "end_pos": 525 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5H1-1", "uniprot_ac": "A0ABI0P5H1", "uniprot_id": "A0ABI0P5H1_BOVIN", "mass": { "chemical_mass": 14571.0, "monoisotopic_mass": 14571.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Splicing factor 3B subunit 6", "type": "recommended", "evidence": [ { "id": "A0ABI0P5H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1/entry#names_and_taxonomy" } ] }, { "name": "Pre-mRNA branch site protein p14", "type": "synonym", "evidence": [ { "id": "A0ABI0P5H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1/entry#names_and_taxonomy" } ] }, { "name": "SF3b 14 kDa subunit", "type": "synonym", "evidence": [ { "id": "A0ABI0P5H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1", "locus": {} } ], "crossref": [ { "id": "cd12241", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12241", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR034150", "url": "https://www.ebi.ac.uk/interpro/entry/IPR034150", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050374", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050374", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23003", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23003", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00076", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00076", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5H1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5H1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAMQAAKRANIRLPPEVNQILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVIYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK", "length": 125, "header": "tr|A0ABI0P5H1-1|A0ABI0P5H1_BOVIN Isoform 1 of Splicing factor 3B subunit 6 OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5H1-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5H1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1/entry#A0ABI0P5H1-1", "sequence": { "sequence": "MAMQAAKRANIRLPPEVNQILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVIYEDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK", "length": 125, "header": "tr|A0ABI0P5H1-1|A0ABI0P5H1_BOVIN Isoform 1 of Splicing factor 3B subunit 6 OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5H1-1" }, "locus": { "chromosome": "15", "start_pos": 63331135, "end_pos": 63330761, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000137542.1", "url": "https://www.ensembl.org/id/ENSBTAT00000137542.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106991.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106991.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "mRNA processing", "id": "GO:0006397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006397", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1" } ], "pmid": "" }, { "name": "RNA splicing", "id": "GO:0008380", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008380", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H1" }, { "id": "PS50102", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50102" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "RRM", "eco_id": "ECO_0000259", "start_pos": 19, "end_pos": 94, "start_aa": "Gln", "end_aa": "Ala", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5H5-1", "uniprot_ac": "A0ABI0P5H5", "uniprot_id": "A0ABI0P5H5_BOVIN", "mass": { "chemical_mass": 60966.0, "monoisotopic_mass": 60966.0 }, "refseq": { "ac": "XP_059740345", "name": "zinc finger protein 280B-like", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740345" }, "gene_names": [ { "name": "LOC132344717", "type": "recommended", "evidence": [ { "id": "A0ABI0P5H5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5" } ] }, { "name": "LOC132344717", "type": "synonym", "evidence": [ { "id": "XP_059740345", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740345" } ] } ], "protein_names": [ { "name": "C2H2-type domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5H5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5/entry#names_and_taxonomy" } ] }, { "name": "zinc finger protein 280B-like", "type": "synonym", "evidence": [ { "id": "XP_059740345", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740345" } ] } ], "function": [ { "annotation": "May function as a transcription factor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5#function" }, { "database": "UniProtKB", "id": "ARBA00003729", "url": "https://www.uniprot.org/uniprotkb/ARBA00003729#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC132344717", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5", "locus": {} } ], "crossref": [ { "id": "132344717", "url": "https://www.ncbi.nlm.nih.gov/gene/132344717", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025243", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025243", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050527", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050527", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR24388", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24388", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24388:SF56", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24388:SF56", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13836", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13836", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_059740345", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740345", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P5H5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5H5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPPWMSCEEEQEPEPQKSEGETKLVNDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVISNILNRVTPGSCSRRNRYGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPIIIEPLSKADSKNISPQIMPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRVSTSETNSTSPKRPTLSDGVIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTAFPKDNVHCKPVSPLGGNVLTKTDFPSVSSQNKFADPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTAFKCHSCLKVLKNVEFMNHMKHHLELERLRGDSWKYHTTCQHCHRQFPTPFQLQCHIESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAHFRAYHGNTKNLLCPFCLQIFKTEALYICHYRQHWAKRFHQCSKCRLQFLTCKEKREHKTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPGLVEVASITVNASDSEPSPPKSKSRRSKKPG", "length": 543, "header": "tr|A0ABI0P5H5-1|A0ABI0P5H5_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN=LOC132344717 PE=4 SV=1 CANONICAL=A0ABI0P5H5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5H5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5/entry#A0ABI0P5H5-1", "sequence": { "sequence": "MEPPWMSCEEEQEPEPQKSEGETKLVNDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVISNILNRVTPGSCSRRNRYGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPIIIEPLSKADSKNISPQIMPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRVSTSETNSTSPKRPTLSDGVIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTAFPKDNVHCKPVSPLGGNVLTKTDFPSVSSQNKFADPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTAFKCHSCLKVLKNVEFMNHMKHHLELERLRGDSWKYHTTCQHCHRQFPTPFQLQCHIESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAHFRAYHGNTKNLLCPFCLQIFKTEALYICHYRQHWAKRFHQCSKCRLQFLTCKEKREHKTQCHQMFKKPKQLEGLPPETKVVIQVSLEPLQPGLVEVASITVNASDSEPSPPKSKSRRSKKPG", "length": 543, "header": "tr|A0ABI0P5H5-1|A0ABI0P5H5_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN=LOC132344717 PE=4 SV=1 CANONICAL=A0ABI0P5H5-1" }, "locus": { "chromosome": "Y", "start_pos": 57698887, "end_pos": 57697259, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000136182.1", "url": "https://www.ensembl.org/id/ENSBTAT00000136182.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106159.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106159.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 68, "start_aa": "Thr", "end_pos": 68, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr68", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Thr", "end_pos": 96, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr96", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5H5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 131, "end_pos": 133, "annotation": "n_glycosylation_sequon" }, { "start_pos": 184, "end_pos": 186, "annotation": "n_glycosylation_sequon" }, { "start_pos": 523, "end_pos": 525, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5H5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5H5" }, { "id": "PS50157", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50157" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "C2H2-type", "eco_id": "ECO_0000259", "start_pos": 343, "end_pos": 371, "start_aa": "Thr", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 68, 96 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 131, "end_pos": 133 }, { "start_pos": 184, "end_pos": 186 }, { "start_pos": 523, "end_pos": 525 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5I5-1", "uniprot_ac": "A0ABI0P5I5", "uniprot_id": "A0ABI0P5I5_BOVIN", "mass": { "chemical_mass": 61096.0, "monoisotopic_mass": 61096.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "C2H2-type domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "May function as a transcription factor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5#function" }, { "database": "UniProtKB", "id": "ARBA00003729", "url": "https://www.uniprot.org/uniprotkb/ARBA00003729#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5", "locus": {} } ], "crossref": [ { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025243", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025243", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050527", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050527", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR24388", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24388", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24388:SF56", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24388:SF56", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13836", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13836", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5I5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5I5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPPWMSCEEEQEPEPQKSEGETKLVSDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVISNVLNRVTPGSCSRRNRYGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPIIIEPLSKADSKNISPQIVPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRLSTSETNSTSPKRPTLSDGIIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTAFPKDNVHCKPVSPLGGNVLTKTDFPSVSSQNKFADPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTVFKCHSCLKVLKNVEFMNHMKHHLELERLRCDSWKYHTTCQHCHRQFPTPFELQCHIESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAHFRAYHGNTKNLLCPFCLQIFKTEALYKCHYRQHWAKRFHQCSKCRLQFLTCKEKREHKTQCHQMFKKPKQLEGLPPERKVVIQVSLEPLQPGLVEVASITVNASDSEPSPPKSKSRRSKKPS", "length": 543, "header": "tr|A0ABI0P5I5-1|A0ABI0P5I5_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5I5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5I5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5/entry#A0ABI0P5I5-1", "sequence": { "sequence": "MEPPWMSCEEEQEPEPQKSEGETKLVSDEDAELILVGVEHVHEDDDVIFVGMTSNSKPVISNVLNRVTPGSCSRRNRYGHFRKDNAQKLQPVSHVTPTSEAKTVLPLSVSESRSTDSPIIIEPLSKADSKNISPQIVPNSFSELCSPLITFTSSLQHPVETAVSAGDMDKSPRVSKRLSTSETNSTSPKRPTLSDGIIGEHSLALSLSGTFHTVTTQQSTPDSVHNSLSHVQSGEPCPTAFPKDNVHCKPVSPLGGNVLTKTDFPSVSSQNKFADPTEGNLIVLLRDFYYGQHIGDGQPEPKTHTVFKCHSCLKVLKNVEFMNHMKHHLELERLRCDSWKYHTTCQHCHRQFPTPFELQCHIESVHTSQEPCTVCKICELSFEADQILLQHMKDNHKPGEMPYVCQVCSYRSSFFADVDAHFRAYHGNTKNLLCPFCLQIFKTEALYKCHYRQHWAKRFHQCSKCRLQFLTCKEKREHKTQCHQMFKKPKQLEGLPPERKVVIQVSLEPLQPGLVEVASITVNASDSEPSPPKSKSRRSKKPS", "length": 543, "header": "tr|A0ABI0P5I5-1|A0ABI0P5I5_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5I5-1" }, "locus": { "chromosome": "Y", "start_pos": 31903379, "end_pos": 31901751, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000137834.1", "url": "https://www.ensembl.org/id/ENSBTAT00000137834.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107218.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107218.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 68, "start_aa": "Thr", "end_pos": 68, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr68", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 96, "start_aa": "Thr", "end_pos": 96, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr96", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 131, "end_pos": 133, "annotation": "n_glycosylation_sequon" }, { "start_pos": 184, "end_pos": 186, "annotation": "n_glycosylation_sequon" }, { "start_pos": 523, "end_pos": 525, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I5" }, { "id": "PS50157", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50157" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "C2H2-type", "eco_id": "ECO_0000259", "start_pos": 343, "end_pos": 371, "start_aa": "Thr", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 68, 96 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 131, "end_pos": 133 }, { "start_pos": 184, "end_pos": 186 }, { "start_pos": 523, "end_pos": 525 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 2 }, { "field": "exact_o_linked_sites", "count": 2 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5I7-1", "uniprot_ac": "A0ABI0P5I7", "uniprot_id": "A0ABI0P5I7_BOVIN", "mass": { "chemical_mass": 12243.0, "monoisotopic_mass": 12243.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5I7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5I7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5I7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "HAGVTQDPRFQVLRTGQKATLTCTQDLGHNCMYWYRQDLGQGLRLIHYSVAAPNTVKGDIPEGYSVSRPSTKAFPLTLESANHSQTSVYFCASSYSTVLHGHLLSMQKNR", "length": 110, "header": "tr|A0ABI0P5I7-1|A0ABI0P5I7_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5I7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5I7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7/entry#A0ABI0P5I7-1", "sequence": { "sequence": "HAGVTQDPRFQVLRTGQKATLTCTQDLGHNCMYWYRQDLGQGLRLIHYSVAAPNTVKGDIPEGYSVSRPSTKAFPLTLESANHSQTSVYFCASSYSTVLHGHLLSMQKNR", "length": 110, "header": "tr|A0ABI0P5I7-1|A0ABI0P5I7_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5I7-1" }, "locus": { "chromosome": "4", "start_pos": 105692443, "end_pos": 105692114, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000150026.1", "url": "https://www.ensembl.org/id/ENSBTAT00000150026.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106854.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106854.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "T cell receptor complex", "id": "GO:0042101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 82, "end_pos": 84, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5I7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7" }, { "id": "SM00409", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM00409" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Immunoglobulin", "eco_id": "ECO_0000259", "start_pos": 8, "end_pos": 107, "start_aa": "Pro", "end_aa": "Gln", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P5I7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I7" }, { "id": "SM00406", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM00406" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Immunoglobulin V-set", "eco_id": "ECO_0000259", "start_pos": 18, "end_pos": 93, "start_aa": "Lys", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 82, "end_pos": 84 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5I9-1", "uniprot_ac": "A0ABI0P5I9", "uniprot_id": "A0ABI0P5I9_BOVIN", "mass": { "chemical_mass": 52348.0, "monoisotopic_mass": 52348.0 }, "refseq": {}, "gene_names": [ { "name": "FCRL4", "type": "recommended", "evidence": [ { "id": "A0ABI0P5I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I9" } ] } ], "protein_names": [ { "name": "Fc receptor like 4", "type": "synonym", "evidence": [ { "id": "A0ABI0P5I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5I9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "FCRL4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I9", "locus": {} } ], "crossref": [ { "id": "IPR003598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050488", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050488", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11481", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11481", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11481:SF64", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11481:SF64", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13895", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13895", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF13927", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13927", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5I9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5I9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "PTLWPYLFLFSPATVHKSVISVQPPWTTVFHGERVNLTCNGFHFYAQEKLQGYRWFSGKARPRETPGNTLEVRDSGQYRCQAPGSLPSNPVHLIFSSASLILQAPYSVFEGDELVLRCQKRGREKLAVVKYTWNRKIISGTDESFDLLIPKASLNNSGCYQCIGFLENAYVLRTSQTNIQIQELFSRPKLEVTDSQPIEGKPVNLSCGTRLPLERPDTRLHFVFLRDDGVMISNWSGSPDLQITAIWREDSGSYSCGAETLTGGIHKRSLPLQIDVQRIPVSGVLLETQPQEDEVIEGETLVLVCSVAKGTGNTTFSWHREDTRESLGQKSQRSQRAELEIPVIGESHARSYYCTADNGYGLIQSEAVNVTVRSIPGIKRGLVAGGTTGGSLSILLAVALLFYCWYQRKPGLCSLLPFANLHNLPLPQKPHSLQPWKLPHYHSPPHHPSANRWAHLLSSKGSFLNRCLV", "length": 469, "header": "tr|A0ABI0P5I9-1|A0ABI0P5I9_BOVIN Isoform 1 of Fc receptor like 4 OS=Bos taurus OX=9913 GN=FCRL4 PE=4 SV=1 CANONICAL=A0ABI0P5I9-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5I9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I9/entry#A0ABI0P5I9-1", "sequence": { "sequence": "PTLWPYLFLFSPATVHKSVISVQPPWTTVFHGERVNLTCNGFHFYAQEKLQGYRWFSGKARPRETPGNTLEVRDSGQYRCQAPGSLPSNPVHLIFSSASLILQAPYSVFEGDELVLRCQKRGREKLAVVKYTWNRKIISGTDESFDLLIPKASLNNSGCYQCIGFLENAYVLRTSQTNIQIQELFSRPKLEVTDSQPIEGKPVNLSCGTRLPLERPDTRLHFVFLRDDGVMISNWSGSPDLQITAIWREDSGSYSCGAETLTGGIHKRSLPLQIDVQRIPVSGVLLETQPQEDEVIEGETLVLVCSVAKGTGNTTFSWHREDTRESLGQKSQRSQRAELEIPVIGESHARSYYCTADNGYGLIQSEAVNVTVRSIPGIKRGLVAGGTTGGSLSILLAVALLFYCWYQRKPGLCSLLPFANLHNLPLPQKPHSLQPWKLPHYHSPPHHPSANRWAHLLSSKGSFLNRCLV", "length": 469, "header": "tr|A0ABI0P5I9-1|A0ABI0P5I9_BOVIN Isoform 1 of Fc receptor like 4 OS=Bos taurus OX=9913 GN=FCRL4 PE=4 SV=1 CANONICAL=A0ABI0P5I9-1" }, "locus": { "chromosome": "3", "start_pos": 12765284, "end_pos": 12748686, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000149831.1", "url": "https://www.ensembl.org/id/ENSBTAT00000149831.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106549.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106549.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 155, "end_pos": 157, "annotation": "n_glycosylation_sequon" }, { "start_pos": 204, "end_pos": 206, "annotation": "n_glycosylation_sequon" }, { "start_pos": 234, "end_pos": 236, "annotation": "n_glycosylation_sequon" }, { "start_pos": 313, "end_pos": 315, "annotation": "n_glycosylation_sequon" }, { "start_pos": 369, "end_pos": 371, "annotation": "n_glycosylation_sequon" }, { "start_pos": 36, "end_pos": 38, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5I9" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 12, "end_pos": 82, "start_aa": "Pro", "end_aa": "Ala", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 155, "end_pos": 157 }, { "start_pos": 204, "end_pos": 206 }, { "start_pos": 234, "end_pos": 236 }, { "start_pos": 313, "end_pos": 315 }, { "start_pos": 369, "end_pos": 371 }, { "start_pos": 36, "end_pos": 38 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5K6-1", "uniprot_ac": "A0ABI0P5K6", "uniprot_id": "A0ABI0P5K6_BOVIN", "mass": { "chemical_mass": 10694.0, "monoisotopic_mass": 10694.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Immunoglobulin V-set domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5K6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K6/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K6" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K6", "locus": {} } ], "crossref": [ { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR052051", "url": "https://www.ebi.ac.uk/interpro/entry/IPR052051", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR19433", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19433", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19433:SF132", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19433:SF132", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5K6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5K6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGLVIGVTVFLTLGTVINAKTTQPSSMDCAEGENVNLPCNHSTIGGDDYIYWYQQNPNQSPQYVIHGLRGTVNSSTGSLHIASDRKSSTLVLPQVTLRD", "length": 99, "header": "tr|A0ABI0P5K6-1|A0ABI0P5K6_BOVIN Isoform 1 of Immunoglobulin V-set domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5K6-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5K6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K6/entry#A0ABI0P5K6-1", "sequence": { "sequence": "MGLVIGVTVFLTLGTVINAKTTQPSSMDCAEGENVNLPCNHSTIGGDDYIYWYQQNPNQSPQYVIHGLRGTVNSSTGSLHIASDRKSSTLVLPQVTLRD", "length": 99, "header": "tr|A0ABI0P5K6-1|A0ABI0P5K6_BOVIN Isoform 1 of Immunoglobulin V-set domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5K6-1" }, "locus": { "chromosome": "10", "start_pos": 24928172, "end_pos": 24927430, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147276.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147276.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106462.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106462.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5K6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" }, { "start_pos": 73, "end_pos": 75, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5K6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5K6" }, { "id": "PF07686", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Immunoglobulin V-set", "eco_id": "ECO_0000259", "start_pos": 22, "end_pos": 68, "start_aa": "Thr", "end_aa": "Leu", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 40, "end_pos": 42 }, { "start_pos": 58, "end_pos": 60 }, { "start_pos": 73, "end_pos": 75 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5L4-1", "uniprot_ac": "A0ABI0P5L4", "uniprot_id": "A0ABI0P5L4_BOVIN", "mass": { "chemical_mass": 12554.0, "monoisotopic_mass": 12554.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5L4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5L4/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5L4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5L4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5L4", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5L4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5L4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5L4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5L4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "GALVSQQPRRAVSKSGASVTIECRALDFQASSMFWYRQFPKRGLVLMATSNEGTDATYEQGYNKDKFPISQPDRTFSSLMVTSVDPTDSGLYFCSARDTALGRDQRPRQESW", "length": 112, "header": "tr|A0ABI0P5L4-1|A0ABI0P5L4_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5L4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5L4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5L4/entry#A0ABI0P5L4-1", "sequence": { "sequence": "GALVSQQPRRAVSKSGASVTIECRALDFQASSMFWYRQFPKRGLVLMATSNEGTDATYEQGYNKDKFPISQPDRTFSSLMVTSVDPTDSGLYFCSARDTALGRDQRPRQESW", "length": 112, "header": "tr|A0ABI0P5L4-1|A0ABI0P5L4_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5L4-1" }, "locus": { "chromosome": "4", "start_pos": 105922472, "end_pos": 105922137, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139408.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139408.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106210.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106210.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5L4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5L4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5L4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5L4" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 2, "end_pos": 111, "start_aa": "Ala", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5M1-1", "uniprot_ac": "A0ABI0P5M1", "uniprot_id": "A0ABI0P5M1_BOVIN", "mass": { "chemical_mass": 9695.0, "monoisotopic_mass": 9695.0 }, "refseq": {}, "gene_names": [ { "name": "SPRR4", "type": "recommended", "evidence": [ { "id": "A0ABI0P5M1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M1" } ] } ], "protein_names": [ { "name": "Small proline rich protein 4", "type": "synonym", "evidence": [ { "id": "A0ABI0P5M1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M1/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5M1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "SPRR4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M1", "locus": {} } ], "crossref": [ { "id": "A0ABI0P5M1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5M1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPTKRTRDTCQTMSSQQHQQQQCLPQQIQQQQVKQPCQPPPVKCQEMCAPKTKDPCAPQAKKQCPPKGTAIPAQQKCPATQQAPKSK", "length": 87, "header": "tr|A0ABI0P5M1-1|A0ABI0P5M1_BOVIN Isoform 1 of Small proline rich protein 4 OS=Bos taurus OX=9913 GN=SPRR4 PE=4 SV=1 CANONICAL=A0ABI0P5M1-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5M1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5M1/entry#A0ABI0P5M1-1", "sequence": { "sequence": "MPTKRTRDTCQTMSSQQHQQQQCLPQQIQQQQVKQPCQPPPVKCQEMCAPKTKDPCAPQAKKQCPPKGTAIPAQQKCPATQQAPKSK", "length": 87, "header": "tr|A0ABI0P5M1-1|A0ABI0P5M1_BOVIN Isoform 1 of Small proline rich protein 4 OS=Bos taurus OX=9913 GN=SPRR4 PE=4 SV=1 CANONICAL=A0ABI0P5M1-1" }, "locus": { "chromosome": "3", "start_pos": 17772356, "end_pos": 17771031, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000064747.4", "url": "https://www.ensembl.org/id/ENSBTAT00000064747.4" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106488.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106488.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5Q1-1", "uniprot_ac": "A0ABI0P5Q1", "uniprot_id": "A0ABI0P5Q1_BOVIN", "mass": { "chemical_mass": 29339.0, "monoisotopic_mass": 29339.0 }, "refseq": { "ac": "NP_001179634", "name": "tetratricopeptide repeat protein 33", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001179634" }, "gene_names": [ { "name": "TTC33", "type": "recommended", "evidence": [ { "id": "A0ABI0P5Q1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q1" } ] }, { "name": "TTC33", "type": "synonym", "evidence": [ { "id": "NP_001179634", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001179634" } ] } ], "protein_names": [ { "name": "Tetratricopeptide repeat domain 33", "type": "synonym", "evidence": [ { "id": "A0ABI0P5Q1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q1/entry#names_and_taxonomy" } ] }, { "name": "tetratricopeptide repeat protein 33", "type": "synonym", "evidence": [ { "id": "NP_001179634", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001179634" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Q1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "TTC33", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q1", "locus": { "chromosome": "20", "start_pos": 33732944, "end_pos": 33708599, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000000012", "url": "https://www.ensembl.org/id/ENSBTAG00000000012" } ] } } ], "crossref": [ { "id": "531278", "url": "https://www.ncbi.nlm.nih.gov/gene/531278", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR011990", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011990", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019734", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019734", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR052658", "url": "https://www.ebi.ac.uk/interpro/entry/IPR052658", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:531278", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:531278", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR15544", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15544", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15544:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15544:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "NP_001179634", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001179634", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P5Q1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5Q1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASFGWKRKIGEKVSKVTSQQFEAEAADEKDAVGKDEGNWLHAVKRRKESLLEGCAEKSKQLKDEGATLAENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAVQRNPHSWESWQTLGRAQLGLGEIVLAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKVAERIKKSEVPAEVTHFSPKSIPDYDFESDEIVAVCAAIAEKQKTVAANKTMVIVSASGTVETVTEKEDGAAPPDASVFIKAR", "length": 262, "header": "tr|A0ABI0P5Q1-1|A0ABI0P5Q1_BOVIN Isoform 1 of Tetratricopeptide repeat domain 33 OS=Bos taurus OX=9913 GN=TTC33 PE=4 SV=1 CANONICAL=A0ABI0P5Q1-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5Q1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q1/entry#A0ABI0P5Q1-1", "sequence": { "sequence": "MASFGWKRKIGEKVSKVTSQQFEAEAADEKDAVGKDEGNWLHAVKRRKESLLEGCAEKSKQLKDEGATLAENKRYREAIQKWDEALQLTPNDATLYEMKSQVLMSLHEMFPAVHAAEMAVQRNPHSWESWQTLGRAQLGLGEIVLAIRSFQVALHIYPMNPEIWKEDLSWARTLQEQQKVAERIKKSEVPAEVTHFSPKSIPDYDFESDEIVAVCAAIAEKQKTVAANKTMVIVSASGTVETVTEKEDGAAPPDASVFIKAR", "length": 262, "header": "tr|A0ABI0P5Q1-1|A0ABI0P5Q1_BOVIN Isoform 1 of Tetratricopeptide repeat domain 33 OS=Bos taurus OX=9913 GN=TTC33 PE=4 SV=1 CANONICAL=A0ABI0P5Q1-1" }, "locus": { "chromosome": "20", "start_pos": 33732547, "end_pos": 33710748, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000154901.1", "url": "https://www.ensembl.org/id/ENSBTAT00000154901.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106395.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106395.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:531278", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:531278", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 228, "end_pos": 230, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 228, "end_pos": 230 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5Q2-1", "uniprot_ac": "A0ABI0P5Q2", "uniprot_id": "A0ABI0P5Q2_BOVIN", "mass": { "chemical_mass": 16718.0, "monoisotopic_mass": 16718.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "UBC core domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q2/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Q2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q2", "locus": {} } ], "crossref": [ { "id": "cd23792", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd23792", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000608", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000608", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016135", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016135", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023313", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023313", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR24068", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24068", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00179", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00179", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5Q2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5Q2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALKWINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKLPKVAFTTRIYHPNINSNGSICLNILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIAQMYKTDRDKYNRISREWPQKYAM", "length": 147, "header": "tr|A0ABI0P5Q2-1|A0ABI0P5Q2_BOVIN Isoform 1 of UBC core domain-containing protein OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P5Q2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5Q2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q2/entry#A0ABI0P5Q2-1", "sequence": { "sequence": "MALKWINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKLPKVAFTTRIYHPNINSNGSICLNILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIAQMYKTDRDKYNRISREWPQKYAM", "length": 147, "header": "tr|A0ABI0P5Q2-1|A0ABI0P5Q2_BOVIN Isoform 1 of UBC core domain-containing protein OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P5Q2-1" }, "locus": { "chromosome": "Y", "start_pos": 24796793, "end_pos": 24796353, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000141739.1", "url": "https://www.ensembl.org/id/ENSBTAT00000141739.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106262.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106262.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Q2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q2" } ], "pmid": "" }, { "name": "transferase activity", "id": "GO:0016740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016740", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Q2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 41, "end_pos": 43, "annotation": "n_glycosylation_sequon" }, { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5Q2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q2" }, { "id": "PS50127", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50127" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "UBC core", "eco_id": "ECO_0000259", "start_pos": 1, "end_pos": 147, "start_aa": "Met", "end_aa": "Met", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 41, "end_pos": 43 }, { "start_pos": 81, "end_pos": 83 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5Q5-1", "uniprot_ac": "A0ABI0P5Q5", "uniprot_id": "A0ABI0P5Q5_BOVIN", "mass": { "chemical_mass": 29988.0, "monoisotopic_mass": 29988.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "SEA domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q5/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Q5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q5", "locus": {} } ], "crossref": [ { "id": "IPR000082", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000082", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028850", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028850", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036364", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036364", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR14672", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14672", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14672:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14672:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01390", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01390", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5Q5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5Q5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "RNSGHTAQFSSRVDSSMVKQVFLDKTLNASSHWLGATYQLTDVHVTEPSIHLPTDQPTTTPSFQKVQLNFTVTNLFYSQDMKQPDTPKYQRNKRNIEDALNQLFRNSSIKTHFSDCEVSAFRSVPPSNHTGVNAQCNFAFLARSPYQVVIYEEFLRLTKNGTQLQNFTLDRNSLLVDGYSPNRNDVVTENSDLPFWAIILICLAGLLVLIMGLISFFLVSKEVLFSYYQVVRAFYILEGYVLCGDVFCRYFLLVCEGFAFSFS", "length": 263, "header": "tr|A0ABI0P5Q5-1|A0ABI0P5Q5_BOVIN Isoform 1 of SEA domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5Q5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5Q5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q5/entry#A0ABI0P5Q5-1", "sequence": { "sequence": "RNSGHTAQFSSRVDSSMVKQVFLDKTLNASSHWLGATYQLTDVHVTEPSIHLPTDQPTTTPSFQKVQLNFTVTNLFYSQDMKQPDTPKYQRNKRNIEDALNQLFRNSSIKTHFSDCEVSAFRSVPPSNHTGVNAQCNFAFLARSPYQVVIYEEFLRLTKNGTQLQNFTLDRNSLLVDGYSPNRNDVVTENSDLPFWAIILICLAGLLVLIMGLISFFLVSKEVLFSYYQVVRAFYILEGYVLCGDVFCRYFLLVCEGFAFSFS", "length": 263, "header": "tr|A0ABI0P5Q5-1|A0ABI0P5Q5_BOVIN Isoform 1 of SEA domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5Q5-1" }, "locus": { "chromosome": "7", "start_pos": 13207271, "end_pos": 13198934, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139164.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139164.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106811.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106811.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 106, "end_pos": 108, "annotation": "n_glycosylation_sequon" }, { "start_pos": 128, "end_pos": 130, "annotation": "n_glycosylation_sequon" }, { "start_pos": 160, "end_pos": 162, "annotation": "n_glycosylation_sequon" }, { "start_pos": 166, "end_pos": 168, "annotation": "n_glycosylation_sequon" }, { "start_pos": 28, "end_pos": 30, "annotation": "n_glycosylation_sequon" }, { "start_pos": 69, "end_pos": 71, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Q5" }, { "id": "PS50024", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50024" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "SEA", "eco_id": "ECO_0000259", "start_pos": 62, "end_pos": 181, "start_aa": "Ser", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 106, "end_pos": 108 }, { "start_pos": 128, "end_pos": 130 }, { "start_pos": 160, "end_pos": 162 }, { "start_pos": 166, "end_pos": 168 }, { "start_pos": 28, "end_pos": 30 }, { "start_pos": 69, "end_pos": 71 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5S3-1", "uniprot_ac": "A0ABI0P5S3", "uniprot_id": "A0ABI0P5S3_BOVIN", "mass": { "chemical_mass": 17046.0, "monoisotopic_mass": 17046.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P5S3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S3/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S3" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S3", "locus": {} } ], "crossref": [ { "id": "A0ABI0P5S3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5S3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTKSEILLHRDCSNSLKFKCTLLPLRPPKPVARPQRKEGILVRTFSMHHGVSLAGRLLPRPWTLKTSRPRTAPRGFPVSHSPEVLWDMQLLLTHSVPSLTGSSGQRVKHVQPPVLSSPFCTAREAGWKCLEACHAHILSLLGCLWVCRYSLL", "length": 152, "header": "tr|A0ABI0P5S3-1|A0ABI0P5S3_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5S3-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5S3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S3/entry#A0ABI0P5S3-1", "sequence": { "sequence": "MTKSEILLHRDCSNSLKFKCTLLPLRPPKPVARPQRKEGILVRTFSMHHGVSLAGRLLPRPWTLKTSRPRTAPRGFPVSHSPEVLWDMQLLLTHSVPSLTGSSGQRVKHVQPPVLSSPFCTAREAGWKCLEACHAHILSLLGCLWVCRYSLL", "length": 152, "header": "tr|A0ABI0P5S3-1|A0ABI0P5S3_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5S3-1" }, "locus": { "chromosome": "Y", "start_pos": 42639643, "end_pos": 42639188, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000136341.1", "url": "https://www.ensembl.org/id/ENSBTAT00000136341.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106988.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106988.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5S8-1", "uniprot_ac": "A0ABI0P5S8", "uniprot_id": "A0ABI0P5S8_BOVIN", "mass": { "chemical_mass": 35004.0, "monoisotopic_mass": 35004.0 }, "refseq": { "ac": "NP_001377336", "name": "olfactory receptor family 4 subfamily F member 1D", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377336" }, "gene_names": [ { "name": "OR4F1D", "type": "recommended", "evidence": [ { "id": "A0ABI0P5S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8" } ] }, { "name": "OR4F1D", "type": "synonym", "evidence": [ { "id": "NP_001377336", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377336" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P5S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 4F3/4F16/4F29", "type": "synonym", "evidence": [ { "id": "NP_001377336", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377336" } ] }, { "name": "olfactory receptor family 4 subfamily F member 1D", "type": "synonym", "evidence": [ { "id": "NP_001377336", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377336" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377336", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377336" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR4F1D", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8", "locus": {} } ], "crossref": [ { "id": "cd15226", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15226", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "784925", "url": "https://www.ncbi.nlm.nih.gov/gene/784925", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050427", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050427", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377336", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377336", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P5S8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5S8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDGGNHSVSEFVFLGLTYSWEFQLLLLVFSSVLNVASMTGNILIVFSVTTDPHLHSPMYFLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAFDRYVAICKPLHYLSIMSPRMCILFLAAAWALGVSHSLFQLAFIVNLPFCGPNVLDSFYCDLPRLLRLACTDTYRLQFMVTGNSGFICVSSFFILLISYMFILLTVWKRSSGGSPKALSTLSAHITVVILFFGPTMFVYTWPHPNSQMDKFLALSDAVLTPFLNPVIYTFRNKEMKVAMKRAFRPFVIFRKIS", "length": 311, "header": "tr|A0ABI0P5S8-1|A0ABI0P5S8_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4F1D PE=3 SV=1 CANONICAL=A0ABI0P5S8-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5S8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8/entry#A0ABI0P5S8-1", "sequence": { "sequence": "MDGGNHSVSEFVFLGLTYSWEFQLLLLVFSSVLNVASMTGNILIVFSVTTDPHLHSPMYFLLASLSFIDLGACSVTSPKMIYDLFRKRKVISFGGCIAQIFFIHVIGGVEMVLLIAMAFDRYVAICKPLHYLSIMSPRMCILFLAAAWALGVSHSLFQLAFIVNLPFCGPNVLDSFYCDLPRLLRLACTDTYRLQFMVTGNSGFICVSSFFILLISYMFILLTVWKRSSGGSPKALSTLSAHITVVILFFGPTMFVYTWPHPNSQMDKFLALSDAVLTPFLNPVIYTFRNKEMKVAMKRAFRPFVIFRKIS", "length": 311, "header": "tr|A0ABI0P5S8-1|A0ABI0P5S8_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4F1D PE=3 SV=1 CANONICAL=A0ABI0P5S8-1" }, "locus": { "chromosome": "10", "start_pos": 27863689, "end_pos": 27862757, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144809.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144809.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107382.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107382.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5S8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5S8" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 40, "end_pos": 286, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5T4-1", "uniprot_ac": "A0ABI0P5T4", "uniprot_id": "A0ABI0P5T4_BOVIN", "mass": { "chemical_mass": 54194.0, "monoisotopic_mass": 54194.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Envelope protein syncytin-rum1", "type": "recommended", "evidence": [ { "id": "A0ABI0P5T4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T4/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5T4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T4", "locus": {} } ], "crossref": [ { "id": "IPR018154", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018154", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR10424", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10424", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10424:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10424:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00429", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00429", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5T4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5T4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSLIIYVSLLLLTPNILSLPLDPQDNVFLSWAHSYAAFHNPSNCWVCGALPSSSVEGFPWWTSPLQDKDFLQVCEYLRQQSRAMPLLHLMTSTNPKMDWCNTLYSNYGHNVTFNFDYTLSRFNDYFATYKENRSRSNGFLPDIYQIWDEVTWLTPEKGHLISTASICWEQTEPSPKVSQQLNYNDWKQMGYLSQETCNVIIPVFSNPSSGSPFVWPGTNWDWISQSRWLAPNGTYWICGSYLWAWLPPGWIGRCTLGLAFTHGFIFSELPEKPANLPHLRTRWTRSVFYWYDYLAAAFVPSLGTTDVMLRVDALTNFTQQALQDSQKAISALNAEQAQIRKVVLQNRLALDILTAAQGGTCAIIHTQCCTYIPDMSTNVTHFTNHMNKMIRAMDTPEASIASLWKTLTNSPWWTTILITIILVVLFLLFAPCICNCITGFVSSRMKAFKLQMVAQTPATAVASSSYYLGPLDQISSI", "length": 477, "header": "tr|A0ABI0P5T4-1|A0ABI0P5T4_BOVIN Isoform 1 of Envelope protein syncytin-rum1 OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5T4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5T4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T4/entry#A0ABI0P5T4-1", "sequence": { "sequence": "MSLIIYVSLLLLTPNILSLPLDPQDNVFLSWAHSYAAFHNPSNCWVCGALPSSSVEGFPWWTSPLQDKDFLQVCEYLRQQSRAMPLLHLMTSTNPKMDWCNTLYSNYGHNVTFNFDYTLSRFNDYFATYKENRSRSNGFLPDIYQIWDEVTWLTPEKGHLISTASICWEQTEPSPKVSQQLNYNDWKQMGYLSQETCNVIIPVFSNPSSGSPFVWPGTNWDWISQSRWLAPNGTYWICGSYLWAWLPPGWIGRCTLGLAFTHGFIFSELPEKPANLPHLRTRWTRSVFYWYDYLAAAFVPSLGTTDVMLRVDALTNFTQQALQDSQKAISALNAEQAQIRKVVLQNRLALDILTAAQGGTCAIIHTQCCTYIPDMSTNVTHFTNHMNKMIRAMDTPEASIASLWKTLTNSPWWTTILITIILVVLFLLFAPCICNCITGFVSSRMKAFKLQMVAQTPATAVASSSYYLGPLDQISSI", "length": 477, "header": "tr|A0ABI0P5T4-1|A0ABI0P5T4_BOVIN Isoform 1 of Envelope protein syncytin-rum1 OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5T4-1" }, "locus": { "chromosome": "Y", "start_pos": 50330756, "end_pos": 50329326, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144502.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144502.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107018.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107018.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 110, "end_pos": 112, "annotation": "n_glycosylation_sequon" }, { "start_pos": 132, "end_pos": 134, "annotation": "n_glycosylation_sequon" }, { "start_pos": 232, "end_pos": 234, "annotation": "n_glycosylation_sequon" }, { "start_pos": 316, "end_pos": 318, "annotation": "n_glycosylation_sequon" }, { "start_pos": 378, "end_pos": 380, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 110, "end_pos": 112 }, { "start_pos": 132, "end_pos": 134 }, { "start_pos": 232, "end_pos": 234 }, { "start_pos": 316, "end_pos": 318 }, { "start_pos": 378, "end_pos": 380 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5T5-1", "uniprot_ac": "A0ABI0P5T5", "uniprot_id": "A0ABI0P5T5_BOVIN", "mass": { "chemical_mass": 17200.0, "monoisotopic_mass": 17200.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P5T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T5/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T5", "locus": {} } ], "crossref": [ { "id": "A0ABI0P5T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5T5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTKSEILLQRDCSNSLRCRRTLLPLRPPKPVARPQRKEELHVRTFSTHHGVSLAGLLLPRPWTLKTSRPQTAPRGFPVSHSPEVLWDMQLLLAHSIPSLTGSSQQRVKHVQPPVLSSPFCTAREAGWKCLEACHAHILSLLGCLWFCRYSLL", "length": 152, "header": "tr|A0ABI0P5T5-1|A0ABI0P5T5_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5T5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5T5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5T5/entry#A0ABI0P5T5-1", "sequence": { "sequence": "MTKSEILLQRDCSNSLRCRRTLLPLRPPKPVARPQRKEELHVRTFSTHHGVSLAGLLLPRPWTLKTSRPQTAPRGFPVSHSPEVLWDMQLLLAHSIPSLTGSSQQRVKHVQPPVLSSPFCTAREAGWKCLEACHAHILSLLGCLWFCRYSLL", "length": 152, "header": "tr|A0ABI0P5T5-1|A0ABI0P5T5_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5T5-1" }, "locus": { "chromosome": "Y", "start_pos": 24660296, "end_pos": 24659841, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000151042.1", "url": "https://www.ensembl.org/id/ENSBTAT00000151042.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106867.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106867.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5W4-1", "uniprot_ac": "A0ABI0P5W4", "uniprot_id": "A0ABI0P5W4_BOVIN", "mass": { "chemical_mass": 11979.0, "monoisotopic_mass": 11979.0 }, "refseq": { "ac": "XP_002697289", "name": "uncharacterized protein C6orf226 homolog", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002697289" }, "gene_names": [ { "name": "C23H6orf226", "type": "recommended", "evidence": [ { "id": "A0ABI0P5W4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5W4" } ] }, { "name": "C23H6orf226", "type": "synonym", "evidence": [ { "id": "XP_002697289", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002697289" } ] } ], "protein_names": [ { "name": "Peroxisomal membrane protein PEX14-like KPWE domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5W4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5W4/entry#names_and_taxonomy" } ] }, { "name": "uncharacterized protein C6orf226 homolog", "type": "synonym", "evidence": [ { "id": "XP_002697289", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002697289" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5W4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5W4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "C23H6orf226", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5W4", "locus": {} } ], "crossref": [ { "id": "100140540", "url": "https://www.ncbi.nlm.nih.gov/gene/100140540", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR039995", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039995", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040554", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040554", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:100140540", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:100140540", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR40657", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40657", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR40657:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR40657:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF17733", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17733", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_002697289", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002697289", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P5W4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5W4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5W4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5W4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPLACRSESGPAPSPAESTQASVTLAQLLQLVQQGQELPGLERRQVAATLDEPTASRLPRIPKPWEAARSAEHPAPQFQTGDRGLADPPSGQRNRLEEPGSAVSEAPGPLQL", "length": 113, "header": "tr|A0ABI0P5W4-1|A0ABI0P5W4_BOVIN Isoform 1 of Peroxisomal membrane protein PEX14-like KPWE domain-containing protein OS=Bos taurus OX=9913 GN=C23H6orf226 PE=4 SV=1 CANONICAL=A0ABI0P5W4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5W4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5W4/entry#A0ABI0P5W4-1", "sequence": { "sequence": "MEPLACRSESGPAPSPAESTQASVTLAQLLQLVQQGQELPGLERRQVAATLDEPTASRLPRIPKPWEAARSAEHPAPQFQTGDRGLADPPSGQRNRLEEPGSAVSEAPGPLQL", "length": 113, "header": "tr|A0ABI0P5W4-1|A0ABI0P5W4_BOVIN Isoform 1 of Peroxisomal membrane protein PEX14-like KPWE domain-containing protein OS=Bos taurus OX=9913 GN=C23H6orf226 PE=4 SV=1 CANONICAL=A0ABI0P5W4-1" }, "locus": { "chromosome": "23", "start_pos": 16534799, "end_pos": 16534461, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000153811.1", "url": "https://www.ensembl.org/id/ENSBTAT00000153811.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106733.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106733.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:100140540", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:100140540", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5W4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5W4" }, { "id": "PF17733", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17733" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Peroxisomal membrane protein PEX14-like KPWE", "eco_id": "ECO_0000259", "start_pos": 23, "end_pos": 67, "start_aa": "Ser", "end_aa": "Glu", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5Y1-1", "uniprot_ac": "A0ABI0P5Y1", "uniprot_id": "A0ABI0P5Y1_BOVIN", "mass": { "chemical_mass": 35233.0, "monoisotopic_mass": 35233.0 }, "refseq": { "ac": "NP_001376734", "name": "olfactory receptor family 4 subfamily D member 2B", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376734" }, "gene_names": [ { "name": "OR4D2B", "type": "recommended", "evidence": [ { "id": "A0ABI0P5Y1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1" } ] }, { "name": "OR4D2B", "type": "synonym", "evidence": [ { "id": "NP_001376734", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376734" } ] } ], "protein_names": [ { "name": "Olfactory receptor family 4 subfamily D member 2B", "type": "synonym", "evidence": [ { "id": "A0ABI0P5Y1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 4D2", "type": "synonym", "evidence": [ { "id": "NP_001376734", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376734" } ] }, { "name": "olfactory receptor family 4 subfamily D member 2B", "type": "synonym", "evidence": [ { "id": "NP_001376734", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376734" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001376734", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376734" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR4D2B", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1", "locus": {} } ], "crossref": [ { "id": "cd15936", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15936", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "508468", "url": "https://www.ncbi.nlm.nih.gov/gene/508468", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050427", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050427", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001376734", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376734", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P5Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5Y1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASRNHTCMTEFVFLGLSQTQEIQLVLFLVFLFVYTTTVMGNLLIVVTVTSDSRLHTPMYFLLRNLAILDLCFSSVTAPKMLVDLRAEKKTISYQGCMTQVFFFHFLGGAMVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVGLVVTAWMVGFVHSISQLVLMLPLPFCGPNVLDNFYCDVPQVLRLACTDTSVLEFLMICNSGMLDVIWFLLLLVSYSVILVMLRSHSGQARRKAASTCTTHIIVVSMVFIPSIYLYARPFTSFSMDKAVSISHTVMTPMLNPMIYTLRNQEMQAAVKRLGKRWVLCKKE", "length": 311, "header": "tr|A0ABI0P5Y1-1|A0ABI0P5Y1_BOVIN Isoform 1 of Olfactory receptor family 4 subfamily D member 2B OS=Bos taurus OX=9913 GN=OR4D2B PE=3 SV=1 CANONICAL=A0ABI0P5Y1-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5Y1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1/entry#A0ABI0P5Y1-1", "sequence": { "sequence": "MASRNHTCMTEFVFLGLSQTQEIQLVLFLVFLFVYTTTVMGNLLIVVTVTSDSRLHTPMYFLLRNLAILDLCFSSVTAPKMLVDLRAEKKTISYQGCMTQVFFFHFLGGAMVFFLSVMAYDRLVAISRPLHYVTIMNTQLCVGLVVTAWMVGFVHSISQLVLMLPLPFCGPNVLDNFYCDVPQVLRLACTDTSVLEFLMICNSGMLDVIWFLLLLVSYSVILVMLRSHSGQARRKAASTCTTHIIVVSMVFIPSIYLYARPFTSFSMDKAVSISHTVMTPMLNPMIYTLRNQEMQAAVKRLGKRWVLCKKE", "length": 311, "header": "tr|A0ABI0P5Y1-1|A0ABI0P5Y1_BOVIN Isoform 1 of Olfactory receptor family 4 subfamily D member 2B OS=Bos taurus OX=9913 GN=OR4D2B PE=3 SV=1 CANONICAL=A0ABI0P5Y1-1" }, "locus": { "chromosome": "19", "start_pos": 8978228, "end_pos": 8977296, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152867.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152867.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106648.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106648.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5Y1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y1" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 41, "end_pos": 287, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5Y2-1", "uniprot_ac": "A0ABI0P5Y2", "uniprot_id": "A0ABI0P5Y2_BOVIN", "mass": { "chemical_mass": 13359.0, "monoisotopic_mass": 13359.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Immunoglobulin V-set domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P5Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y2/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Y2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y2", "locus": {} } ], "crossref": [ { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF111", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF111", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P5Y2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5Y2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDAEIYQIRFLLAEAGQDVTLECKQHLGYSAMYWYRQDPGQGLKLIYYSTVVKDIQRGDLSEGYSVSREKQELFPLTVKSAHTNQTAVYLCSGGTTVEHGHLSPVHKPHSSPTAPDTASL", "length": 120, "header": "tr|A0ABI0P5Y2-1|A0ABI0P5Y2_BOVIN Isoform 1 of Immunoglobulin V-set domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5Y2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5Y2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y2/entry#A0ABI0P5Y2-1", "sequence": { "sequence": "MDAEIYQIRFLLAEAGQDVTLECKQHLGYSAMYWYRQDPGQGLKLIYYSTVVKDIQRGDLSEGYSVSREKQELFPLTVKSAHTNQTAVYLCSGGTTVEHGHLSPVHKPHSSPTAPDTASL", "length": 120, "header": "tr|A0ABI0P5Y2-1|A0ABI0P5Y2_BOVIN Isoform 1 of Immunoglobulin V-set domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P5Y2-1" }, "locus": { "chromosome": "4", "start_pos": 106016157, "end_pos": 106015798, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000149200.1", "url": "https://www.ensembl.org/id/ENSBTAT00000149200.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106763.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106763.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Y2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 84, "end_pos": 86, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P5Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y2" }, { "id": "SM00406", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM00406" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Immunoglobulin V-set", "eco_id": "ECO_0000259", "start_pos": 18, "end_pos": 93, "start_aa": "Asp", "end_aa": "Gly", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 84, "end_pos": 86 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P5Y7-1", "uniprot_ac": "A0ABI0P5Y7", "uniprot_id": "A0ABI0P5Y7_BOVIN", "mass": { "chemical_mass": 34640.0, "monoisotopic_mass": 34640.0 }, "refseq": { "ac": "NP_001180013", "name": "barttin", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001180013" }, "gene_names": [ { "name": "BSND", "type": "recommended", "evidence": [ { "id": "A0ABI0P5Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y7" } ] }, { "name": "BSND", "type": "synonym", "evidence": [ { "id": "NP_001180013", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001180013" } ] } ], "protein_names": [ { "name": "Bartter syndrome, infantile, with sensorineural deafness (Barttin)", "type": "synonym", "evidence": [ { "id": "NP_001180013", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001180013" } ] }, { "name": "Barttin CLCNK type accessory subunit beta", "type": "synonym", "evidence": [ { "id": "A0ABI0P5Y7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y7/entry#names_and_taxonomy" } ] }, { "name": "barttin CLCNK type accessory beta subunit", "type": "synonym", "evidence": [ { "id": "NP_001180013", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001180013" } ] }, { "name": "barttin", "type": "synonym", "evidence": [ { "id": "NP_001180013", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001180013" } ] } ], "function": [ { "annotation": "Structure of a bovine CLC channel (CLC-K) using cryo-electron microscopy", "evidence": [ { "database": "RefSeq", "id": "NP_001180013", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001180013" }, { "database": "PubMed", "id": "28002411", "url": "https://glygen.org/publication/PubMed/28002411" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Y7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "BSND", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y7", "locus": {} } ], "crossref": [ { "id": "615670", "url": "https://www.ncbi.nlm.nih.gov/gene/615670", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR029181", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029181", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:615670", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:615670", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR28399", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28399", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR28399:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR28399:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15462", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15462", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001180013", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001180013", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P5Y7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P5Y7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTDEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGGVMVIGGVIWSMCQCYPKITFIPADSDFQGVLSTKAKALGLLESGFAAEMKSPQPPYVRLWEAAAYDQSLPDFSHIQMKVMSYSEDPRPLLDPEPGQRQPGASDGGESGPHDPQTWLEATVVIHRGSDQDEGEGDPSQGRLSPPTCPQGSAPLASFQDDLDVGSSEGSSPNPSPPEEAEPQPPPPESRTCRCQLDRFHDFALIDAPATEDAPPEKQRWEAAVPSSQQRSPRTKEEEEASDTGTEGPAQEEEDLYYGLPDSPGDPLPDKELGFEPEAQG", "length": 319, "header": "tr|A0ABI0P5Y7-1|A0ABI0P5Y7_BOVIN Isoform 1 of Barttin CLCNK type accessory subunit beta OS=Bos taurus OX=9913 GN=BSND PE=4 SV=1 CANONICAL=A0ABI0P5Y7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P5Y7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y7/entry#A0ABI0P5Y7-1", "sequence": { "sequence": "MTDEKTFRIGFIVLGLFLLALGTFLMSHDRPQVYGTFYAMGGVMVIGGVIWSMCQCYPKITFIPADSDFQGVLSTKAKALGLLESGFAAEMKSPQPPYVRLWEAAAYDQSLPDFSHIQMKVMSYSEDPRPLLDPEPGQRQPGASDGGESGPHDPQTWLEATVVIHRGSDQDEGEGDPSQGRLSPPTCPQGSAPLASFQDDLDVGSSEGSSPNPSPPEEAEPQPPPPESRTCRCQLDRFHDFALIDAPATEDAPPEKQRWEAAVPSSQQRSPRTKEEEEASDTGTEGPAQEEEDLYYGLPDSPGDPLPDKELGFEPEAQG", "length": 319, "header": "tr|A0ABI0P5Y7-1|A0ABI0P5Y7_BOVIN Isoform 1 of Barttin CLCNK type accessory subunit beta OS=Bos taurus OX=9913 GN=BSND PE=4 SV=1 CANONICAL=A0ABI0P5Y7-1" }, "locus": { "chromosome": "3", "start_pos": 91324220, "end_pos": 91314363, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152546.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152546.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107097.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107097.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Structure of a CLC chloride ion channel by cryo-electron microscopy.", "journal": "Nature", "date": "2017-01-26", "authors": "Park Eunyong, Campbell Ernest B, MacKinnon Roderick", "evidence": [ { "database": "RefSeq", "id": "NP_001180013", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001180013" } ], "reference": [ { "type": "PubMed", "id": "28002411", "url": "https://glygen.org/publication/PubMed/28002411" } ] } ], "pathway": [ { "id": "bta:615670", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:615670", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "chloride transport", "id": "GO:0006821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006821", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P5Y7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P5Y7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }, { "uniprot_canonical_ac": "A0ABI0P604-1", "uniprot_ac": "A0ABI0P604", "uniprot_id": "A0ABI0P604_BOVIN", "mass": { "chemical_mass": 14020.0, "monoisotopic_mass": 14020.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P604/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P604", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P604" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P604", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050150", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050150", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23267", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23267", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P604", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P604", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P604-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P604-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAWTPLLLPLLTLCTGSVVSYELTQLTSVSVALGQTAKITCSGELLDEQYTQWYQQKPGQAPKLVIYKDSKRRSGIPDQFSGSSSGKTAILTISGVRAEDEADYYCLSWDSGSYNVHSDTDRQGSETQ", "length": 128, "header": "tr|A0ABI0P604-1|A0ABI0P604_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P604-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P604-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P604/entry#A0ABI0P604-1", "sequence": { "sequence": "MAWTPLLLPLLTLCTGSVVSYELTQLTSVSVALGQTAKITCSGELLDEQYTQWYQQKPGQAPKLVIYKDSKRRSGIPDQFSGSSSGKTAILTISGVRAEDEADYYCLSWDSGSYNVHSDTDRQGSETQ", "length": 128, "header": "tr|A0ABI0P604-1|A0ABI0P604_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P604-1" }, "locus": { "chromosome": "17", "start_pos": 71088388, "end_pos": 71087844, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000146068.1", "url": "https://www.ensembl.org/id/ENSBTAT00000146068.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107126.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107126.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P604" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 9, "end_pos": 106, "start_aa": "Pro", "end_aa": "Cys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P612-1", "uniprot_ac": "A0ABI0P612", "uniprot_id": "A0ABI0P612_BOVIN", "mass": { "chemical_mass": 35167.0, "monoisotopic_mass": 35167.0 }, "refseq": { "ac": "NP_001376820", "name": "olfactory receptor family 9 subfamily K member 2F", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376820" }, "gene_names": [ { "name": "OR9K2F", "type": "recommended", "evidence": [ { "id": "A0ABI0P612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612" } ] }, { "name": "OR9K2F", "type": "synonym", "evidence": [ { "id": "NP_001376820", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376820" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor family 9 subfamily K member 2F", "type": "synonym", "evidence": [ { "id": "NP_001376820", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376820" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001376820", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376820" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P612", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P612", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR9K2F", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612", "locus": {} } ], "crossref": [ { "id": "511753", "url": "https://www.ncbi.nlm.nih.gov/gene/511753", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050516", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050516", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR26452", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26452", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001376820", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376820", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P612", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P612-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGDRGTSNYSDMTDFILVGFRVHPELHILLFLLFLLVYAMILLGNVGMMVIIITDPWLNTPMYFFLGNLSFIDLVYSSVIAPKAMINFWSVSKSISFAGCVTQLFLFVLFIVTEGFLLAVMAYDRFIAICNPLLYTVQMSTRLCAQLVAGSYFFGCISSILQTSMTFTLSFCASRAIDHFYCDTRPLQRLSCSDLFIRRMVSFTLSGLITLPTIIVIVISYLYIVSTVLKIPSTEGRKKAFSTCSSHLGVVSVLYGAVFFMYLTPDTFPELSKVASLCYTLLTPMLNPLIYSLRNKDVKEALNKLLEKKSTIL", "length": 313, "header": "tr|A0ABI0P612-1|A0ABI0P612_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR9K2F PE=3 SV=1 CANONICAL=A0ABI0P612-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P612-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612/entry#A0ABI0P612-1", "sequence": { "sequence": "MGDRGTSNYSDMTDFILVGFRVHPELHILLFLLFLLVYAMILLGNVGMMVIIITDPWLNTPMYFFLGNLSFIDLVYSSVIAPKAMINFWSVSKSISFAGCVTQLFLFVLFIVTEGFLLAVMAYDRFIAICNPLLYTVQMSTRLCAQLVAGSYFFGCISSILQTSMTFTLSFCASRAIDHFYCDTRPLQRLSCSDLFIRRMVSFTLSGLITLPTIIVIVISYLYIVSTVLKIPSTEGRKKAFSTCSSHLGVVSVLYGAVFFMYLTPDTFPELSKVASLCYTLLTPMLNPLIYSLRNKDVKEALNKLLEKKSTIL", "length": 313, "header": "tr|A0ABI0P612-1|A0ABI0P612_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR9K2F PE=3 SV=1 CANONICAL=A0ABI0P612-1" }, "locus": { "chromosome": "5", "start_pos": 59745986, "end_pos": 59745048, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000044007.5", "url": "https://www.ensembl.org/id/ENSBTAT00000044007.5" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107001.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107001.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P612", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P612", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P612", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 68, "end_pos": 70, "annotation": "n_glycosylation_sequon" }, { "start_pos": 8, "end_pos": 10, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P612" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 44, "end_pos": 291, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 68, "end_pos": 70 }, { "start_pos": 8, "end_pos": 10 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P650-1", "uniprot_ac": "A0ABI0P650", "uniprot_id": "A0ABI0P650_BOVIN", "mass": { "chemical_mass": 3337.0, "monoisotopic_mass": 3337.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P650", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P650/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P650", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P650" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P650", "locus": {} } ], "crossref": [ { "id": "A0ABI0P650", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P650", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P650-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P650-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAETQTLNFGPECLLQMCLDPEYGILMGF", "length": 30, "header": "tr|A0ABI0P650-1|A0ABI0P650_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P650-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P650-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P650/entry#A0ABI0P650-1", "sequence": { "sequence": "MAAETQTLNFGPECLLQMCLDPEYGILMGF", "length": 30, "header": "tr|A0ABI0P650-1|A0ABI0P650_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P650-1" }, "locus": { "chromosome": "3", "start_pos": 112481248, "end_pos": 112480652, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000141659.1", "url": "https://www.ensembl.org/id/ENSBTAT00000141659.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106445.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106445.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P654-1", "uniprot_ac": "A0ABI0P654", "uniprot_id": "A0ABI0P654_BOVIN", "mass": { "chemical_mass": 11104.0, "monoisotopic_mass": 11104.0 }, "refseq": {}, "gene_names": [ { "name": "TRBV27", "type": "recommended", "evidence": [ { "id": "A0ABI0P654", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P654" } ] } ], "protein_names": [ { "name": "T cell receptor beta variable 27", "type": "synonym", "evidence": [ { "id": "A0ABI0P654", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P654/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P654", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P654" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "TRBV27", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P654", "locus": {} } ], "crossref": [ { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF110", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF110", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P654", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P654", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P654-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P654-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "EADVTQSPRHRITETRTRVTLTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVGFIENGDIPDGYTASREEKPNFPLTLELASTNQTSLYLCASSESTV", "length": 98, "header": "tr|A0ABI0P654-1|A0ABI0P654_BOVIN Isoform 1 of T cell receptor beta variable 27 OS=Bos taurus OX=9913 GN=TRBV27 PE=4 SV=1 CANONICAL=A0ABI0P654-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P654-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P654/entry#A0ABI0P654-1", "sequence": { "sequence": "EADVTQSPRHRITETRTRVTLTCSQNMNHDAMYWYRQDPGLGPKLIYFSRNVGFIENGDIPDGYTASREEKPNFPLTLELASTNQTSLYLCASSESTV", "length": 98, "header": "tr|A0ABI0P654-1|A0ABI0P654_BOVIN Isoform 1 of T cell receptor beta variable 27 OS=Bos taurus OX=9913 GN=TRBV27 PE=4 SV=1 CANONICAL=A0ABI0P654-1" }, "locus": { "chromosome": "4", "start_pos": 106040032, "end_pos": 106039739, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000150296.1", "url": "https://www.ensembl.org/id/ENSBTAT00000150296.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107205.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107205.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P654", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P654" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 84, "end_pos": 86, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P654", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P654" }, { "id": "PF07686", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Immunoglobulin V-set", "eco_id": "ECO_0000259", "start_pos": 6, "end_pos": 93, "start_aa": "Gln", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 84, "end_pos": 86 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P669-1", "uniprot_ac": "A0ABI0P669", "uniprot_id": "A0ABI0P669_BOVIN", "mass": { "chemical_mass": 35554.0, "monoisotopic_mass": 35554.0 }, "refseq": { "ac": "NP_001377360", "name": "olfactory receptor family 7 subfamily A member 83", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377360" }, "gene_names": [ { "name": "OR7A83", "type": "recommended", "evidence": [ { "id": "A0ABI0P669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669" } ] }, { "name": "OR7A83", "type": "synonym", "evidence": [ { "id": "NP_001377360", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377360" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 7A17", "type": "synonym", "evidence": [ { "id": "NP_001377360", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377360" } ] }, { "name": "olfactory receptor family 7 subfamily A member 83", "type": "synonym", "evidence": [ { "id": "NP_001377360", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377360" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377360" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P669", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P669", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR7A83", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669", "locus": {} } ], "crossref": [ { "id": "cd15234", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15234", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "785624", "url": "https://www.ncbi.nlm.nih.gov/gene/785624", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48001", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48001", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377360", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P669", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P669-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEVGNQTCISEFILLGLSEEVLLQPLLFWFFLFMYLVTFIGNLLIILAIITNSHLHTPMYFFLFNLSFSDICFTSTTIPKMLWNIKTQSQVITYEGCIIQMYFFMLFGILDNILLTVMAYDRFVAICHPLQYLIIMNPKFCDLLLLTSWLVSVLDSLLHGLMILRLSFCTKLEIHHFFCELYEVIQLACSDTFLNDLMIYFASGVLVIVPLTGILFSYSKIVSSILKISSTRGKYKAFSTCVSHLSTVSLFYGTSLGVYLSSASTQNSRATAVASVMYTVVTPMLNPFIYSLKNKDIKQALKTLFSRETFLV", "length": 312, "header": "tr|A0ABI0P669-1|A0ABI0P669_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR7A83 PE=3 SV=1 CANONICAL=A0ABI0P669-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P669-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669/entry#A0ABI0P669-1", "sequence": { "sequence": "MEVGNQTCISEFILLGLSEEVLLQPLLFWFFLFMYLVTFIGNLLIILAIITNSHLHTPMYFFLFNLSFSDICFTSTTIPKMLWNIKTQSQVITYEGCIIQMYFFMLFGILDNILLTVMAYDRFVAICHPLQYLIIMNPKFCDLLLLTSWLVSVLDSLLHGLMILRLSFCTKLEIHHFFCELYEVIQLACSDTFLNDLMIYFASGVLVIVPLTGILFSYSKIVSSILKISSTRGKYKAFSTCVSHLSTVSLFYGTSLGVYLSSASTQNSRATAVASVMYTVVTPMLNPFIYSLKNKDIKQALKTLFSRETFLV", "length": 312, "header": "tr|A0ABI0P669-1|A0ABI0P669_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR7A83 PE=3 SV=1 CANONICAL=A0ABI0P669-1" }, "locus": { "chromosome": "7", "start_pos": 9224949, "end_pos": 9224014, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000146116.1", "url": "https://www.ensembl.org/id/ENSBTAT00000146116.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106927.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106927.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P669", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P669", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P669", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 65, "end_pos": 67, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P669", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P669" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 41, "end_pos": 290, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 }, { "start_pos": 65, "end_pos": 67 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P670-1", "uniprot_ac": "A0ABI0P670", "uniprot_id": "A0ABI0P670_BOVIN", "mass": { "chemical_mass": 10649.0, "monoisotopic_mass": 10649.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P670/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P670", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P670" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P670", "locus": {} } ], "crossref": [ { "id": "A0ABI0P670", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P670", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P670-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P670-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKISHLRSKGCVKVTKSWHLPVTRTDQQSSKRVGSTCHEQLYDMRLCSAFSHHLGQLHSTSHIGLIHVGTENKDLWAQLYVCTCLHVPPRAISM", "length": 94, "header": "tr|A0ABI0P670-1|A0ABI0P670_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P670-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P670-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P670/entry#A0ABI0P670-1", "sequence": { "sequence": "MKISHLRSKGCVKVTKSWHLPVTRTDQQSSKRVGSTCHEQLYDMRLCSAFSHHLGQLHSTSHIGLIHVGTENKDLWAQLYVCTCLHVPPRAISM", "length": 94, "header": "tr|A0ABI0P670-1|A0ABI0P670_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P670-1" }, "locus": { "chromosome": "Y", "start_pos": 58015218, "end_pos": 57989997, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147628.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147628.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107236.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107236.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P673-1", "uniprot_ac": "A0ABI0P673", "uniprot_id": "A0ABI0P673_BOVIN", "mass": { "chemical_mass": 34805.0, "monoisotopic_mass": 34805.0 }, "refseq": { "ac": "NP_001377633", "name": "olfactory receptor family 2 subfamily AG member 1E", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377633" }, "gene_names": [ { "name": "OR2AG1E", "type": "recommended", "evidence": [ { "id": "A0ABI0P673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673" } ] }, { "name": "OR2AG1E", "type": "synonym", "evidence": [ { "id": "NP_001377633", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377633" } ] } ], "protein_names": [ { "name": "Olfactory receptor family 2 subfamily AG member 1E", "type": "synonym", "evidence": [ { "id": "A0ABI0P673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor family 2 subfamily AG member 1E", "type": "synonym", "evidence": [ { "id": "NP_001377633", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377633" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377633", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377633" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P673", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P673", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR2AG1E", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673", "locus": {} } ], "crossref": [ { "id": "cd15421", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15421", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100336980", "url": "https://www.ncbi.nlm.nih.gov/gene/100336980", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377633", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377633", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P673", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P673-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEHWNSTLGSGFMLLGILNNSGFPGLLCATISVLYMLALTSNGLLLLVITMDAWLHVPMYLLLRQLSLMDLLFTSVVTPKVIIDFLLSENTVSFGGCALQMFLALTVGGAEDLLLAFMAYDRYVAICHPLNYMVLMRPRVYWLMMATPWVLASLNALFHTPYTMHFPFCRSRKINHLLCEIPPLLKLACEDASRYELMLYVTGVTFLIPPLVAILASYTLILLTVLHMPSNEGRQKALVTCSSHLTVVGMFYGAATFMYVLPSSLHSPKQDNIISVFYTMVTPALNPLIYSLRNKEVMGALRRVLQKYML", "length": 310, "header": "tr|A0ABI0P673-1|A0ABI0P673_BOVIN Isoform 1 of Olfactory receptor family 2 subfamily AG member 1E OS=Bos taurus OX=9913 GN=OR2AG1E PE=3 SV=1 CANONICAL=A0ABI0P673-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P673-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673/entry#A0ABI0P673-1", "sequence": { "sequence": "MEHWNSTLGSGFMLLGILNNSGFPGLLCATISVLYMLALTSNGLLLLVITMDAWLHVPMYLLLRQLSLMDLLFTSVVTPKVIIDFLLSENTVSFGGCALQMFLALTVGGAEDLLLAFMAYDRYVAICHPLNYMVLMRPRVYWLMMATPWVLASLNALFHTPYTMHFPFCRSRKINHLLCEIPPLLKLACEDASRYELMLYVTGVTFLIPPLVAILASYTLILLTVLHMPSNEGRQKALVTCSSHLTVVGMFYGAATFMYVLPSSLHSPKQDNIISVFYTMVTPALNPLIYSLRNKEVMGALRRVLQKYML", "length": 310, "header": "tr|A0ABI0P673-1|A0ABI0P673_BOVIN Isoform 1 of Olfactory receptor family 2 subfamily AG member 1E OS=Bos taurus OX=9913 GN=OR2AG1E PE=3 SV=1 CANONICAL=A0ABI0P673-1" }, "locus": { "chromosome": "15", "start_pos": 46025557, "end_pos": 46024628, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139211.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139211.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107593.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107593.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 282, "start_aa": "Thr", "end_pos": 282, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr282", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P673", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P673", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P673", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 19, "end_pos": 21, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P673" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 41, "end_pos": 290, "start_aa": "Ser", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 282 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 19, "end_pos": 21 }, { "start_pos": 5, "end_pos": 7 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6A7-1", "uniprot_ac": "A0ABI0P6A7", "uniprot_id": "A0ABI0P6A7_BOVIN", "mass": { "chemical_mass": 33053.0, "monoisotopic_mass": 33053.0 }, "refseq": {}, "gene_names": [ { "name": "LOC618633", "type": "recommended", "evidence": [ { "id": "A0ABI0P6A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6A7" } ] } ], "protein_names": [ { "name": "MARVEL domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6A7/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6A7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6A7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC618633", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6A7", "locus": {} } ], "crossref": [ { "id": "IPR008253", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008253", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR17068", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17068", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR17068:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17068:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01284", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01284", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6A7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6A7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6A7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6A7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDNERGAVSNCCLTIWCVCFSLTAFISMLECYYYDILPFWYKLPITYACYVAIFCLLTSIINPIFYVQYLHYGPSRDQAIAASAFSCITSVLYAIDVACTWKYYKLKNIPCYEHTLPGLLKILESVVACVIFSFISNTSLYWPQPALKCCLAVYFTCFVRVAVAMLLKLSGWENRLPLQLTIFHLGQTMLSFLLYVSAMVLWPLCQFDEKLGGQPHWYSDLSCVDELTDYGCVWDQRLAVAILTAINLLMYVVDLVYWTRQFSVGTEHQPSTPYPLHSQGVSLQRSVEP", "length": 289, "header": "tr|A0ABI0P6A7-1|A0ABI0P6A7_BOVIN Isoform 1 of MARVEL domain-containing protein OS=Bos taurus OX=9913 GN=LOC618633 PE=3 SV=1 CANONICAL=A0ABI0P6A7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6A7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6A7/entry#A0ABI0P6A7-1", "sequence": { "sequence": "MDNERGAVSNCCLTIWCVCFSLTAFISMLECYYYDILPFWYKLPITYACYVAIFCLLTSIINPIFYVQYLHYGPSRDQAIAASAFSCITSVLYAIDVACTWKYYKLKNIPCYEHTLPGLLKILESVVACVIFSFISNTSLYWPQPALKCCLAVYFTCFVRVAVAMLLKLSGWENRLPLQLTIFHLGQTMLSFLLYVSAMVLWPLCQFDEKLGGQPHWYSDLSCVDELTDYGCVWDQRLAVAILTAINLLMYVVDLVYWTRQFSVGTEHQPSTPYPLHSQGVSLQRSVEP", "length": 289, "header": "tr|A0ABI0P6A7-1|A0ABI0P6A7_BOVIN Isoform 1 of MARVEL domain-containing protein OS=Bos taurus OX=9913 GN=LOC618633 PE=3 SV=1 CANONICAL=A0ABI0P6A7-1" }, "locus": { "chromosome": "21", "start_pos": 19745299, "end_pos": 19744428, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000153924.1", "url": "https://www.ensembl.org/id/ENSBTAT00000153924.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107138.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107138.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6A7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6A7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 137, "end_pos": 139, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6A7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6A7" }, { "id": "PS51225", "database": "PROSITE", "url": "https://prosite.expasy.org/PS51225" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "MARVEL", "eco_id": "ECO_0000259", "start_pos": 1, "end_pos": 105, "start_aa": "Met", "end_aa": "Lys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 137, "end_pos": 139 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6B3-1", "uniprot_ac": "A0ABI0P6B3", "uniprot_id": "A0ABI0P6B3_BOVIN", "mass": { "chemical_mass": 36514.0, "monoisotopic_mass": 36514.0 }, "refseq": { "ac": "NP_001193267", "name": "olfactory receptor family 9 subfamily K member 15", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001193267" }, "gene_names": [ { "name": "OR9K15", "type": "recommended", "evidence": [ { "id": "A0ABI0P6B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3" } ] }, { "name": "OR9K15", "type": "synonym", "evidence": [ { "id": "NP_001193267", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001193267" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P6B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor family 9 subfamily K member 15", "type": "synonym", "evidence": [ { "id": "NP_001193267", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001193267" } ] }, { "name": "olfactory receptor-like", "type": "synonym", "evidence": [ { "id": "NP_001193267", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001193267" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001193267", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001193267" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR9K15", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3", "locus": {} } ], "crossref": [ { "id": "788615", "url": "https://www.ncbi.nlm.nih.gov/gene/788615", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050516", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050516", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:788615", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:788615", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR26452", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26452", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001193267", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001193267", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P6B3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6B3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGDKGGDNYSEVTDFILVGIRVRPELHSLLFLFFLIVCWMVLLGNLSMIGIIVTDPRLITPMYFFLGNLSIIDLSYSTVIVPKAMVNILSQKKTISFAGCVAQLFLYALFMVTEAFVLAAMAYDRFIAICNPLLYTVRMSRSLCIQLVAGFYLCGWVSSILQVSVTFSMSFCASRVIDHFYCDSNSIEKISCSNVFMNKMVSLSLAILIILPTIVVIVVSYMYIVSTVLKICSSEGRKKAFSTCSSHLGVVSSLYGTVSFVYLTPPSNPELHKMASVCYILFTPMLNPLIYSLRNKDIKDAMRKVVWKKKFYFKYASTFTFSCIL", "length": 325, "header": "tr|A0ABI0P6B3-1|A0ABI0P6B3_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR9K15 PE=3 SV=1 CANONICAL=A0ABI0P6B3-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6B3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3/entry#A0ABI0P6B3-1", "sequence": { "sequence": "MGDKGGDNYSEVTDFILVGIRVRPELHSLLFLFFLIVCWMVLLGNLSMIGIIVTDPRLITPMYFFLGNLSIIDLSYSTVIVPKAMVNILSQKKTISFAGCVAQLFLYALFMVTEAFVLAAMAYDRFIAICNPLLYTVRMSRSLCIQLVAGFYLCGWVSSILQVSVTFSMSFCASRVIDHFYCDSNSIEKISCSNVFMNKMVSLSLAILIILPTIVVIVVSYMYIVSTVLKICSSEGRKKAFSTCSSHLGVVSSLYGTVSFVYLTPPSNPELHKMASVCYILFTPMLNPLIYSLRNKDIKDAMRKVVWKKKFYFKYASTFTFSCIL", "length": 325, "header": "tr|A0ABI0P6B3-1|A0ABI0P6B3_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR9K15 PE=3 SV=1 CANONICAL=A0ABI0P6B3-1" }, "locus": { "chromosome": "5", "start_pos": 59681292, "end_pos": 59680318, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000146726.1", "url": "https://www.ensembl.org/id/ENSBTAT00000146726.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107644.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107644.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:788615", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:788615", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 45, "end_pos": 47, "annotation": "n_glycosylation_sequon" }, { "start_pos": 68, "end_pos": 70, "annotation": "n_glycosylation_sequon" }, { "start_pos": 8, "end_pos": 10, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6B3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B3" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 44, "end_pos": 291, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 45, "end_pos": 47 }, { "start_pos": 68, "end_pos": 70 }, { "start_pos": 8, "end_pos": 10 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6B4-1", "uniprot_ac": "A0ABI0P6B4", "uniprot_id": "A0ABI0P6B4_BOVIN", "mass": { "chemical_mass": 34470.0, "monoisotopic_mass": 34470.0 }, "refseq": {}, "gene_names": [ { "name": "OR5AC31", "type": "recommended", "evidence": [ { "id": "A0ABI0P6B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P6B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR5AC31", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4", "locus": { "chromosome": "1", "start_pos": 42328486, "end_pos": 42326818, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000048630", "url": "https://www.ensembl.org/id/ENSBTAG00000048630" } ] } } ], "crossref": [ { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48018", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6B4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMEANKTLVTEFVLTGLTDLPGLKVPLFLVFLVIYLTTMVGNLGLIFLIWKDPHLHTPMYSFLGSLAFVDACSSSSVIPKMLVNILDKSQMMSLFECMAQYYFFGSSATTECFLLVVMAYDRYAAICSPLLYPVVMSNRLCTCLISASYAVGFLQPIIHVGLLSRLTFCRSNTIHHFYCEILPLFTISCTDPSINALVLFIFAAFIQAFTFITIMASYTYVLFAILKKKSEKGRSKAFSTCSAHLLSVSLFYGTLFFMYVHPGSDQDQYQDKMYSLFYTIIIPLLNPFIYSLRNKEVLGDSLFKK", "length": 305, "header": "tr|A0ABI0P6B4-1|A0ABI0P6B4_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR5AC31 PE=3 SV=1 CANONICAL=A0ABI0P6B4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6B4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4/entry#A0ABI0P6B4-1", "sequence": { "sequence": "MMEANKTLVTEFVLTGLTDLPGLKVPLFLVFLVIYLTTMVGNLGLIFLIWKDPHLHTPMYSFLGSLAFVDACSSSSVIPKMLVNILDKSQMMSLFECMAQYYFFGSSATTECFLLVVMAYDRYAAICSPLLYPVVMSNRLCTCLISASYAVGFLQPIIHVGLLSRLTFCRSNTIHHFYCEILPLFTISCTDPSINALVLFIFAAFIQAFTFITIMASYTYVLFAILKKKSEKGRSKAFSTCSAHLLSVSLFYGTLFFMYVHPGSDQDQYQDKMYSLFYTIIIPLLNPFIYSLRNKEVLGDSLFKK", "length": 305, "header": "tr|A0ABI0P6B4-1|A0ABI0P6B4_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR5AC31 PE=3 SV=1 CANONICAL=A0ABI0P6B4-1" }, "locus": { "chromosome": "1", "start_pos": 42328952, "end_pos": 42310545, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000032401.6", "url": "https://www.ensembl.org/id/ENSBTAT00000032401.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107450.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107450.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6B4" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 41, "end_pos": 290, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6D6-1", "uniprot_ac": "A0ABI0P6D6", "uniprot_id": "A0ABI0P6D6_BOVIN", "mass": { "chemical_mass": 35032.0, "monoisotopic_mass": 35032.0 }, "refseq": { "ac": "NP_001377037", "name": "olfactory receptor family 5 subfamily D member 79", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377037" }, "gene_names": [ { "name": "OR5D79", "type": "recommended", "evidence": [ { "id": "A0ABI0P6D6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6" } ] }, { "name": "OR5D79", "type": "synonym", "evidence": [ { "id": "NP_001377037", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377037" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P6D6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 5D18", "type": "synonym", "evidence": [ { "id": "NP_001377037", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377037" } ] }, { "name": "olfactory receptor family 5 subfamily D member 79", "type": "synonym", "evidence": [ { "id": "NP_001377037", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377037" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377037" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR5D79", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6", "locus": {} } ], "crossref": [ { "id": "cd15410", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15410", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "528722", "url": "https://www.ncbi.nlm.nih.gov/gene/528722", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48018", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48018", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377037", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377037", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P6D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6D6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVRNEGNQSSVSMFILLGFSEYPRLQAPLFLVFLTIYTITLMGNLGIIVVIRTSPKLHTPMYFFLSHLSVLDISSSSVFTPKLLGILVVEDRVISFKGCMAQFFFGCAFVITEMSMLAVMAYDRFVAVCNPLLYTVAVSPKLCSLLVAGTYMWGGMCSLTITWSLLELSFCDSNVIHHFGCEYSAIISTSCSDTHFSQLTCFIISTLNEVGSLLIILTSYAFIVVTIIKMPSAGGLRKAFSTCASHLTAITIFHGTVLLLYCVPNSKSSWLLIKVATVFFTVMIPMLNPLIYSLRNKDVKETVRRLITMKLLCPSI", "length": 316, "header": "tr|A0ABI0P6D6-1|A0ABI0P6D6_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR5D79 PE=3 SV=1 CANONICAL=A0ABI0P6D6-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6D6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6/entry#A0ABI0P6D6-1", "sequence": { "sequence": "MVRNEGNQSSVSMFILLGFSEYPRLQAPLFLVFLTIYTITLMGNLGIIVVIRTSPKLHTPMYFFLSHLSVLDISSSSVFTPKLLGILVVEDRVISFKGCMAQFFFGCAFVITEMSMLAVMAYDRFVAVCNPLLYTVAVSPKLCSLLVAGTYMWGGMCSLTITWSLLELSFCDSNVIHHFGCEYSAIISTSCSDTHFSQLTCFIISTLNEVGSLLIILTSYAFIVVTIIKMPSAGGLRKAFSTCASHLTAITIFHGTVLLLYCVPNSKSSWLLIKVATVFFTVMIPMLNPLIYSLRNKDVKETVRRLITMKLLCPSI", "length": 316, "header": "tr|A0ABI0P6D6-1|A0ABI0P6D6_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR5D79 PE=3 SV=1 CANONICAL=A0ABI0P6D6-1" }, "locus": { "chromosome": "15", "start_pos": 78445193, "end_pos": 78444246, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139287.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139287.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107343.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107343.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 7, "end_pos": 9, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6D6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6D6" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 43, "end_pos": 292, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 7, "end_pos": 9 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6G6-1", "uniprot_ac": "A0ABI0P6G6", "uniprot_id": "A0ABI0P6G6_BOVIN", "mass": { "chemical_mass": 37537.0, "monoisotopic_mass": 37537.0 }, "refseq": { "ac": "XP_002687723", "name": "apolipoprotein L6", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002687723" }, "gene_names": [ { "name": "LOC616957", "type": "recommended", "evidence": [ { "id": "A0ABI0P6G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6" } ] }, { "name": "LOC616957", "type": "synonym", "evidence": [ { "id": "XP_002687723", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002687723" } ] } ], "protein_names": [ { "name": "Apolipoprotein L6", "type": "recommended", "evidence": [ { "id": "A0ABI0P6G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6/entry#names_and_taxonomy" } ] }, { "name": "apolipoprotein L6", "type": "synonym", "evidence": [ { "id": "XP_002687723", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002687723" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC616957", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6", "locus": {} } ], "crossref": [ { "id": "616957", "url": "https://www.ncbi.nlm.nih.gov/gene/616957", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR008405", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008405", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:616957", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:616957", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR14096", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14096", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14096:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14096:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF05461", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF05461", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_002687723", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_002687723", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P6G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6G6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDKMSMDLVPQNLLDRDVDDILPCDDVKPQDSDLSAEERIFLEEFPNLKGELDMDIQKLHALADHIDTTHKTLTKTSVVANSITVVSGAMSILGLVLAPARAGGSLALSTAGRVLGTAGEVTSILTNVLERFHSQEAQAQVGSLMPSHGGKVRRTGVDYIMAAGKVIQNCRSTIEGVQKSIRAFQITKADPRLATATKHLLTTGQVSARRSSQVQRAFGGTTLVMKTKARLLGSAMAGFSLSVDLASLLKDWKQLKEGARTELAEELRAQARELERQLTQLTQRYESLQQRMRLCGPSWVAQSGGKALTGFMGTGAYGRGDEEASVCTVCLPIPEDAGRLEAQTASNAS", "length": 349, "header": "tr|A0ABI0P6G6-1|A0ABI0P6G6_BOVIN Isoform 1 of Apolipoprotein L6 OS=Bos taurus OX=9913 GN=LOC616957 PE=3 SV=1 CANONICAL=A0ABI0P6G6-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6G6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6/entry#A0ABI0P6G6-1", "sequence": { "sequence": "MDKMSMDLVPQNLLDRDVDDILPCDDVKPQDSDLSAEERIFLEEFPNLKGELDMDIQKLHALADHIDTTHKTLTKTSVVANSITVVSGAMSILGLVLAPARAGGSLALSTAGRVLGTAGEVTSILTNVLERFHSQEAQAQVGSLMPSHGGKVRRTGVDYIMAAGKVIQNCRSTIEGVQKSIRAFQITKADPRLATATKHLLTTGQVSARRSSQVQRAFGGTTLVMKTKARLLGSAMAGFSLSVDLASLLKDWKQLKEGARTELAEELRAQARELERQLTQLTQRYESLQQRMRLCGPSWVAQSGGKALTGFMGTGAYGRGDEEASVCTVCLPIPEDAGRLEAQTASNAS", "length": 349, "header": "tr|A0ABI0P6G6-1|A0ABI0P6G6_BOVIN Isoform 1 of Apolipoprotein L6 OS=Bos taurus OX=9913 GN=LOC616957 PE=3 SV=1 CANONICAL=A0ABI0P6G6-1" }, "locus": { "chromosome": "5", "start_pos": 73871607, "end_pos": 73868866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000153193.1", "url": "https://www.ensembl.org/id/ENSBTAT00000153193.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107528.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107528.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:616957", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:616957", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "lipid transport", "id": "GO:0006869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006869", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6" } ], "pmid": "" }, { "name": "lipoprotein metabolic process", "id": "GO:0042157", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042157", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "lipid binding", "id": "GO:0008289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008289", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6G6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 347, "end_pos": 349, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 347, "end_pos": 349 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6I3-1", "uniprot_ac": "A0ABI0P6I3", "uniprot_id": "A0ABI0P6I3_BOVIN", "mass": { "chemical_mass": 27734.0, "monoisotopic_mass": 27734.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Large ribosomal subunit protein uL2", "type": "recommended", "evidence": [ { "id": "A0ABI0P6I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3/entry#names_and_taxonomy" } ] }, { "name": "60S ribosomal protein L8", "type": "synonym", "evidence": [ { "id": "A0ABI0P6I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Component of the large ribosomal subunit. The ribosome is a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6I3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3#function" }, { "database": "UniProtKB", "id": "ARBA00034092", "url": "https://www.uniprot.org/uniprotkb/ARBA00034092#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6I3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3", "locus": {} } ], "crossref": [ { "id": "IPR002171", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002171", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008991", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008991", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012340", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012340", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014722", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014722", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014726", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014726", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022666", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022666", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022669", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022669", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022671", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022671", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023672", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023672", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR13691", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13691", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13691:SF16", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13691:SF16", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00181", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00181", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF03947", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF03947", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6I3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6I3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGRVIHGQRKGASSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDVIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQSGYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHSPETKKTRVKLPSGSKKVISSANRAVVGVVAGGGCIDKPILKAGHAYHKYKAKRNCWPLVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAALRTGRLRGTKTVQEKEN", "length": 257, "header": "tr|A0ABI0P6I3-1|A0ABI0P6I3_BOVIN Isoform 1 of Large ribosomal subunit protein uL2 OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P6I3-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6I3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3/entry#A0ABI0P6I3-1", "sequence": { "sequence": "MGRVIHGQRKGASSVFRAHVKHRKGAARLRAVDFAERHGYIKGIVKDVIHDPGRGAPLAKVVFRDPYRFKKRTELFIAAEGIHTGQSGYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHSPETKKTRVKLPSGSKKVISSANRAVVGVVAGGGCIDKPILKAGHAYHKYKAKRNCWPLVRGVAMNPVEHPFGGGNHQHIGKPSTIRRDAPAGRKVGLIAALRTGRLRGTKTVQEKEN", "length": 257, "header": "tr|A0ABI0P6I3-1|A0ABI0P6I3_BOVIN Isoform 1 of Large ribosomal subunit protein uL2 OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P6I3-1" }, "locus": { "chromosome": "12", "start_pos": 18096228, "end_pos": 18095458, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000149553.1", "url": "https://www.ensembl.org/id/ENSBTAT00000149553.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106975.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106975.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6I3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3" } ], "pmid": "" }, { "name": "structural constituent of ribosome", "id": "GO:0003735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003735", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6I3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "translation", "id": "GO:0006412", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006412", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6I3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "organelle membrane", "id": "GO:0031090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031090", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6I3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3" } ], "pmid": "" }, { "name": "large ribosomal subunit", "id": "GO:0015934", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015934", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6I3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3" }, { "id": "SM01382", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM01382" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Large ribosomal subunit protein uL2 C-terminal", "eco_id": "ECO_0000259", "start_pos": 96, "end_pos": 231, "start_aa": "Leu", "end_aa": "Ala", "glycosite_overlap": "" }, { "evidence": [ { "id": "A0ABI0P6I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6I3" }, { "id": "SM01383", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM01383" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Large ribosomal subunit protein uL2 RNA-binding", "eco_id": "ECO_0000259", "start_pos": 11, "end_pos": 90, "start_aa": "Gly", "end_aa": "Cys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6M0-1", "uniprot_ac": "A0ABI0P6M0", "uniprot_id": "A0ABI0P6M0_BOVIN", "mass": { "chemical_mass": 13890.0, "monoisotopic_mass": 13890.0 }, "refseq": {}, "gene_names": [ { "name": "H2BC12", "type": "recommended", "evidence": [ { "id": "A0ABI0P6M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0" } ] } ], "protein_names": [ { "name": "Histone H2B", "type": "recommended", "evidence": [ { "id": "A0ABI0P6M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "H2BC12", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0", "locus": {} } ], "crossref": [ { "id": "cd22910", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22910", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000558", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000558", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007125", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007125", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009072", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR055333", "url": "https://www.ebi.ac.uk/interpro/entry/IPR055333", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23428", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23428", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00125", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00125", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6M0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK", "length": 126, "header": "tr|A0ABI0P6M0-1|A0ABI0P6M0_BOVIN Isoform 1 of Histone H2B OS=Bos taurus OX=9913 GN=H2BC12 PE=3 SV=1 CANONICAL=A0ABI0P6M0-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6M0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0/entry#A0ABI0P6M0-1", "sequence": { "sequence": "MPEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK", "length": 126, "header": "tr|A0ABI0P6M0-1|A0ABI0P6M0_BOVIN Isoform 1 of Histone H2B OS=Bos taurus OX=9913 GN=H2BC12 PE=3 SV=1 CANONICAL=A0ABI0P6M0-1" }, "locus": { "chromosome": "23", "start_pos": 31355026, "end_pos": 31354649, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000145781.1", "url": "https://www.ensembl.org/id/ENSBTAT00000145781.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106877.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106877.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0" } ], "pmid": "" }, { "name": "structural constituent of chromatin", "id": "GO:0030527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0" } ], "pmid": "" }, { "name": "nucleosome", "id": "GO:0000786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6M0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M0" }, { "id": "PF00125", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00125" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Core Histone H2A/H2B/H3", "eco_id": "ECO_0000259", "start_pos": 20, "end_pos": 101, "start_aa": "Thr", "end_aa": "Leu", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6M2-1", "uniprot_ac": "A0ABI0P6M2", "uniprot_id": "A0ABI0P6M2_BOVIN", "mass": { "chemical_mass": 17532.0, "monoisotopic_mass": 17532.0 }, "refseq": {}, "gene_names": [ { "name": "LOC112442671", "type": "recommended", "evidence": [ { "id": "A0ABI0P6M2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M2" } ] } ], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P6M2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M2/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC112442671", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M2", "locus": {} } ], "crossref": [ { "id": "A0ABI0P6M2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6M2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTHSCCSPCCQPTCCRTTCCESSCCNCCSKPCCQPTCCESICCQPSCPPTCYQASETTCCRTTCRKPTCVTTCCQPTCCVSSSCGQTFSGSSCSQSCCQPACCAPVYCHRICYHPTCLCLPGCQDQSCGSSCCQPCSRPVCCQTTCCRTTCCHPSCVSSCCQPSCC", "length": 166, "header": "tr|A0ABI0P6M2-1|A0ABI0P6M2_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN=LOC112442671 PE=4 SV=1 CANONICAL=A0ABI0P6M2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6M2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M2/entry#A0ABI0P6M2-1", "sequence": { "sequence": "MTHSCCSPCCQPTCCRTTCCESSCCNCCSKPCCQPTCCESICCQPSCPPTCYQASETTCCRTTCRKPTCVTTCCQPTCCVSSSCGQTFSGSSCSQSCCQPACCAPVYCHRICYHPTCLCLPGCQDQSCGSSCCQPCSRPVCCQTTCCRTTCCHPSCVSSCCQPSCC", "length": 166, "header": "tr|A0ABI0P6M2-1|A0ABI0P6M2_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN=LOC112442671 PE=4 SV=1 CANONICAL=A0ABI0P6M2-1" }, "locus": { "chromosome": "19", "start_pos": 41465381, "end_pos": 41464794, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000142064.1", "url": "https://www.ensembl.org/id/ENSBTAT00000142064.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106656.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106656.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6M6-1", "uniprot_ac": "A0ABI0P6M6", "uniprot_id": "A0ABI0P6M6_BOVIN", "mass": { "chemical_mass": 36356.0, "monoisotopic_mass": 36356.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Testis-specific Y-encoded protein 1-like", "type": "recommended", "evidence": [ { "id": "A0ABI0P6M6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M6/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M6" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M6", "locus": {} } ], "crossref": [ { "id": "IPR002164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11875", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11875", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00956", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00956", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6M6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6M6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRPFASAPARGHRQGQEERERRSEEGGSVPGPRTFQVVSPVVTPGQEATLFRVEAVEEGEALVDGDVAGIGREFQLLAEDIVEEVEVVADEEQEQRPSQELEEKTVEEQGQERPGGPCERQELDALQALAALQVELSSEREQNGRAYVQFMRKNHQRRKRHLARRSAIIQGIPGFWAKAIMSHPQVSVLISDQDQDFLGYMMDLKVQVQSHPPSRCKLIFSFRDNPYFLNSVIIKEYYLDITGYRARRSTPVHWFWDFERGAPSRRLDTRSLNFLNWLSGHNGPESNRIAEIISEDVWDDPLKYYLREEGSSMRDN", "length": 317, "header": "tr|A0ABI0P6M6-1|A0ABI0P6M6_BOVIN Isoform 1 of Testis-specific Y-encoded protein 1-like OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P6M6-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6M6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M6/entry#A0ABI0P6M6-1", "sequence": { "sequence": "MSRPFASAPARGHRQGQEERERRSEEGGSVPGPRTFQVVSPVVTPGQEATLFRVEAVEEGEALVDGDVAGIGREFQLLAEDIVEEVEVVADEEQEQRPSQELEEKTVEEQGQERPGGPCERQELDALQALAALQVELSSEREQNGRAYVQFMRKNHQRRKRHLARRSAIIQGIPGFWAKAIMSHPQVSVLISDQDQDFLGYMMDLKVQVQSHPPSRCKLIFSFRDNPYFLNSVIIKEYYLDITGYRARRSTPVHWFWDFERGAPSRRLDTRSLNFLNWLSGHNGPESNRIAEIISEDVWDDPLKYYLREEGSSMRDN", "length": 317, "header": "tr|A0ABI0P6M6-1|A0ABI0P6M6_BOVIN Isoform 1 of Testis-specific Y-encoded protein 1-like OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P6M6-1" }, "locus": { "chromosome": "Y", "start_pos": 8969234, "end_pos": 8966997, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144602.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144602.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107474.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107474.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "nucleosome assembly", "id": "GO:0006334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006334", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 44 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6M7-1", "uniprot_ac": "A0ABI0P6M7", "uniprot_id": "A0ABI0P6M7_BOVIN", "mass": { "chemical_mass": 12086.0, "monoisotopic_mass": 12086.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6M7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M7/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M7", "locus": {} } ], "crossref": [ { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF46", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF46", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6M7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6M7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDTEVTQSPSHLIKGKDQRAKMDCVPKEGHAYVYWYRKKLEEAFEFLVYFQNQDMMENTALFKQRFSAECPQNSPCSLEINSTEAADAALYFCASSQSTVLHVSSS", "length": 106, "header": "tr|A0ABI0P6M7-1|A0ABI0P6M7_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6M7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6M7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M7/entry#A0ABI0P6M7-1", "sequence": { "sequence": "MDTEVTQSPSHLIKGKDQRAKMDCVPKEGHAYVYWYRKKLEEAFEFLVYFQNQDMMENTALFKQRFSAECPQNSPCSLEINSTEAADAALYFCASSQSTVLHVSSS", "length": 106, "header": "tr|A0ABI0P6M7-1|A0ABI0P6M7_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6M7-1" }, "locus": { "chromosome": "4", "start_pos": 106011332, "end_pos": 106011015, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152960.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152960.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107198.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107198.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6M7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6M7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6M7" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 3, "end_pos": 106, "start_aa": "Thr", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 81, "end_pos": 83 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6R2-1", "uniprot_ac": "A0ABI0P6R2", "uniprot_id": "A0ABI0P6R2_BOVIN", "mass": { "chemical_mass": 12997.0, "monoisotopic_mass": 12997.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R2/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6R2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R2", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6R2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6R2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "YAGVSQDPRYQVVRRGQSTTLTCTQDLDHNSMYWYRQDPGHGLRLIHYSAGPPSTEKGDMPDGYTVSRSRKENFPLTLESANPSQTSVYFCASSYSMALHGHLLSVQKDRVPRVGS", "length": 116, "header": "tr|A0ABI0P6R2-1|A0ABI0P6R2_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6R2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6R2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R2/entry#A0ABI0P6R2-1", "sequence": { "sequence": "YAGVSQDPRYQVVRRGQSTTLTCTQDLDHNSMYWYRQDPGHGLRLIHYSAGPPSTEKGDMPDGYTVSRSRKENFPLTLESANPSQTSVYFCASSYSMALHGHLLSVQKDRVPRVGS", "length": 116, "header": "tr|A0ABI0P6R2-1|A0ABI0P6R2_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6R2-1" }, "locus": { "chromosome": "4", "start_pos": 105685547, "end_pos": 105685200, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000137590.1", "url": "https://www.ensembl.org/id/ENSBTAT00000137590.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107111.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107111.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "T cell receptor complex", "id": "GO:0042101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6R2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6R2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6R2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R2" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 2, "end_pos": 107, "start_aa": "Ala", "end_aa": "Gln", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6R5-1", "uniprot_ac": "A0ABI0P6R5", "uniprot_id": "A0ABI0P6R5_BOVIN", "mass": { "chemical_mass": 17554.0, "monoisotopic_mass": 17554.0 }, "refseq": {}, "gene_names": [ { "name": "KRTAP9-2", "type": "recommended", "evidence": [ { "id": "A0ABI0P6R5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R5" } ] } ], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P6R5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R5/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6R5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "KRTAP9-2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R5", "locus": {} } ], "crossref": [ { "id": "A0ABI0P6R5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6R5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTHSCCSPCCQPTCCRNTCCESSCCNCCSKPCCQPTCCESICCQPSCPPTCYQASETTCCRTTCRKPTCVTTCCQPTCCVSSSCGQTFSGSSCSQSCCQPACCAPVYCHRICYHPTCCCLPGCQDQSCGSSCCQPCSRPVCCQTTCCRTTCCRPSCVSSCCQPSCC", "length": 166, "header": "tr|A0ABI0P6R5-1|A0ABI0P6R5_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN=KRTAP9-2 PE=4 SV=1 CANONICAL=A0ABI0P6R5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6R5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6R5/entry#A0ABI0P6R5-1", "sequence": { "sequence": "MTHSCCSPCCQPTCCRNTCCESSCCNCCSKPCCQPTCCESICCQPSCPPTCYQASETTCCRTTCRKPTCVTTCCQPTCCVSSSCGQTFSGSSCSQSCCQPACCAPVYCHRICYHPTCCCLPGCQDQSCGSSCCQPCSRPVCCQTTCCRTTCCRPSCVSSCCQPSCC", "length": 166, "header": "tr|A0ABI0P6R5-1|A0ABI0P6R5_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN=KRTAP9-2 PE=4 SV=1 CANONICAL=A0ABI0P6R5-1" }, "locus": { "chromosome": "19", "start_pos": 41448825, "end_pos": 41448238, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000153784.1", "url": "https://www.ensembl.org/id/ENSBTAT00000153784.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106735.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106735.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6T5-1", "uniprot_ac": "A0ABI0P6T5", "uniprot_id": "A0ABI0P6T5_BOVIN", "mass": { "chemical_mass": 16747.0, "monoisotopic_mass": 16747.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "UBC core domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6T5/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6T5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6T5", "locus": {} } ], "crossref": [ { "id": "cd23792", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd23792", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000608", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000608", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016135", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016135", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023313", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023313", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR24068", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24068", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00179", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00179", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6T5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6T5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6T5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MALKWINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKLPKVAFTTRIYHPNINSNGSICLDILRSQWSPALIISKVLLSICSLLCDPIPDNPLVPEIARMYKTDRDKYNRVSREWTQKYAM", "length": 147, "header": "tr|A0ABI0P6T5-1|A0ABI0P6T5_BOVIN Isoform 1 of UBC core domain-containing protein OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P6T5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6T5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6T5/entry#A0ABI0P6T5-1", "sequence": { "sequence": "MALKWINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKLPKVAFTTRIYHPNINSNGSICLDILRSQWSPALIISKVLLSICSLLCDPIPDNPLVPEIARMYKTDRDKYNRVSREWTQKYAM", "length": 147, "header": "tr|A0ABI0P6T5-1|A0ABI0P6T5_BOVIN Isoform 1 of UBC core domain-containing protein OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P6T5-1" }, "locus": { "chromosome": "Y", "start_pos": 29234284, "end_pos": 29233844, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147457.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147457.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106984.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106984.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6T5" } ], "pmid": "" }, { "name": "transferase activity", "id": "GO:0016740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016740", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6T5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 41, "end_pos": 43, "annotation": "n_glycosylation_sequon" }, { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6T5" }, { "id": "PS50127", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50127" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "UBC core", "eco_id": "ECO_0000259", "start_pos": 1, "end_pos": 147, "start_aa": "Met", "end_aa": "Met", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 41, "end_pos": 43 }, { "start_pos": 81, "end_pos": 83 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6U1-1", "uniprot_ac": "A0ABI0P6U1", "uniprot_id": "A0ABI0P6U1_BOVIN", "mass": { "chemical_mass": 32112.0, "monoisotopic_mass": 32112.0 }, "refseq": { "ac": "NP_001377758", "name": "olfactory receptor family 7 subfamily A member 92", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377758" }, "gene_names": [ { "name": "OR7A92", "type": "recommended", "evidence": [ { "id": "A0ABI0P6U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1" } ] }, { "name": "OR7A92", "type": "synonym", "evidence": [ { "id": "NP_001377758", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377758" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P6U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor family 7 subfamily A member 92", "type": "synonym", "evidence": [ { "id": "NP_001377758", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377758" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377758" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6U1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6U1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR7A92", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1", "locus": {} } ], "crossref": [ { "id": "cd15234", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15234", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "119646116", "url": "https://www.ncbi.nlm.nih.gov/gene/119646116", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48001", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48001", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377758", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377758", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P6U1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6U1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFADICFTSTIIPKMLWNIQTHSKVITYEGCIIQMYFLLLFGAFDVFLLTMMAYDRYVAICHPLHYMVIMKPQLCGILVLSSFIMSFLYSLMQSLMVVQVSFCTKRVIPHIFCEANLMIKLACSDTFICDMVVYFVSVVLGGGSLGAILYSYSKIIACINGISSAQGKYKAFSTCASHLSVVSLFSCSVLGVYLTSADTHSSHSSVIASVMYSVVTPMLNPFMYSLRNKDIKKALKIFGKETNKELSVLGLKNCH", "length": 288, "header": "tr|A0ABI0P6U1-1|A0ABI0P6U1_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR7A92 PE=3 SV=1 CANONICAL=A0ABI0P6U1-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6U1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1/entry#A0ABI0P6U1-1", "sequence": { "sequence": "MYLITVFGNLLIILAVSSDSHLHTPMYFFLSNLSFADICFTSTIIPKMLWNIQTHSKVITYEGCIIQMYFLLLFGAFDVFLLTMMAYDRYVAICHPLHYMVIMKPQLCGILVLSSFIMSFLYSLMQSLMVVQVSFCTKRVIPHIFCEANLMIKLACSDTFICDMVVYFVSVVLGGGSLGAILYSYSKIIACINGISSAQGKYKAFSTCASHLSVVSLFSCSVLGVYLTSADTHSSHSSVIASVMYSVVTPMLNPFMYSLRNKDIKKALKIFGKETNKELSVLGLKNCH", "length": 288, "header": "tr|A0ABI0P6U1-1|A0ABI0P6U1_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR7A92 PE=3 SV=1 CANONICAL=A0ABI0P6U1-1" }, "locus": { "chromosome": "7", "start_pos": 9736126, "end_pos": 9735263, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000143760.1", "url": "https://www.ensembl.org/id/ENSBTAT00000143760.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107740.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107740.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6U1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6U1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6U1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 32, "end_pos": 34, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6U1" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 8, "end_pos": 257, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 32, "end_pos": 34 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6V1-1", "uniprot_ac": "A0ABI0P6V1", "uniprot_id": "A0ABI0P6V1_BOVIN", "mass": { "chemical_mass": 13445.0, "monoisotopic_mass": 13445.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Secreted protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6V1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V1/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6V1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V1", "locus": {} } ], "crossref": [ { "id": "A0ABI0P6V1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6V1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKYYLYRAKVTQIMCVVALYGPNCNAAQPVCMGSGSWTQDLECHPGRGLLLVMWRWPDGERVTENEMAGLHHQCNGHELGQTSGNGEGQGGLAHCGPWGCRYNWANEQQQFLEIKLFQGE", "length": 120, "header": "tr|A0ABI0P6V1-1|A0ABI0P6V1_BOVIN Isoform 1 of Secreted protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6V1-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6V1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V1/entry#A0ABI0P6V1-1", "sequence": { "sequence": "MKYYLYRAKVTQIMCVVALYGPNCNAAQPVCMGSGSWTQDLECHPGRGLLLVMWRWPDGERVTENEMAGLHHQCNGHELGQTSGNGEGQGGLAHCGPWGCRYNWANEQQQFLEIKLFQGE", "length": 120, "header": "tr|A0ABI0P6V1-1|A0ABI0P6V1_BOVIN Isoform 1 of Secreted protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6V1-1" }, "locus": { "chromosome": "Y", "start_pos": 27170805, "end_pos": 27170446, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000140368.1", "url": "https://www.ensembl.org/id/ENSBTAT00000140368.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107310.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107310.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6V2-1", "uniprot_ac": "A0ABI0P6V2", "uniprot_id": "A0ABI0P6V2_BOVIN", "mass": { "chemical_mass": 6668.0, "monoisotopic_mass": 6668.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Immunoglobulin V-set domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V2/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6V2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V2", "locus": {} } ], "crossref": [ { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051287", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051287", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR19367", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19367", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19367:SF45", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19367:SF45", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6V2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6V2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "AQKVTQDQPEISSQVGESATMNCQYETSWNSYNIFWYKQLSSGEMIYLIGQNSAPTRGT", "length": 59, "header": "tr|A0ABI0P6V2-1|A0ABI0P6V2_BOVIN Isoform 1 of Immunoglobulin V-set domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6V2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6V2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V2/entry#A0ABI0P6V2-1", "sequence": { "sequence": "AQKVTQDQPEISSQVGESATMNCQYETSWNSYNIFWYKQLSSGEMIYLIGQNSAPTRGT", "length": 59, "header": "tr|A0ABI0P6V2-1|A0ABI0P6V2_BOVIN Isoform 1 of Immunoglobulin V-set domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6V2-1" }, "locus": { "chromosome": "10", "start_pos": 23304250, "end_pos": 23304074, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147409.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147409.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107432.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107432.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6V2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6V2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V2" }, { "id": "PF07686", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Immunoglobulin V-set", "eco_id": "ECO_0000259", "start_pos": 6, "end_pos": 53, "start_aa": "Gln", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6V5-1", "uniprot_ac": "A0ABI0P6V5", "uniprot_id": "A0ABI0P6V5_BOVIN", "mass": { "chemical_mass": 35713.0, "monoisotopic_mass": 35713.0 }, "refseq": { "ac": "NP_001377488", "name": "olfactory receptor family 52 subfamily N member 5B", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377488" }, "gene_names": [ { "name": "OR52N5B", "type": "recommended", "evidence": [ { "id": "A0ABI0P6V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5" } ] }, { "name": "OR52N5B", "type": "synonym", "evidence": [ { "id": "NP_001377488", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377488" } ] }, { "name": "OR52N5", "type": "synonym", "evidence": [ { "id": "NP_001377488", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377488" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P6V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor family 52 subfamily N member 5B", "type": "synonym", "evidence": [ { "id": "NP_001377488", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377488" } ] }, { "name": "olfactory receptor, family 52, subfamily N, member 5", "type": "synonym", "evidence": [ { "id": "NP_001377488", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377488" } ] } ], "function": [ { "annotation": "Odorant receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6V5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5#function" }, { "database": "UniProtKB", "id": "ARBA00002936", "url": "https://www.uniprot.org/uniprotkb/ARBA00002936#function" } ] }, { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377488", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377488" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6V5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6V5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR52N5B", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5", "locus": {} } ], "crossref": [ { "id": "788304", "url": "https://www.ncbi.nlm.nih.gov/gene/788304", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050402", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050402", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR26450", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26450", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26450:SF18", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26450:SF18", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377488", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377488", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P6V5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6V5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MLVSNNSCVPPKYFILNGIPGLERVHVWISLPFCTMYIISLLGNLGLVYLIHHEESLHHPMYFFLAMLSLVDLFTCTTTLPNALCIFWFNLKEINFNACLVQMFFVHGFTGVESGVLMLMALDRYVAICYPLRYATILTNPIIAKAGLVTFLRGALLMIPFPFLVKRLPFCQSNIISHTYCDHMSVVKLSCASIKVNVIYGLVVALLIGVFDISCISVSYTMILRAVVSLSSADARQKAFSTCTAHISAIIVTYVPALFTLFTHRFGGHSIPSSLHIIVANLYLLLPPTLNPIVYGIKTKQIRDNVIKLLQGEKGASTQDK", "length": 321, "header": "tr|A0ABI0P6V5-1|A0ABI0P6V5_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR52N5B PE=3 SV=1 CANONICAL=A0ABI0P6V5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6V5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5/entry#A0ABI0P6V5-1", "sequence": { "sequence": "MLVSNNSCVPPKYFILNGIPGLERVHVWISLPFCTMYIISLLGNLGLVYLIHHEESLHHPMYFFLAMLSLVDLFTCTTTLPNALCIFWFNLKEINFNACLVQMFFVHGFTGVESGVLMLMALDRYVAICYPLRYATILTNPIIAKAGLVTFLRGALLMIPFPFLVKRLPFCQSNIISHTYCDHMSVVKLSCASIKVNVIYGLVVALLIGVFDISCISVSYTMILRAVVSLSSADARQKAFSTCTAHISAIIVTYVPALFTLFTHRFGGHSIPSSLHIIVANLYLLLPPTLNPIVYGIKTKQIRDNVIKLLQGEKGASTQDK", "length": 321, "header": "tr|A0ABI0P6V5-1|A0ABI0P6V5_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR52N5B PE=3 SV=1 CANONICAL=A0ABI0P6V5-1" }, "locus": { "chromosome": "15", "start_pos": 47359812, "end_pos": 47358850, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144084.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144084.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107167.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107167.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6V5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6V5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6V5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6V5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6V5" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 43, "end_pos": 295, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6W7-1", "uniprot_ac": "A0ABI0P6W7", "uniprot_id": "A0ABI0P6W7_BOVIN", "mass": { "chemical_mass": 8264.0, "monoisotopic_mass": 8264.0 }, "refseq": {}, "gene_names": [ { "name": "LOC100848100", "type": "recommended", "evidence": [ { "id": "A0ABI0P6W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7" } ] } ], "protein_names": [ { "name": "WAP domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6W7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC100848100", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7", "locus": {} } ], "crossref": [ { "id": "cd00199", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00199", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR008197", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008197", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036645", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036645", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050514", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050514", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR19441", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19441", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19441:SF91", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19441:SF91", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00095", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00095", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6W7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6W7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKTGTIFVLVAFIIMGLEVACALRPPIKGQQRPGFCPKVPKDSPGICLHGCSGDDSCPKGMKCCSNGCGYVCKKPVFK", "length": 78, "header": "tr|A0ABI0P6W7-1|A0ABI0P6W7_BOVIN Isoform 1 of WAP domain-containing protein OS=Bos taurus OX=9913 GN=LOC100848100 PE=4 SV=1 CANONICAL=A0ABI0P6W7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6W7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7/entry#A0ABI0P6W7-1", "sequence": { "sequence": "MKTGTIFVLVAFIIMGLEVACALRPPIKGQQRPGFCPKVPKDSPGICLHGCSGDDSCPKGMKCCSNGCGYVCKKPVFK", "length": 78, "header": "tr|A0ABI0P6W7-1|A0ABI0P6W7_BOVIN Isoform 1 of WAP domain-containing protein OS=Bos taurus OX=9913 GN=LOC100848100 PE=4 SV=1 CANONICAL=A0ABI0P6W7-1" }, "locus": { "chromosome": "19", "start_pos": 14291733, "end_pos": 14290638, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147692.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147692.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107039.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107039.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6W7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "peptidase inhibitor activity", "id": "GO:0030414", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030414", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6W7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6W7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6W7" }, { "id": "PS51390", "database": "PROSITE", "url": "https://prosite.expasy.org/PS51390" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "WAP", "eco_id": "ECO_0000259", "start_pos": 29, "end_pos": 76, "start_aa": "Gly", "end_aa": "Val", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6Y1-1", "uniprot_ac": "A0ABI0P6Y1", "uniprot_id": "A0ABI0P6Y1_BOVIN", "mass": { "chemical_mass": 14271.0, "monoisotopic_mass": 14271.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6Y1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y1/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y1", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051287", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051287", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR19367", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19367", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19367:SF45", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19367:SF45", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6Y1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPLSSLLWVFLVFTFSASGVAQKVTQDQPVTSSQVGQSVTLNCRYETNYWSYYNLFWYKQLPNGQMTYLIEQYSEYGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALWELTVLEVIG", "length": 124, "header": "tr|A0ABI0P6Y1-1|A0ABI0P6Y1_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6Y1-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6Y1-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y1/entry#A0ABI0P6Y1-1", "sequence": { "sequence": "MPLSSLLWVFLVFTFSASGVAQKVTQDQPVTSSQVGQSVTLNCRYETNYWSYYNLFWYKQLPNGQMTYLIEQYSEYGNARNGRYSVNFQKADKSISLIISSLQLEDSAKYFCALWELTVLEVIG", "length": 124, "header": "tr|A0ABI0P6Y1-1|A0ABI0P6Y1_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6Y1-1" }, "locus": { "chromosome": "10", "start_pos": 22718082, "end_pos": 22717497, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000136696.1", "url": "https://www.ensembl.org/id/ENSBTAT00000136696.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107066.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107066.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "T cell receptor complex", "id": "GO:0042101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y1" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "adaptive immune response", "id": "GO:0002250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002250", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Y1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6Y1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y1" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 22, "end_pos": 112, "start_aa": "Gln", "end_aa": "Cys", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6Y4-1", "uniprot_ac": "A0ABI0P6Y4", "uniprot_id": "A0ABI0P6Y4_BOVIN", "mass": { "chemical_mass": 11010.0, "monoisotopic_mass": 11010.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial", "type": "recommended", "evidence": [ { "id": "A0ABI0P6Y4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4/entry#names_and_taxonomy" } ] }, { "name": "Complex I-9kD", "type": "synonym", "evidence": [ { "id": "A0ABI0P6Y4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4/entry#names_and_taxonomy" } ] }, { "name": "NADH-ubiquinone oxidoreductase 9 kDa subunit", "type": "synonym", "evidence": [ { "id": "A0ABI0P6Y4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. May be the terminally assembled subunit of Complex I.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Y4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4#function" }, { "database": "UniProtKB", "id": "ARBA00002253", "url": "https://www.uniprot.org/uniprotkb/ARBA00002253#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Y4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4", "locus": {} } ], "crossref": [ { "id": "IPR026193", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026193", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR17117", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17117", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR17117:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR17117:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "A0ABI0P6Y4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6Y4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVTSFLRQQRRSGVLKTVLLEAGVFRGLAPTISLSTESGKNEKELPPNPKKQSPPKEQSTFTNLQHHDYGTYTFLAPSWIPALSPAEGPHPAVGALSPTSLA", "length": 102, "header": "tr|A0ABI0P6Y4-1|A0ABI0P6Y4_BOVIN Isoform 1 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P6Y4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6Y4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4/entry#A0ABI0P6Y4-1", "sequence": { "sequence": "MVTSFLRQQRRSGVLKTVLLEAGVFRGLAPTISLSTESGKNEKELPPNPKKQSPPKEQSTFTNLQHHDYGTYTFLAPSWIPALSPAEGPHPAVGALSPTSLA", "length": 102, "header": "tr|A0ABI0P6Y4-1|A0ABI0P6Y4_BOVIN Isoform 1 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P6Y4-1" }, "locus": { "chromosome": "19", "start_pos": 50458639, "end_pos": 50457778, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000145208.1", "url": "https://www.ensembl.org/id/ENSBTAT00000145208.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107361.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107361.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Y4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4" } ], "pmid": "" }, { "name": "respiratory chain complex I", "id": "GO:0045271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045271", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Y4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "respiratory electron transport chain", "id": "GO:0022904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022904", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Y4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Y4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P6Z9-1", "uniprot_ac": "A0ABI0P6Z9", "uniprot_id": "A0ABI0P6Z9_BOVIN", "mass": { "chemical_mass": 12857.0, "monoisotopic_mass": 12857.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P6Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Z9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Z9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Z9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Z9", "locus": {} } ], "crossref": [ { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF117", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF117", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P6Z9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Z9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P6Z9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Z9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "GALVSQKPSRAIRQRGTSVMIECRQVDSQLAMMYWYRQLPGQNLVLMATANQGSKATYESGFTDSKFPIDRPKVEFSTLTVNNASSEDSSSYFCSAGDTVLGTDQGSQQEPLSHPPSS", "length": 118, "header": "tr|A0ABI0P6Z9-1|A0ABI0P6Z9_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6Z9-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P6Z9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Z9/entry#A0ABI0P6Z9-1", "sequence": { "sequence": "GALVSQKPSRAIRQRGTSVMIECRQVDSQLAMMYWYRQLPGQNLVLMATANQGSKATYESGFTDSKFPIDRPKVEFSTLTVNNASSEDSSSYFCSAGDTVLGTDQGSQQEPLSHPPSS", "length": 118, "header": "tr|A0ABI0P6Z9-1|A0ABI0P6Z9_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P6Z9-1" }, "locus": { "chromosome": "4", "start_pos": 106057176, "end_pos": 106056823, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000147615.1", "url": "https://www.ensembl.org/id/ENSBTAT00000147615.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107093.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107093.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P6Z9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Z9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 83, "end_pos": 85, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P6Z9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P6Z9" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 2, "end_pos": 113, "start_aa": "Ala", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 83, "end_pos": 85 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P702-1", "uniprot_ac": "A0ABI0P702", "uniprot_id": "A0ABI0P702_BOVIN", "mass": { "chemical_mass": 5504.0, "monoisotopic_mass": 5504.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Plakophilin 4", "type": "recommended", "evidence": [ { "id": "A0ABI0P702", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P702/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P702", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P702" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P702", "locus": {} } ], "crossref": [ { "id": "A0ABI0P702", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P702", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P702-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P702-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQVFTSLSTLG", "length": 53, "header": "tr|A0ABI0P702-1|A0ABI0P702_BOVIN Isoform 1 of Plakophilin 4 OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P702-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P702-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P702/entry#A0ABI0P702-1", "sequence": { "sequence": "MPAPEQASLVEEGQPQTRQEAASTGPGMEPETTATTILASVKEQVFTSLSTLG", "length": 53, "header": "tr|A0ABI0P702-1|A0ABI0P702_BOVIN Isoform 1 of Plakophilin 4 OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P702-1" }, "locus": { "chromosome": "2", "start_pos": 37830790, "end_pos": 37830510, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000143253.1", "url": "https://www.ensembl.org/id/ENSBTAT00000143253.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106876.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106876.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P706-1", "uniprot_ac": "A0ABI0P706", "uniprot_id": "A0ABI0P706_BOVIN", "mass": { "chemical_mass": 41073.0, "monoisotopic_mass": 41073.0 }, "refseq": {}, "gene_names": [ { "name": "GPR52", "type": "recommended", "evidence": [ { "id": "A0ABI0P706", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706" } ] } ], "protein_names": [ { "name": "G protein-coupled receptor 52", "type": "synonym", "evidence": [ { "id": "A0ABI0P706", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P706", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "GPR52", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706", "locus": {} } ], "crossref": [ { "id": "cd00637", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00637", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050569", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050569", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR24249", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24249", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24249:SF392", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24249:SF392", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00001", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00001", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P706", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P706-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNDSRWTEWRILNTSSGILNVSERHSCPLGFGHYSAVDVCIFETIVIVLLTFLIIAGNLTVIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGIHESLTCQVFGYIISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCATSWLTSAYFTGFIVCLLYAPAALVVCFTYFHIFKICRQHTKEINDRRARFPSHEAAASGDAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSFLTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDKEARDPKPRKRANSCSI", "length": 361, "header": "tr|A0ABI0P706-1|A0ABI0P706_BOVIN Isoform 1 of G protein-coupled receptor 52 OS=Bos taurus OX=9913 GN=GPR52 PE=3 SV=1 CANONICAL=A0ABI0P706-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P706-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706/entry#A0ABI0P706-1", "sequence": { "sequence": "MNDSRWTEWRILNTSSGILNVSERHSCPLGFGHYSAVDVCIFETIVIVLLTFLIIAGNLTVIFVFHCAPLLHHYTTSYFIQTMAYADLFVGVSCLVPTLSLLHYSTGIHESLTCQVFGYIISVLKSVSMACLACISVDRYLAITKPLSYNQLVTPCRLRICIILIWIYSCLIFLPSFFGWGKPGYHGDIFEWCATSWLTSAYFTGFIVCLLYAPAALVVCFTYFHIFKICRQHTKEINDRRARFPSHEAAASGDAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESSRVLDNPTLSFLTTWLAISNSFCNCVIYSLSNSVFRLGLRRLSETMCTSCMCVKDKEARDPKPRKRANSCSI", "length": 361, "header": "tr|A0ABI0P706-1|A0ABI0P706_BOVIN Isoform 1 of G protein-coupled receptor 52 OS=Bos taurus OX=9913 GN=GPR52 PE=3 SV=1 CANONICAL=A0ABI0P706-1" }, "locus": { "chromosome": "16", "start_pos": 55749823, "end_pos": 55748741, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000142952.1", "url": "https://www.ensembl.org/id/ENSBTAT00000142952.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107512.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107512.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P706", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P706", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 13, "end_pos": 15, "annotation": "n_glycosylation_sequon" }, { "start_pos": 20, "end_pos": 22, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2, "end_pos": 4, "annotation": "n_glycosylation_sequon" }, { "start_pos": 58, "end_pos": 60, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P706", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P706" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 57, "end_pos": 317, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 13, "end_pos": 15 }, { "start_pos": 20, "end_pos": 22 }, { "start_pos": 2, "end_pos": 4 }, { "start_pos": 58, "end_pos": 60 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P713-1", "uniprot_ac": "A0ABI0P713", "uniprot_id": "A0ABI0P713_BOVIN", "mass": { "chemical_mass": 86580.0, "monoisotopic_mass": 86580.0 }, "refseq": {}, "gene_names": [ { "name": "PCDHB6", "type": "recommended", "evidence": [ { "id": "A0ABI0P713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713" } ] } ], "protein_names": [ { "name": "Protocadherin beta 6", "type": "synonym", "evidence": [ { "id": "A0ABI0P713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P713", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "PCDHB6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713", "locus": {} } ], "crossref": [ { "id": "cd11304", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11304", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR002126", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002126", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015919", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015919", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020894", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020894", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032455", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032455", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050174", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050174", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR24028", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24028", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24028:SF104", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24028:SF104", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00028", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00028", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF08266", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF08266", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF16492", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF16492", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P713", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P713-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MVQRKLHQKKRQVMIFITLILSWEAGSETIRYSVLEETESGTFVANLTKDLGLRMGELAARGARVVFKGNRQHLRLDPGTCDLLLNDKLDREELCGSTEPCVLPFQVLLENPFQLFQAALVIRDVNDHAPEFPAREMQLKISEITIPGKVFPLKMAQDLDAGSNGLQSYIISSNPHFHILTRNRKDGRKSPELVLDKALDREEQPELRLTLTALDGGSPSLSGTTEIQILVLDSNDNAPEFAQEFYEAQVPENSSLGSLVITVSARDLDAGSFGEVSYALFQVDDVNEPFEINANTGEIRLKKKLDFEEFQSYQVDIEATDGGGLSGKCSVVIKVLDVNDNAPQLTMSSLTSPIPENLPEILVAVFSVSDADSGHNQQVICSIHDNLPFVLRPSVENFYTLVTEGALDREERAEYNITITVTDMGTPRLKTEHNITVLVSDVNDNAPAFSQTSYTLWVRENNSPALHIGSVSATDTDAGANAQVTYSLLPPPDPLVPLASLVSINPDNGHLFALTSLDYEALRAFEFHVGATDRGSPALSSQALVRVLVADANDNAPFVLYPLQNASAPCTELVPRAAEPGYLVTKVVAVDGDAGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAPKQRLVVLVKDNGEPPLSASVTLHVLLVDGFSQPYLPAPEAEAAAAAPADPLTVYLVVALASVSSLFLFSVLVFVAVRLCRRGGAASAGRCPVAEGHFPGHLMDVSGTGTLSQSYQYEVCLTGDHRTGEFKFLKPVFPNLLVQDTEREIKESPSCRNSFVFS", "length": 795, "header": "tr|A0ABI0P713-1|A0ABI0P713_BOVIN Isoform 1 of Protocadherin beta 6 OS=Bos taurus OX=9913 GN=PCDHB6 PE=4 SV=1 CANONICAL=A0ABI0P713-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P713-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713/entry#A0ABI0P713-1", "sequence": { "sequence": "MVQRKLHQKKRQVMIFITLILSWEAGSETIRYSVLEETESGTFVANLTKDLGLRMGELAARGARVVFKGNRQHLRLDPGTCDLLLNDKLDREELCGSTEPCVLPFQVLLENPFQLFQAALVIRDVNDHAPEFPAREMQLKISEITIPGKVFPLKMAQDLDAGSNGLQSYIISSNPHFHILTRNRKDGRKSPELVLDKALDREEQPELRLTLTALDGGSPSLSGTTEIQILVLDSNDNAPEFAQEFYEAQVPENSSLGSLVITVSARDLDAGSFGEVSYALFQVDDVNEPFEINANTGEIRLKKKLDFEEFQSYQVDIEATDGGGLSGKCSVVIKVLDVNDNAPQLTMSSLTSPIPENLPEILVAVFSVSDADSGHNQQVICSIHDNLPFVLRPSVENFYTLVTEGALDREERAEYNITITVTDMGTPRLKTEHNITVLVSDVNDNAPAFSQTSYTLWVRENNSPALHIGSVSATDTDAGANAQVTYSLLPPPDPLVPLASLVSINPDNGHLFALTSLDYEALRAFEFHVGATDRGSPALSSQALVRVLVADANDNAPFVLYPLQNASAPCTELVPRAAEPGYLVTKVVAVDGDAGQNAWLSYQLLKATEPGLFGVWAHNGEVRTARLLSERDAPKQRLVVLVKDNGEPPLSASVTLHVLLVDGFSQPYLPAPEAEAAAAAPADPLTVYLVVALASVSSLFLFSVLVFVAVRLCRRGGAASAGRCPVAEGHFPGHLMDVSGTGTLSQSYQYEVCLTGDHRTGEFKFLKPVFPNLLVQDTEREIKESPSCRNSFVFS", "length": 795, "header": "tr|A0ABI0P713-1|A0ABI0P713_BOVIN Isoform 1 of Protocadherin beta 6 OS=Bos taurus OX=9913 GN=PCDHB6 PE=4 SV=1 CANONICAL=A0ABI0P713-1" }, "locus": { "chromosome": "7", "start_pos": 52253067, "end_pos": 52250683, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000149710.1", "url": "https://www.ensembl.org/id/ENSBTAT00000149710.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107121.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107121.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P713", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P713", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "homophilic cell adhesion via plasma membrane adhesion molecules", "id": "GO:0007156", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007156", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P713", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 253, "end_pos": 255, "annotation": "n_glycosylation_sequon" }, { "start_pos": 416, "end_pos": 418, "annotation": "n_glycosylation_sequon" }, { "start_pos": 434, "end_pos": 436, "annotation": "n_glycosylation_sequon" }, { "start_pos": 461, "end_pos": 463, "annotation": "n_glycosylation_sequon" }, { "start_pos": 46, "end_pos": 48, "annotation": "n_glycosylation_sequon" }, { "start_pos": 565, "end_pos": 567, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P713" }, { "id": "PS50268", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50268" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Cadherin", "eco_id": "ECO_0000259", "start_pos": 133, "end_pos": 241, "start_aa": "Pro", "end_aa": "Phe", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 253, "end_pos": 255 }, { "start_pos": 416, "end_pos": 418 }, { "start_pos": 434, "end_pos": 436 }, { "start_pos": 461, "end_pos": 463 }, { "start_pos": 46, "end_pos": 48 }, { "start_pos": 565, "end_pos": 567 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P747-1", "uniprot_ac": "A0ABI0P747", "uniprot_id": "A0ABI0P747_BOVIN", "mass": { "chemical_mass": 12533.0, "monoisotopic_mass": 12533.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P747/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P747", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P747" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P747", "locus": {} } ], "crossref": [ { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF11", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF11", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P747", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P747", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P747-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P747-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "GALVSQQPRRAFSKSGASVTIECRALDFQASSMFWYRQFPKRGLVLMATSNVGTNATYEQGYTKDKFPISHPDLTFSSLTVTRVDPADSSLYFCGARDTALGRDQRPRQESW", "length": 112, "header": "tr|A0ABI0P747-1|A0ABI0P747_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P747-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P747-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P747/entry#A0ABI0P747-1", "sequence": { "sequence": "GALVSQQPRRAFSKSGASVTIECRALDFQASSMFWYRQFPKRGLVLMATSNVGTNATYEQGYTKDKFPISHPDLTFSSLTVTRVDPADSSLYFCGARDTALGRDQRPRQESW", "length": 112, "header": "tr|A0ABI0P747-1|A0ABI0P747_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P747-1" }, "locus": { "chromosome": "4", "start_pos": 105842481, "end_pos": 105842146, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000149659.1", "url": "https://www.ensembl.org/id/ENSBTAT00000149659.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107591.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107591.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P747", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P747" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 55, "end_pos": 57, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P747" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 2, "end_pos": 111, "start_aa": "Ala", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 55, "end_pos": 57 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P786-1", "uniprot_ac": "A0ABI0P786", "uniprot_id": "A0ABI0P786_BOVIN", "mass": { "chemical_mass": 13644.0, "monoisotopic_mass": 13644.0 }, "refseq": { "ac": "XP_005226672", "name": "stromal cell-derived factor 1 isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005226672" }, "gene_names": [ { "name": "CXCL12", "type": "recommended", "evidence": [ { "id": "A0ABI0P786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786" } ] }, { "name": "CXCL12", "type": "synonym", "evidence": [ { "id": "XP_005226672", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005226672" } ] }, { "name": "SDF1", "type": "synonym", "evidence": [ { "id": "XP_005226672", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005226672" } ] } ], "protein_names": [ { "name": "Stromal cell-derived factor 1", "type": "recommended", "evidence": [ { "id": "A0ABI0P786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786/entry#names_and_taxonomy" } ] }, { "name": "C-X-C motif chemokine 12", "type": "synonym", "evidence": [ { "id": "A0ABI0P786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786/entry#names_and_taxonomy" } ] }, { "name": "stromal cell-derived factor 1 isoform X1", "type": "synonym", "evidence": [ { "id": "XP_005226672", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005226672" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P786", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "CXCL12", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786", "locus": { "chromosome": "28", "start_pos": 45051962, "end_pos": 45022457, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000005077", "url": "https://www.ensembl.org/id/ENSBTAG00000005077" } ] } } ], "crossref": [ { "id": "cd00273", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00273", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "613811", "url": "https://www.ncbi.nlm.nih.gov/gene/613811", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001811", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001811", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033899", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033899", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039809", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039809", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR12015", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12015", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12015:SF193", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12015:SF193", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00048", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00048", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_005226672", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005226672", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P786", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P786-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDAKVFVVLALVLTALCLSDAKPVSLSYRCPCRFFESHVAKANVKHLKILNTPNCSLQIVARLKNNNRQVCIDPKLKWIQEYLDKALNKGSREEKVGKKEKIGKKKRQKKRKAAQKRKI", "length": 119, "header": "tr|A0ABI0P786-1|A0ABI0P786_BOVIN Isoform 1 of Stromal cell-derived factor 1 OS=Bos taurus OX=9913 GN=CXCL12 PE=3 SV=1 CANONICAL=A0ABI0P786-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P786-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786/entry#A0ABI0P786-1", "sequence": { "sequence": "MDAKVFVVLALVLTALCLSDAKPVSLSYRCPCRFFESHVAKANVKHLKILNTPNCSLQIVARLKNNNRQVCIDPKLKWIQEYLDKALNKGSREEKVGKKEKIGKKKRQKKRKAAQKRKI", "length": 119, "header": "tr|A0ABI0P786-1|A0ABI0P786_BOVIN Isoform 1 of Stromal cell-derived factor 1 OS=Bos taurus OX=9913 GN=CXCL12 PE=3 SV=1 CANONICAL=A0ABI0P786-1" }, "locus": { "chromosome": "28", "start_pos": 45031784, "end_pos": 45022493, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000150300.1", "url": "https://www.ensembl.org/id/ENSBTAT00000150300.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107229.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107229.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P786", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "defense response", "id": "GO:0006952", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006952", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P786", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P786", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "growth factor activity", "id": "GO:0008083", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008083", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P786", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786" } ], "pmid": "" }, { "name": "chemokine activity", "id": "GO:0008009", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008009", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P786", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 54, "end_pos": 56, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P786" }, { "id": "SM00199", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM00199" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Chemokine interleukin-8-like", "eco_id": "ECO_0000259", "start_pos": 27, "end_pos": 86, "start_aa": "Ser", "end_aa": "Ala", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 54, "end_pos": 56 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7B0-1", "uniprot_ac": "A0ABI0P7B0", "uniprot_id": "A0ABI0P7B0_BOVIN", "mass": { "chemical_mass": 16936.0, "monoisotopic_mass": 16936.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P7B0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B0/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7B0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B0", "locus": {} } ], "crossref": [ { "id": "A0ABI0P7B0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7B0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPRSHPVSPRMPVGLQISGAMDGSYHWSSFLHSHPGQGQCRDTEQTTFRLRFLEPWSGVITGHPFFIPILDRVSAEIRNKPPSDWKGLVPPLLVAQHLLSCRLHLCICPGLDTQKHTHKHSQHKRMCVYTHAWHGDTNANRECRCFRS", "length": 148, "header": "tr|A0ABI0P7B0-1|A0ABI0P7B0_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7B0-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7B0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B0/entry#A0ABI0P7B0-1", "sequence": { "sequence": "MPRSHPVSPRMPVGLQISGAMDGSYHWSSFLHSHPGQGQCRDTEQTTFRLRFLEPWSGVITGHPFFIPILDRVSAEIRNKPPSDWKGLVPPLLVAQHLLSCRLHLCICPGLDTQKHTHKHSQHKRMCVYTHAWHGDTNANRECRCFRS", "length": 148, "header": "tr|A0ABI0P7B0-1|A0ABI0P7B0_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7B0-1" }, "locus": { "chromosome": "Y", "start_pos": 51522252, "end_pos": 51239984, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000140719.1", "url": "https://www.ensembl.org/id/ENSBTAT00000140719.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107407.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107407.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7B4-1", "uniprot_ac": "A0ABI0P7B4", "uniprot_id": "A0ABI0P7B4_BOVIN", "mass": { "chemical_mass": 34881.0, "monoisotopic_mass": 34881.0 }, "refseq": { "ac": "NP_001192363", "name": "transcriptional activator protein Pur-alpha", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192363" }, "gene_names": [ { "name": "PURA", "type": "recommended", "evidence": [ { "id": "A0ABI0P7B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B4" } ] }, { "name": "PURA", "type": "synonym", "evidence": [ { "id": "NP_001192363", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192363" } ] } ], "protein_names": [ { "name": "Purine rich element binding protein A", "type": "synonym", "evidence": [ { "id": "A0ABI0P7B4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B4/entry#names_and_taxonomy" } ] }, { "name": "transcriptional activator protein Pur-alpha", "type": "synonym", "evidence": [ { "id": "NP_001192363", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192363" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "PURA", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B4", "locus": { "chromosome": "7", "start_pos": 51302491, "end_pos": 51298957, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000008881", "url": "https://www.ensembl.org/id/ENSBTAG00000008881" } ] } } ], "crossref": [ { "id": "782746", "url": "https://www.ncbi.nlm.nih.gov/gene/782746", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006628", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006628", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:782746", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:782746", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR12611", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12611", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12611:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12611:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04845", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF04845", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001192363", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001192363", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7B4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MADRDSGSEQGGAALGSGGSLGHPGSGSGGGGGGGGGGGGGSGGGGGGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQQQQQEETAAATLLLQGEEEGEED", "length": 322, "header": "tr|A0ABI0P7B4-1|A0ABI0P7B4_BOVIN Isoform 1 of Purine rich element binding protein A OS=Bos taurus OX=9913 GN=PURA PE=3 SV=1 CANONICAL=A0ABI0P7B4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7B4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B4/entry#A0ABI0P7B4-1", "sequence": { "sequence": "MADRDSGSEQGGAALGSGGSLGHPGSGSGGGGGGGGGGGGGSGGGGGGGAPGGLQHETQELASKRVDIQNKRFYLDVKQNAKGRFLKIAEVGAGGNKSRLTLSMSVAVEFRDYLGDFIEHYAQLGPSQPPDLAQAQDEPRRALKSEFLVRENRKYYMDLKENQRGRFLRIRQTVNRGPGLGSTQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEEMKKIQEKQREKRAACEQLHQQQQQQQEETAAATLLLQGEEEGEED", "length": 322, "header": "tr|A0ABI0P7B4-1|A0ABI0P7B4_BOVIN Isoform 1 of Purine rich element binding protein A OS=Bos taurus OX=9913 GN=PURA PE=3 SV=1 CANONICAL=A0ABI0P7B4-1" }, "locus": { "chromosome": "7", "start_pos": 51300795, "end_pos": 51299830, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000142653.1", "url": "https://www.ensembl.org/id/ENSBTAT00000142653.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104873.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104873.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:782746", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:782746", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B4" } ], "pmid": "" }, { "name": "purine-rich negative regulatory element binding", "id": "GO:0032422", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032422", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7B4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 96, "end_pos": 98, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 96, "end_pos": 98 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7B5-1", "uniprot_ac": "A0ABI0P7B5", "uniprot_id": "A0ABI0P7B5_BOVIN", "mass": { "chemical_mass": 10796.0, "monoisotopic_mass": 10796.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P7B5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B5/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7B5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B5", "locus": {} } ], "crossref": [ { "id": "A0ABI0P7B5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7B5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKISHQLRSKGCVKVTKSWHLLVTRTDLQSRERVGSTRHEQLYDMRLRSAFSHHLGQLHSTSHIGLIHVGTENKDLWAQLSVCSCLHVPPSANSM", "length": 95, "header": "tr|A0ABI0P7B5-1|A0ABI0P7B5_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7B5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7B5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7B5/entry#A0ABI0P7B5-1", "sequence": { "sequence": "MKISHQLRSKGCVKVTKSWHLLVTRTDLQSRERVGSTRHEQLYDMRLRSAFSHHLGQLHSTSHIGLIHVGTENKDLWAQLSVCSCLHVPPSANSM", "length": 95, "header": "tr|A0ABI0P7B5-1|A0ABI0P7B5_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7B5-1" }, "locus": { "chromosome": "Y", "start_pos": 55448358, "end_pos": 55423118, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144260.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144260.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106111.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106111.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7C2-1", "uniprot_ac": "A0ABI0P7C2", "uniprot_id": "A0ABI0P7C2_BOVIN", "mass": { "chemical_mass": 15872.0, "monoisotopic_mass": 15872.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P7C2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C2/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C2", "locus": {} } ], "crossref": [ { "id": "A0ABI0P7C2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7C2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELGLLYTSYFSLEWRFSYKKMEIAVFHMKHWKHLYSLFAYVSTCLKHLCAYPHELVAHVCVIFCVDCVQPQLTEMNITDREIWSKQKAAPGIHRVWETGPCISEVILFKTGMRKEWPVTTQNSVFTNLGLHQET", "length": 135, "header": "tr|A0ABI0P7C2-1|A0ABI0P7C2_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7C2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7C2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C2/entry#A0ABI0P7C2-1", "sequence": { "sequence": "MELGLLYTSYFSLEWRFSYKKMEIAVFHMKHWKHLYSLFAYVSTCLKHLCAYPHELVAHVCVIFCVDCVQPQLTEMNITDREIWSKQKAAPGIHRVWETGPCISEVILFKTGMRKEWPVTTQNSVFTNLGLHQET", "length": 135, "header": "tr|A0ABI0P7C2-1|A0ABI0P7C2_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7C2-1" }, "locus": { "chromosome": "Y", "start_pos": 35565082, "end_pos": 35564678, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000142938.1", "url": "https://www.ensembl.org/id/ENSBTAT00000142938.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107286.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107286.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [ { "start_pos": 77, "end_pos": 79, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 77, "end_pos": 79 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7C8-1", "uniprot_ac": "A0ABI0P7C8", "uniprot_id": "A0ABI0P7C8_BOVIN", "mass": { "chemical_mass": 87414.0, "monoisotopic_mass": 87414.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "C2H2-type domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P7C8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C8/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7C8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C8" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C8", "locus": {} } ], "crossref": [ { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23226", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23226", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23226:SF366", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23226:SF366", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00096", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00096", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF13465", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13465", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P7C8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7C8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKNPWDVRRLEPPAIYTAVSSHNTRGLMSKNPRLENLIQKANLGIYERAHLGNEHLMKDQEYTGICERSRRCSYGHKETEIVSHKVDITAKRNEQCESNCGKHPFPLSTSAEKCISSSKGLHHFLKRTRSLKGNVENLESHPVSTANTHSNHSEHGLRLHIHSSTSENQKFKNDGENSQYNQFEGSVSKGSLFFHQQTVSLCSKMCHVDNNGRELILPSLFNTHHDMVNTEQLFTCNNTSHALSKSSTPNNYKHIYNGVRNHSCNETGYKTEQDSNPMKHQGPQSSDKDSKNSTCRNILYQISGLPLNESTHTGEKTYNCEYGDVSNQSSNVTQQQSIQNPQTSYKCKKCEKAFTNSSSLSRQRKIHSGWKPFKCTECGNTSNQNSKLSQDRQIHPGKKPYECKECGKAFMSCSHLSRHQRIHTGEKPYKCTKCGKAFNQNSNLTQHQRIHTEQKPYKGKEGGKATFRCSHFSLHQRVHAGEKPNTCKECGKVFPCSLRLTQHQITHMQQKSYKCTKCGKAFNQKSNLTQHQRIHTGEKPYKCKDCGKAFNQCSGLTYHQRIHTGEKPYKCKDCGKAFRQRSYLTKHQVIHTGEKSYKCKECGKAFSHYSTLAKHQRIHTGEKPYKCKDCGKEFNQCSGLTYHQRIHTGEKPYKCTECGKSFSQNSTLTQHQRIHTGERPYKCKDCGKDFSKHSGLTYHQRIHTGEKPYKCTECGKAFCHHSSLIQHQRIHTGEKPYKCKECGKAFIKHSHLTQHQRIHIGGKTL", "length": 765, "header": "tr|A0ABI0P7C8-1|A0ABI0P7C8_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P7C8-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7C8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C8/entry#A0ABI0P7C8-1", "sequence": { "sequence": "MKNPWDVRRLEPPAIYTAVSSHNTRGLMSKNPRLENLIQKANLGIYERAHLGNEHLMKDQEYTGICERSRRCSYGHKETEIVSHKVDITAKRNEQCESNCGKHPFPLSTSAEKCISSSKGLHHFLKRTRSLKGNVENLESHPVSTANTHSNHSEHGLRLHIHSSTSENQKFKNDGENSQYNQFEGSVSKGSLFFHQQTVSLCSKMCHVDNNGRELILPSLFNTHHDMVNTEQLFTCNNTSHALSKSSTPNNYKHIYNGVRNHSCNETGYKTEQDSNPMKHQGPQSSDKDSKNSTCRNILYQISGLPLNESTHTGEKTYNCEYGDVSNQSSNVTQQQSIQNPQTSYKCKKCEKAFTNSSSLSRQRKIHSGWKPFKCTECGNTSNQNSKLSQDRQIHPGKKPYECKECGKAFMSCSHLSRHQRIHTGEKPYKCTKCGKAFNQNSNLTQHQRIHTEQKPYKGKEGGKATFRCSHFSLHQRVHAGEKPNTCKECGKVFPCSLRLTQHQITHMQQKSYKCTKCGKAFNQKSNLTQHQRIHTGEKPYKCKDCGKAFNQCSGLTYHQRIHTGEKPYKCKDCGKAFRQRSYLTKHQVIHTGEKSYKCKECGKAFSHYSTLAKHQRIHTGEKPYKCKDCGKEFNQCSGLTYHQRIHTGEKPYKCTECGKSFSQNSTLTQHQRIHTGERPYKCKDCGKDFSKHSGLTYHQRIHTGEKPYKCTECGKAFCHHSSLIQHQRIHTGEKPYKCKECGKAFIKHSHLTQHQRIHIGGKTL", "length": 765, "header": "tr|A0ABI0P7C8-1|A0ABI0P7C8_BOVIN Isoform 1 of C2H2-type domain-containing protein OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P7C8-1" }, "locus": { "chromosome": "18", "start_pos": 57330124, "end_pos": 57325197, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152447.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152447.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107572.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107572.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7C8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C8" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7C8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 151, "end_pos": 153, "annotation": "n_glycosylation_sequon" }, { "start_pos": 237, "end_pos": 239, "annotation": "n_glycosylation_sequon" }, { "start_pos": 238, "end_pos": 240, "annotation": "n_glycosylation_sequon" }, { "start_pos": 261, "end_pos": 263, "annotation": "n_glycosylation_sequon" }, { "start_pos": 265, "end_pos": 267, "annotation": "n_glycosylation_sequon" }, { "start_pos": 292, "end_pos": 294, "annotation": "n_glycosylation_sequon" }, { "start_pos": 308, "end_pos": 310, "annotation": "n_glycosylation_sequon" }, { "start_pos": 327, "end_pos": 329, "annotation": "n_glycosylation_sequon" }, { "start_pos": 331, "end_pos": 333, "annotation": "n_glycosylation_sequon" }, { "start_pos": 356, "end_pos": 358, "annotation": "n_glycosylation_sequon" }, { "start_pos": 380, "end_pos": 382, "annotation": "n_glycosylation_sequon" }, { "start_pos": 443, "end_pos": 445, "annotation": "n_glycosylation_sequon" }, { "start_pos": 527, "end_pos": 529, "annotation": "n_glycosylation_sequon" }, { "start_pos": 665, "end_pos": 667, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7C8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7C8" }, { "id": "PS50157", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50157" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "C2H2-type", "eco_id": "ECO_0000259", "start_pos": 345, "end_pos": 372, "start_aa": "Tyr", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 151, "end_pos": 153 }, { "start_pos": 237, "end_pos": 239 }, { "start_pos": 238, "end_pos": 240 }, { "start_pos": 261, "end_pos": 263 }, { "start_pos": 265, "end_pos": 267 }, { "start_pos": 292, "end_pos": 294 }, { "start_pos": 308, "end_pos": 310 }, { "start_pos": 327, "end_pos": 329 }, { "start_pos": 331, "end_pos": 333 }, { "start_pos": 356, "end_pos": 358 }, { "start_pos": 380, "end_pos": 382 }, { "start_pos": 443, "end_pos": 445 }, { "start_pos": 527, "end_pos": 529 }, { "start_pos": 665, "end_pos": 667 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7D5-1", "uniprot_ac": "A0ABI0P7D5", "uniprot_id": "A0ABI0P7D5_BOVIN", "mass": { "chemical_mass": 6187.0, "monoisotopic_mass": 6187.0 }, "refseq": {}, "gene_names": [ { "name": "SMIM30", "type": "recommended", "evidence": [ { "id": "A0ABI0P7D5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D5" } ] } ], "protein_names": [ { "name": "Small integral membrane protein 30", "type": "synonym", "evidence": [ { "id": "A0ABI0P7D5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D5/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "SMIM30", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D5", "locus": {} } ], "crossref": [ { "id": "IPR031742", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031742", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR36878", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR36878", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR36878:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR36878:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15873", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15873", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P7D5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7D5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MISVSTQLFLVLFSLLLVLPVVEAVEAGDAIALLLGVILSITGICACLGVYARKRNGQI", "length": 59, "header": "tr|A0ABI0P7D5-1|A0ABI0P7D5_BOVIN Isoform 1 of Small integral membrane protein 30 OS=Bos taurus OX=9913 GN=SMIM30 PE=4 SV=1 CANONICAL=A0ABI0P7D5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7D5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D5/entry#A0ABI0P7D5-1", "sequence": { "sequence": "MISVSTQLFLVLFSLLLVLPVVEAVEAGDAIALLLGVILSITGICACLGVYARKRNGQI", "length": 59, "header": "tr|A0ABI0P7D5-1|A0ABI0P7D5_BOVIN Isoform 1 of Small integral membrane protein 30 OS=Bos taurus OX=9913 GN=SMIM30 PE=4 SV=1 CANONICAL=A0ABI0P7D5-1" }, "locus": { "chromosome": "4", "start_pos": 55293638, "end_pos": 55293462, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144789.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144789.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107723.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107723.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7D6-1", "uniprot_ac": "A0ABI0P7D6", "uniprot_id": "A0ABI0P7D6_BOVIN", "mass": { "chemical_mass": 36481.0, "monoisotopic_mass": 36481.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Testis-specific Y-encoded protein 1", "type": "recommended", "evidence": [ { "id": "A0ABI0P7D6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D6/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D6" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D6", "locus": {} } ], "crossref": [ { "id": "IPR002164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11875", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11875", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00956", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00956", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P7D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7D6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRPFASAPARGHRQGQEERERRSEEGGSVPGPRTFQVVSPVVTPGQEATLFRVEAVEEGEALVDGDVAGIGREFQLLAEDIVEEVEVVADEEQEQRPSQELEEKTVEEQGQERPGGPCERQELDALQALAALQVELSSEREQNRRAYVQFMRKNHQRRKRHLARRSTIIQGIPGFWAKAIMSHPQVSVLISDQDQDFLGYMMDLKVQVRSHPPSRCKLIFSFRDNPYFLNSVIIKEYYLDITGYRARRSTPVHWFWDFERGAPSRRLDTRSLNFLNWLSGHNGPESNRIAEIISEDVWDDPLKYYLREEGSSVRDN", "length": 317, "header": "tr|A0ABI0P7D6-1|A0ABI0P7D6_BOVIN Isoform 1 of Testis-specific Y-encoded protein 1 OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P7D6-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7D6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D6/entry#A0ABI0P7D6-1", "sequence": { "sequence": "MSRPFASAPARGHRQGQEERERRSEEGGSVPGPRTFQVVSPVVTPGQEATLFRVEAVEEGEALVDGDVAGIGREFQLLAEDIVEEVEVVADEEQEQRPSQELEEKTVEEQGQERPGGPCERQELDALQALAALQVELSSEREQNRRAYVQFMRKNHQRRKRHLARRSTIIQGIPGFWAKAIMSHPQVSVLISDQDQDFLGYMMDLKVQVRSHPPSRCKLIFSFRDNPYFLNSVIIKEYYLDITGYRARRSTPVHWFWDFERGAPSRRLDTRSLNFLNWLSGHNGPESNRIAEIISEDVWDDPLKYYLREEGSSVRDN", "length": 317, "header": "tr|A0ABI0P7D6-1|A0ABI0P7D6_BOVIN Isoform 1 of Testis-specific Y-encoded protein 1 OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P7D6-1" }, "locus": { "chromosome": "Y", "start_pos": 9429720, "end_pos": 9427483, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000141205.1", "url": "https://www.ensembl.org/id/ENSBTAT00000141205.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000106547.1", "url": "https://www.ensembl.org/id/ENSBTAP00000106547.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D6" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "nucleosome assembly", "id": "GO:0006334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006334", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7D6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7D6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 44 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7E8-1", "uniprot_ac": "A0ABI0P7E8", "uniprot_id": "A0ABI0P7E8_BOVIN", "mass": { "chemical_mass": 34846.0, "monoisotopic_mass": 34846.0 }, "refseq": { "ac": "NP_001377631", "name": "olfactory receptor family 4 subfamily A member 47AA", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377631" }, "gene_names": [ { "name": "OR4A47AA", "type": "recommended", "evidence": [ { "id": "A0ABI0P7E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8" } ] }, { "name": "OR4A47AA", "type": "synonym", "evidence": [ { "id": "NP_001377631", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377631" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P7E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 4A47", "type": "synonym", "evidence": [ { "id": "NP_001377631", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377631" } ] }, { "name": "olfactory receptor family 4 subfamily A member 47AA", "type": "synonym", "evidence": [ { "id": "NP_001377631", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377631" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377631", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377631" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR4A47AA", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8", "locus": {} } ], "crossref": [ { "id": "cd15939", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15939", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100336921", "url": "https://www.ncbi.nlm.nih.gov/gene/100336921", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050427", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050427", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377631", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377631", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7E8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7E8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MESRNNVTYFVLLGLTQNPKEQKVLSVLFLFIYLLTLVGNLLIIVTIAVSETLNSPMYFFLASLSCMDVTYSTSITPRLISELLFGGKNTSFESCMTQLFTEHFLGGSEIFLLLVMACDRYVAICKPLHYLVIMRQRVCVVLLVVSWVGGFLHSIIQLSTVYWLPFCAPNVIDHFMCDMYPLLELVCTDTYVTGILVLANGGLICTIVFLLLLVSYGVILHSLKNLSQEGRRKALQTCGSHITVVACFFVPCIFINARPAKTFPIDKSVSVFYTVISPMLNPFIYSLRNSELTNAMKKLWRRNIVSHNK", "length": 309, "header": "tr|A0ABI0P7E8-1|A0ABI0P7E8_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4A47AA PE=3 SV=1 CANONICAL=A0ABI0P7E8-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7E8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8/entry#A0ABI0P7E8-1", "sequence": { "sequence": "MESRNNVTYFVLLGLTQNPKEQKVLSVLFLFIYLLTLVGNLLIIVTIAVSETLNSPMYFFLASLSCMDVTYSTSITPRLISELLFGGKNTSFESCMTQLFTEHFLGGSEIFLLLVMACDRYVAICKPLHYLVIMRQRVCVVLLVVSWVGGFLHSIIQLSTVYWLPFCAPNVIDHFMCDMYPLLELVCTDTYVTGILVLANGGLICTIVFLLLLVSYGVILHSLKNLSQEGRRKALQTCGSHITVVACFFVPCIFINARPAKTFPIDKSVSVFYTVISPMLNPFIYSLRNSELTNAMKKLWRRNIVSHNK", "length": 309, "header": "tr|A0ABI0P7E8-1|A0ABI0P7E8_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4A47AA PE=3 SV=1 CANONICAL=A0ABI0P7E8-1" }, "locus": { "chromosome": "15", "start_pos": 78212691, "end_pos": 78211765, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000137989.1", "url": "https://www.ensembl.org/id/ENSBTAT00000137989.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107339.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107339.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7E8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 225, "end_pos": 227, "annotation": "n_glycosylation_sequon" }, { "start_pos": 6, "end_pos": 8, "annotation": "n_glycosylation_sequon" }, { "start_pos": 89, "end_pos": 91, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7E8" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 39, "end_pos": 285, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 225, "end_pos": 227 }, { "start_pos": 6, "end_pos": 8 }, { "start_pos": 89, "end_pos": 91 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7F9-1", "uniprot_ac": "A0ABI0P7F9", "uniprot_id": "A0ABI0P7F9_BOVIN", "mass": { "chemical_mass": 10274.0, "monoisotopic_mass": 10274.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "KRAB domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P7F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7F9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7F9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7F9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7F9", "locus": {} } ], "crossref": [ { "id": "cd07765", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07765", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001909", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001909", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036051", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036051", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050169", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050169", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23232", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23232", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23232:SF156", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23232:SF156", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01352", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01352", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P7F9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7F9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7F9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7F9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTKFQEAFKEVTVTFTKEELGLLDLAQRKLYPDVMLENFWNLVSMGYQPFTLDIILQLGREEQLWVMEPETRDECSGHRNQNEFKK", "length": 86, "header": "tr|A0ABI0P7F9-1|A0ABI0P7F9_BOVIN Isoform 1 of KRAB domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7F9-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7F9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7F9/entry#A0ABI0P7F9-1", "sequence": { "sequence": "MTKFQEAFKEVTVTFTKEELGLLDLAQRKLYPDVMLENFWNLVSMGYQPFTLDIILQLGREEQLWVMEPETRDECSGHRNQNEFKK", "length": 86, "header": "tr|A0ABI0P7F9-1|A0ABI0P7F9_BOVIN Isoform 1 of KRAB domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7F9-1" }, "locus": { "chromosome": "18", "start_pos": 52180064, "end_pos": 52173851, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000151852.1", "url": "https://www.ensembl.org/id/ENSBTAT00000151852.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107487.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107487.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7F9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7F9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7F9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7F9" }, { "id": "PS50805", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50805" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "KRAB", "eco_id": "ECO_0000259", "start_pos": 6, "end_pos": 77, "start_aa": "Glu", "end_aa": "Gly", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7G3-1", "uniprot_ac": "A0ABI0P7G3", "uniprot_id": "A0ABI0P7G3_BOVIN", "mass": { "chemical_mass": 6927.0, "monoisotopic_mass": 6927.0 }, "refseq": { "ac": "NP_001161717", "name": "beta-defensin-like precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001161717" }, "gene_names": [ { "name": "LOC783012", "type": "recommended", "evidence": [ { "id": "A0ABI0P7G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G3" } ] }, { "name": "LOC783012", "type": "synonym", "evidence": [ { "id": "NP_001161717", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001161717" } ] } ], "protein_names": [ { "name": "Beta-defensin 33", "type": "recommended", "evidence": [ { "id": "A0ABI0P7G3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G3/entry#names_and_taxonomy" } ] }, { "name": "beta-defensin-like precursor", "type": "synonym", "evidence": [ { "id": "NP_001161717", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001161717" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G3" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC783012", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G3", "locus": {} } ], "crossref": [ { "id": "783012", "url": "https://www.ncbi.nlm.nih.gov/gene/783012", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "bta:783012", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:783012", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR20515", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20515", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR20515:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20515:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "NP_001161717", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001161717", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7G3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7G3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRLLYLLFLLLICLIQTVSGKGKKKNLECEKMGGACKYQNTHGCVILPGECRSRKKHCCRV", "length": 61, "header": "tr|A0ABI0P7G3-1|A0ABI0P7G3_BOVIN Isoform 1 of Beta-defensin 33 OS=Bos taurus OX=9913 GN=LOC783012 PE=4 SV=1 CANONICAL=A0ABI0P7G3-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7G3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G3/entry#A0ABI0P7G3-1", "sequence": { "sequence": "MRLLYLLFLLLICLIQTVSGKGKKKNLECEKMGGACKYQNTHGCVILPGECRSRKKHCCRV", "length": 61, "header": "tr|A0ABI0P7G3-1|A0ABI0P7G3_BOVIN Isoform 1 of Beta-defensin 33 OS=Bos taurus OX=9913 GN=LOC783012 PE=4 SV=1 CANONICAL=A0ABI0P7G3-1" }, "locus": { "chromosome": "27", "start_pos": 6242688, "end_pos": 6240969, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000148528.1", "url": "https://www.ensembl.org/id/ENSBTAT00000148528.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107364.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107364.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:783012", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:783012", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7G4-1", "uniprot_ac": "A0ABI0P7G4", "uniprot_id": "A0ABI0P7G4_BOVIN", "mass": { "chemical_mass": 34945.0, "monoisotopic_mass": 34945.0 }, "refseq": { "ac": "NP_001376839", "name": "olfactory receptor family 7 subfamily G member 48", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376839" }, "gene_names": [ { "name": "OR7G48", "type": "recommended", "evidence": [ { "id": "A0ABI0P7G4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4" } ] }, { "name": "OR7G48", "type": "synonym", "evidence": [ { "id": "NP_001376839", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376839" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P7G4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 7G1", "type": "synonym", "evidence": [ { "id": "NP_001376839", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376839" } ] }, { "name": "olfactory receptor family 7 subfamily G member 48", "type": "synonym", "evidence": [ { "id": "NP_001376839", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376839" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001376839", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376839" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR7G48", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4", "locus": {} } ], "crossref": [ { "id": "cd15234", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15234", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "512624", "url": "https://www.ncbi.nlm.nih.gov/gene/512624", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48001", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48001", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001376839", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376839", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7G4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPRNQTAVSEFLLMRLTENEKLKTILFNLFLSMYLVTVLGNLLIILAVIFDSHLHTPMYFFLSHLSFTDIGLSTTIIPKILVNMQAQSQRITYTGCLTQICFVLILVCWESFLLGAMAYDRYVAICHPLRYTVIVNPHLCVMLTLLSLFISIGNALLHTLMVLPLSFCKELEISLFFCEVVQVIKLACSDTLINNALLYFAISLLGGIPVFGIIFSYTKIISSILRQSSVGGKYKTFSTCGSHLSVVSLFYGTGFGVYICSAIPDSPRKTAVASLMYTMVTPTMNPFIYSLRNKDMKGALRKLFSRVPTIL", "length": 312, "header": "tr|A0ABI0P7G4-1|A0ABI0P7G4_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR7G48 PE=3 SV=1 CANONICAL=A0ABI0P7G4-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7G4-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4/entry#A0ABI0P7G4-1", "sequence": { "sequence": "MEPRNQTAVSEFLLMRLTENEKLKTILFNLFLSMYLVTVLGNLLIILAVIFDSHLHTPMYFFLSHLSFTDIGLSTTIIPKILVNMQAQSQRITYTGCLTQICFVLILVCWESFLLGAMAYDRYVAICHPLRYTVIVNPHLCVMLTLLSLFISIGNALLHTLMVLPLSFCKELEISLFFCEVVQVIKLACSDTLINNALLYFAISLLGGIPVFGIIFSYTKIISSILRQSSVGGKYKTFSTCGSHLSVVSLFYGTGFGVYICSAIPDSPRKTAVASLMYTMVTPTMNPFIYSLRNKDMKGALRKLFSRVPTIL", "length": 312, "header": "tr|A0ABI0P7G4-1|A0ABI0P7G4_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR7G48 PE=3 SV=1 CANONICAL=A0ABI0P7G4-1" }, "locus": { "chromosome": "7", "start_pos": 13484600, "end_pos": 13483665, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000150114.1", "url": "https://www.ensembl.org/id/ENSBTAT00000150114.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107624.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107624.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 282, "start_aa": "Thr", "end_pos": 282, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr282", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G4", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7G4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G4" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 41, "end_pos": 290, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 282 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7G6-1", "uniprot_ac": "A0ABI0P7G6", "uniprot_id": "A0ABI0P7G6_BOVIN", "mass": { "chemical_mass": 35272.0, "monoisotopic_mass": 35272.0 }, "refseq": { "ac": "NP_001377150", "name": "olfactory receptor family 52 subfamily E member 18", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377150" }, "gene_names": [ { "name": "OR52E18", "type": "recommended", "evidence": [ { "id": "A0ABI0P7G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6" } ] }, { "name": "OR52E18", "type": "synonym", "evidence": [ { "id": "NP_001377150", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377150" } ] }, { "name": "OR52E6", "type": "synonym", "evidence": [ { "id": "NP_001377150", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377150" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P7G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor family 52 subfamily E member 18", "type": "synonym", "evidence": [ { "id": "NP_001377150", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377150" } ] }, { "name": "olfactory receptor, family 52, subfamily E, member 6", "type": "synonym", "evidence": [ { "id": "NP_001377150", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377150" } ] } ], "function": [ { "annotation": "Odorant receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6#function" }, { "database": "UniProtKB", "id": "ARBA00002936", "url": "https://www.uniprot.org/uniprotkb/ARBA00002936#function" } ] }, { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377150" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR52E18", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6", "locus": {} } ], "crossref": [ { "id": "cd15952", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15952", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "616261", "url": "https://www.ncbi.nlm.nih.gov/gene/616261", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050402", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050402", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR26450", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26450", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26450:SF115", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26450:SF115", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377150", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377150", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7G6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFPSNATDFHPSSFLLLGVPGLEEMHVWIGFPFCSVYLIALVGNNIILFVIKNTQSLHQPMFYFLAMLACIDLGLSTSTIPKMLGIFWFNLKEISFGGCVTQMFFIHIFTAMETVVLVAMAFDRYVAICNPLRYSLILTNRTIGFILIVVFGVNFILVIPLVFLILRLPFCGHHIIPHTYCEHMGIARLACANIKVNMIFGLILISMVLVDVVLIVISYMRILQAVFSLPSREARRKALNTCGSHICVILVFFTPAFFSFMTHRFGRNVPIYIHILLANLYVVVPPALNPVIYGVRTKQIQERVSSIFLRKG", "length": 312, "header": "tr|A0ABI0P7G6-1|A0ABI0P7G6_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR52E18 PE=3 SV=1 CANONICAL=A0ABI0P7G6-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7G6-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6/entry#A0ABI0P7G6-1", "sequence": { "sequence": "MFPSNATDFHPSSFLLLGVPGLEEMHVWIGFPFCSVYLIALVGNNIILFVIKNTQSLHQPMFYFLAMLACIDLGLSTSTIPKMLGIFWFNLKEISFGGCVTQMFFIHIFTAMETVVLVAMAFDRYVAICNPLRYSLILTNRTIGFILIVVFGVNFILVIPLVFLILRLPFCGHHIIPHTYCEHMGIARLACANIKVNMIFGLILISMVLVDVVLIVISYMRILQAVFSLPSREARRKALNTCGSHICVILVFFTPAFFSFMTHRFGRNVPIYIHILLANLYVVVPPALNPVIYGVRTKQIQERVSSIFLRKG", "length": 312, "header": "tr|A0ABI0P7G6-1|A0ABI0P7G6_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR52E18 PE=3 SV=1 CANONICAL=A0ABI0P7G6-1" }, "locus": { "chromosome": "15", "start_pos": 47228473, "end_pos": 47227538, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139084.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139084.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107120.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107120.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7G6", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 140, "end_pos": 142, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7G6" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 43, "end_pos": 293, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 140, "end_pos": 142 }, { "start_pos": 5, "end_pos": 7 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7H7-1", "uniprot_ac": "A0ABI0P7H7", "uniprot_id": "A0ABI0P7H7_BOVIN", "mass": { "chemical_mass": 35246.0, "monoisotopic_mass": 35246.0 }, "refseq": {}, "gene_names": [ { "name": "OR4K14", "type": "recommended", "evidence": [ { "id": "A0ABI0P7H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P7H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7H7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7H7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR4K14", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7", "locus": {} } ], "crossref": [ { "id": "cd15226", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15226", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050427", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050427", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P7H7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7H7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "IDLQNYSLVSEFVLHGLCTSQHLQKFFFVFFSEIYVVTVLGNLIIVVTVISDPHLRSSPMYFLLGNLSFLDIWLASFATPKMIRDFLSDQKLISFRGCMAQIFFLHFVGGAEMVLLVTMAYDRYVAICKPLHYMTVMSRQTCVGLVLVSWVIGFVHSISQVAFTVNLPYCGPNEVDSFFCDLPLVIKLACLDTYVLGILMISDSGLLSMSCFLLLLISYTVILITVRQRAAGGVSKALSTCSAHIMVVTLFFGPCIFIYVWPFSRFSVDKLLSVFYTIFTPFLNPLIYTLRNKEMKISMKKRRNRHVTFH", "length": 310, "header": "tr|A0ABI0P7H7-1|A0ABI0P7H7_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4K14 PE=3 SV=1 CANONICAL=A0ABI0P7H7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7H7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7/entry#A0ABI0P7H7-1", "sequence": { "sequence": "IDLQNYSLVSEFVLHGLCTSQHLQKFFFVFFSEIYVVTVLGNLIIVVTVISDPHLRSSPMYFLLGNLSFLDIWLASFATPKMIRDFLSDQKLISFRGCMAQIFFLHFVGGAEMVLLVTMAYDRYVAICKPLHYMTVMSRQTCVGLVLVSWVIGFVHSISQVAFTVNLPYCGPNEVDSFFCDLPLVIKLACLDTYVLGILMISDSGLLSMSCFLLLLISYTVILITVRQRAAGGVSKALSTCSAHIMVVTLFFGPCIFIYVWPFSRFSVDKLLSVFYTIFTPFLNPLIYTLRNKEMKISMKKRRNRHVTFH", "length": 310, "header": "tr|A0ABI0P7H7-1|A0ABI0P7H7_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4K14 PE=3 SV=1 CANONICAL=A0ABI0P7H7-1" }, "locus": { "chromosome": "10", "start_pos": 27402983, "end_pos": 27402054, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000140425.1", "url": "https://www.ensembl.org/id/ENSBTAT00000140425.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107149.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107149.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7H7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7H7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7H7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 66, "end_pos": 68, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7H7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7H7" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 41, "end_pos": 288, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 }, { "start_pos": 66, "end_pos": 68 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7J0-1", "uniprot_ac": "A0ABI0P7J0", "uniprot_id": "A0ABI0P7J0_BOVIN", "mass": { "chemical_mass": 34615.0, "monoisotopic_mass": 34615.0 }, "refseq": { "ac": "NP_001377201", "name": "olfactory receptor family 4 subfamily C member 1J", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377201" }, "gene_names": [ { "name": "OR4C1J", "type": "recommended", "evidence": [ { "id": "A0ABI0P7J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0" } ] }, { "name": "OR4C1J", "type": "synonym", "evidence": [ { "id": "NP_001377201", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377201" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P7J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 140", "type": "synonym", "evidence": [ { "id": "NP_001377201", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377201" } ] }, { "name": "olfactory receptor family 4 subfamily C member 1J", "type": "synonym", "evidence": [ { "id": "NP_001377201", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377201" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377201" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7J0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7J0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR4C1J", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0", "locus": {} } ], "crossref": [ { "id": "cd15939", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15939", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "618675", "url": "https://www.ncbi.nlm.nih.gov/gene/618675", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050427", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050427", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377201", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377201", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7J0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7J0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDVLRPPNNVTEFVLLGLTQNPHVQKILFIAFLFIFLFTVLANLLIVITIALSPTLSAPMYFLLTYLAFLDASFTSVTTPKLIVDLLHQRGIISWRGCLTQVFLEHFLAASEVIVLTVMAYDRYVAICKPLHYTTIMRQGLCRLLVVVAWIGGILHATVQVLFTMELTFCGPNVIDHFMCDFFSLLELACSNTYIPGMVVAANSGGMCLLIFSMLLISYIVILSSLRSHGSEGRRRALSTCGAHFTVVVLFFLPCVFTYTRPVATYPVDKWVTMFSAILTPMLNPIIYTVRNVEVKKAMRNLLKRRVV", "length": 308, "header": "tr|A0ABI0P7J0-1|A0ABI0P7J0_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4C1J PE=3 SV=1 CANONICAL=A0ABI0P7J0-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7J0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0/entry#A0ABI0P7J0-1", "sequence": { "sequence": "MDVLRPPNNVTEFVLLGLTQNPHVQKILFIAFLFIFLFTVLANLLIVITIALSPTLSAPMYFLLTYLAFLDASFTSVTTPKLIVDLLHQRGIISWRGCLTQVFLEHFLAASEVIVLTVMAYDRYVAICKPLHYTTIMRQGLCRLLVVVAWIGGILHATVQVLFTMELTFCGPNVIDHFMCDFFSLLELACSNTYIPGMVVAANSGGMCLLIFSMLLISYIVILSSLRSHGSEGRRRALSTCGAHFTVVVLFFLPCVFTYTRPVATYPVDKWVTMFSAILTPMLNPIIYTVRNVEVKKAMRNLLKRRVV", "length": 308, "header": "tr|A0ABI0P7J0-1|A0ABI0P7J0_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4C1J PE=3 SV=1 CANONICAL=A0ABI0P7J0-1" }, "locus": { "chromosome": "15", "start_pos": 78378073, "end_pos": 78377150, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000145533.1", "url": "https://www.ensembl.org/id/ENSBTAT00000145533.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107175.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107175.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7J0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7J0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7J0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 9, "end_pos": 11, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7J0" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 42, "end_pos": 288, "start_aa": "Ala", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 9, "end_pos": 11 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7K7-1", "uniprot_ac": "A0ABI0P7K7", "uniprot_id": "A0ABI0P7K7_BOVIN", "mass": { "chemical_mass": 6876.0, "monoisotopic_mass": 6876.0 }, "refseq": { "ac": "NP_001422120", "name": "lens epithelial cell protein LEP503", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001422120" }, "gene_names": [ { "name": "LENEP", "type": "recommended", "evidence": [ { "id": "A0ABI0P7K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7K7" } ] }, { "name": "LENEP", "type": "synonym", "evidence": [ { "id": "NP_001422120", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001422120" } ] } ], "protein_names": [ { "name": "Lens epithelial protein", "type": "synonym", "evidence": [ { "id": "A0ABI0P7K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7K7/entry#names_and_taxonomy" } ] }, { "name": "lens epithelial cell protein LEP503 pseudogene", "type": "synonym", "evidence": [ { "id": "NP_001422120", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001422120" } ] }, { "name": "lens epithelial cell protein LEP503", "type": "synonym", "evidence": [ { "id": "NP_001422120", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001422120" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7K7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7K7" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LENEP", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7K7", "locus": {} } ], "crossref": [ { "id": "132344831", "url": "https://www.ncbi.nlm.nih.gov/gene/132344831", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR029194", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029194", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR16968", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16968", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR16968:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR16968:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15221", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF15221", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001422120", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001422120", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7K7", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7K7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7K7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7K7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQPRTQPLAQTLPFSLGGVLRDTGLRVPIMKMGTGWEGLQQTLKEIAYILLCCWCIKELLD", "length": 61, "header": "tr|A0ABI0P7K7-1|A0ABI0P7K7_BOVIN Isoform 1 of Lens epithelial protein OS=Bos taurus OX=9913 GN=LENEP PE=4 SV=1 CANONICAL=A0ABI0P7K7-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7K7-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7K7/entry#A0ABI0P7K7-1", "sequence": { "sequence": "MQPRTQPLAQTLPFSLGGVLRDTGLRVPIMKMGTGWEGLQQTLKEIAYILLCCWCIKELLD", "length": 61, "header": "tr|A0ABI0P7K7-1|A0ABI0P7K7_BOVIN Isoform 1 of Lens epithelial protein OS=Bos taurus OX=9913 GN=LENEP PE=4 SV=1 CANONICAL=A0ABI0P7K7-1" }, "locus": { "chromosome": "3", "start_pos": 15603394, "end_pos": 15603212, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152274.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152274.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107565.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107565.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7L9-1", "uniprot_ac": "A0ABI0P7L9", "uniprot_id": "A0ABI0P7L9_BOVIN", "mass": { "chemical_mass": 11283.0, "monoisotopic_mass": 11283.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P7L9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7L9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7L9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7L9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7L9", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050150", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050150", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23267", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23267", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P7L9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7L9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7L9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7L9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "SSQLTQPPAVSVSLGQTASITCQGDDLELLSAHWYQQKPGQAPVLVIYADDNLASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQSADISGMDLGLPGPGSMVFS", "length": 108, "header": "tr|A0ABI0P7L9-1|A0ABI0P7L9_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=1 SV=1 CANONICAL=A0ABI0P7L9-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7L9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7L9/entry#A0ABI0P7L9-1", "sequence": { "sequence": "SSQLTQPPAVSVSLGQTASITCQGDDLELLSAHWYQQKPGQAPVLVIYADDNLASGIPDRFSGSKSDTTATLTIRGAQAEDEADYYCQSADISGMDLGLPGPGSMVFS", "length": 108, "header": "tr|A0ABI0P7L9-1|A0ABI0P7L9_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=1 SV=1 CANONICAL=A0ABI0P7L9-1" }, "locus": { "chromosome": "17", "start_pos": 71093279, "end_pos": 71092768, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000136068.1", "url": "https://www.ensembl.org/id/ENSBTAT00000136068.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107730.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107730.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7L9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7L9" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 1, "end_pos": 88, "start_aa": "Ser", "end_aa": "Gln", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7M8-1", "uniprot_ac": "A0ABI0P7M8", "uniprot_id": "A0ABI0P7M8_BOVIN", "mass": { "chemical_mass": 35057.0, "monoisotopic_mass": 35057.0 }, "refseq": { "ac": "NP_001376971", "name": "olfactory receptor family 10 subfamily T member 1", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376971" }, "gene_names": [ { "name": "OR10T1", "type": "recommended", "evidence": [ { "id": "A0ABI0P7M8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8" } ] }, { "name": "OR10T1", "type": "synonym", "evidence": [ { "id": "NP_001376971", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376971" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P7M8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 10T2", "type": "synonym", "evidence": [ { "id": "NP_001376971", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376971" } ] }, { "name": "olfactory receptor family 10 subfamily T member 1", "type": "synonym", "evidence": [ { "id": "NP_001376971", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376971" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001376971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376971" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7M8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7M8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR10T1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8", "locus": {} } ], "crossref": [ { "id": "cd15225", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15225", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "522554", "url": "https://www.ncbi.nlm.nih.gov/gene/522554", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR26453", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26453", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001376971", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376971", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7M8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7M8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKRQNQSMITEFILIGFSNLGDLQILLFFIFLLVYLTTLTANATIMTVIHLDRALHTPMYFFLFVLSCSETCYTLVIVPKMLTNLLSTAPTISLSGCVAQLYFFVGLACTNCFLIAVMGYDRYVAICNPLNYTLIVSRATCTQLVLASSFCGFLISAVVNVLVFSVPFCSSNQINHFFCDISPVIKLGCTDTNLKEMVIFFLSILVLLVPLVLIFISYVFIVSTILKISSVEGQRKTFATCASHLTVVIVHYGCASFIYLRPTSLYSSDKDRLVAVTYTVITPLLNPLVYTLRNKEVKTALKKVLSRYLLSKTV", "length": 314, "header": "tr|A0ABI0P7M8-1|A0ABI0P7M8_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR10T1 PE=3 SV=1 CANONICAL=A0ABI0P7M8-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7M8-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8/entry#A0ABI0P7M8-1", "sequence": { "sequence": "MKRQNQSMITEFILIGFSNLGDLQILLFFIFLLVYLTTLTANATIMTVIHLDRALHTPMYFFLFVLSCSETCYTLVIVPKMLTNLLSTAPTISLSGCVAQLYFFVGLACTNCFLIAVMGYDRYVAICNPLNYTLIVSRATCTQLVLASSFCGFLISAVVNVLVFSVPFCSSNQINHFFCDISPVIKLGCTDTNLKEMVIFFLSILVLLVPLVLIFISYVFIVSTILKISSVEGQRKTFATCASHLTVVIVHYGCASFIYLRPTSLYSSDKDRLVAVTYTVITPLLNPLVYTLRNKEVKTALKKVLSRYLLSKTV", "length": 314, "header": "tr|A0ABI0P7M8-1|A0ABI0P7M8_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR10T1 PE=3 SV=1 CANONICAL=A0ABI0P7M8-1" }, "locus": { "chromosome": "3", "start_pos": 11560048, "end_pos": 11559107, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139781.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139781.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107470.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107470.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7M8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7M8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7M8", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 131, "end_pos": 133, "annotation": "n_glycosylation_sequon" }, { "start_pos": 42, "end_pos": 44, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7M8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7M8" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 41, "end_pos": 290, "start_aa": "Ala", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 131, "end_pos": 133 }, { "start_pos": 42, "end_pos": 44 }, { "start_pos": 5, "end_pos": 7 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7N3-1", "uniprot_ac": "A0ABI0P7N3", "uniprot_id": "A0ABI0P7N3_BOVIN", "mass": { "chemical_mass": 13138.0, "monoisotopic_mass": 13138.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P7N3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7N3/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7N3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7N3" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7N3", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF19", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF19", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P7N3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7N3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7N3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7N3-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "HAGVSQDPRFQVVKTGQNVTLRCTQDLYHDSMYWYRQDLGLRLRLIRYSSFTDTTYKGDMPDGYSVSRSSTENFPLTLESANRSQTSVYFCASSTPQRCRVTSSLCKKMGEALVGS", "length": 116, "header": "tr|A0ABI0P7N3-1|A0ABI0P7N3_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7N3-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7N3-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7N3/entry#A0ABI0P7N3-1", "sequence": { "sequence": "HAGVSQDPRFQVVKTGQNVTLRCTQDLYHDSMYWYRQDLGLRLRLIRYSSFTDTTYKGDMPDGYSVSRSSTENFPLTLESANRSQTSVYFCASSTPQRCRVTSSLCKKMGEALVGS", "length": 116, "header": "tr|A0ABI0P7N3-1|A0ABI0P7N3_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7N3-1" }, "locus": { "chromosome": "4", "start_pos": 105719519, "end_pos": 105719172, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000152075.1", "url": "https://www.ensembl.org/id/ENSBTAT00000152075.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107756.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107756.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "T cell receptor complex", "id": "GO:0042101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7N3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7N3" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7N3", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7N3" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 18, "end_pos": 20, "annotation": "n_glycosylation_sequon" }, { "start_pos": 82, "end_pos": 84, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7N3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7N3" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 2, "end_pos": 102, "start_aa": "Ala", "end_aa": "Thr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 18, "end_pos": 20 }, { "start_pos": 82, "end_pos": 84 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7Q9-1", "uniprot_ac": "A0ABI0P7Q9", "uniprot_id": "A0ABI0P7Q9_BOVIN", "mass": { "chemical_mass": 15315.0, "monoisotopic_mass": 15315.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P7Q9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7Q9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7Q9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7Q9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7Q9", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051896", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051896", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR19339", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19339", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19339:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19339:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P7Q9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7Q9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7Q9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7Q9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKRKWGALLGFLWVQICWVRGVKVEQSPSVLSLQEGANSTLRCNFSETVSSVQWFQQNPGGSLISLFFIASGMKQNERMSSTVNSKERYSTLHITASQLEDAATYLCVVEAQCSQAACSLYPNCSCLSPSPPQYYTVQ", "length": 138, "header": "tr|A0ABI0P7Q9-1|A0ABI0P7Q9_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7Q9-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7Q9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7Q9/entry#A0ABI0P7Q9-1", "sequence": { "sequence": "MKRKWGALLGFLWVQICWVRGVKVEQSPSVLSLQEGANSTLRCNFSETVSSVQWFQQNPGGSLISLFFIASGMKQNERMSSTVNSKERYSTLHITASQLEDAATYLCVVEAQCSQAACSLYPNCSCLSPSPPQYYTVQ", "length": 138, "header": "tr|A0ABI0P7Q9-1|A0ABI0P7Q9_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P7Q9-1" }, "locus": { "chromosome": "10", "start_pos": 22974480, "end_pos": 22973868, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000144053.1", "url": "https://www.ensembl.org/id/ENSBTAT00000144053.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107285.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107285.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "T cell receptor complex", "id": "GO:0042101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7Q9", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7Q9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 123, "end_pos": 125, "annotation": "n_glycosylation_sequon" }, { "start_pos": 38, "end_pos": 40, "annotation": "n_glycosylation_sequon" }, { "start_pos": 44, "end_pos": 46, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7Q9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7Q9" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 22, "end_pos": 119, "start_aa": "Val", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 123, "end_pos": 125 }, { "start_pos": 38, "end_pos": 40 }, { "start_pos": 44, "end_pos": 46 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7T5-1", "uniprot_ac": "A0ABI0P7T5", "uniprot_id": "A0ABI0P7T5_BOVIN", "mass": { "chemical_mass": 35294.0, "monoisotopic_mass": 35294.0 }, "refseq": { "ac": "NP_001377479", "name": "olfactory receptor family 6 subfamily C member 33", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377479" }, "gene_names": [ { "name": "OR6C33", "type": "recommended", "evidence": [ { "id": "A0ABI0P7T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5" } ] }, { "name": "OR6C33", "type": "synonym", "evidence": [ { "id": "NP_001377479", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377479" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P7T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor family 6 subfamily C member 33", "type": "synonym", "evidence": [ { "id": "NP_001377479", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377479" } ] }, { "name": "olfactory receptor, family 6, subfamily C, member 4-like", "type": "synonym", "evidence": [ { "id": "NP_001377479", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377479" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001377479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377479" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR6C33", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5", "locus": {} } ], "crossref": [ { "id": "cd15912", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15912", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "788242", "url": "https://www.ncbi.nlm.nih.gov/gene/788242", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047132", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047132", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR26454", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26454", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR26454:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26454:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001377479", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001377479", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7T5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGNQTSVIEFILLGLTSDAKLQAVLFLFLLLTYVLNIMGNLTIIILTLLDHRLQTPMYFFLRNFSVLEVSFTSVFVPKMLVSIGTGDKTISFAGCFTQYFFAILLGATEFYLLAAMSFDRYVAICKPLHYTTLMSRRLCIQLVLCSWFSGFLVVIVPHVMTLQLPFCASNIINHYCCDYTVLLHLSCSDTRFIEVIEFVLAAVTLIFTLMLVILSYTYIIRTILRIPSAQKRKKAFSTCSSHMIVVSLSYGSCIFMYINPSVEDAATFNKGVAVLNTSVAPLLNPFIYTLRNKQVKIAFRHLVSKIITFSRK", "length": 312, "header": "tr|A0ABI0P7T5-1|A0ABI0P7T5_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR6C33 PE=3 SV=1 CANONICAL=A0ABI0P7T5-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7T5-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5/entry#A0ABI0P7T5-1", "sequence": { "sequence": "MGNQTSVIEFILLGLTSDAKLQAVLFLFLLLTYVLNIMGNLTIIILTLLDHRLQTPMYFFLRNFSVLEVSFTSVFVPKMLVSIGTGDKTISFAGCFTQYFFAILLGATEFYLLAAMSFDRYVAICKPLHYTTLMSRRLCIQLVLCSWFSGFLVVIVPHVMTLQLPFCASNIINHYCCDYTVLLHLSCSDTRFIEVIEFVLAAVTLIFTLMLVILSYTYIIRTILRIPSAQKRKKAFSTCSSHMIVVSLSYGSCIFMYINPSVEDAATFNKGVAVLNTSVAPLLNPFIYTLRNKQVKIAFRHLVSKIITFSRK", "length": 312, "header": "tr|A0ABI0P7T5-1|A0ABI0P7T5_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR6C33 PE=3 SV=1 CANONICAL=A0ABI0P7T5-1" }, "locus": { "chromosome": "5", "start_pos": 59076405, "end_pos": 59075470, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000138630.1", "url": "https://www.ensembl.org/id/ENSBTAT00000138630.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107670.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107670.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7T5", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 276, "end_pos": 278, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3, "end_pos": 5, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 63, "end_pos": 65, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7T5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7T5" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 39, "end_pos": 288, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 276, "end_pos": 278 }, { "start_pos": 3, "end_pos": 5 }, { "start_pos": 40, "end_pos": 42 }, { "start_pos": 63, "end_pos": 65 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7U2-1", "uniprot_ac": "A0ABI0P7U2", "uniprot_id": "A0ABI0P7U2_BOVIN", "mass": { "chemical_mass": 34457.0, "monoisotopic_mass": 34457.0 }, "refseq": { "ac": "NP_001376995", "name": "olfactory receptor family 4 subfamily C member 1E", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376995" }, "gene_names": [ { "name": "OR4C1E", "type": "recommended", "evidence": [ { "id": "A0ABI0P7U2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2" } ] }, { "name": "OR4C1E", "type": "synonym", "evidence": [ { "id": "NP_001376995", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376995" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P7U2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 140", "type": "synonym", "evidence": [ { "id": "NP_001376995", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376995" } ] }, { "name": "olfactory receptor family 4 subfamily C member 1E", "type": "synonym", "evidence": [ { "id": "NP_001376995", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376995" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001376995", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376995" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7U2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7U2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR4C1E", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2", "locus": {} } ], "crossref": [ { "id": "cd15939", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15939", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "524702", "url": "https://www.ncbi.nlm.nih.gov/gene/524702", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050427", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050427", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR48002", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48002", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001376995", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376995", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7U2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7U2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDVLRPPSNVTEFVLLGLTQNPHLQKILFVVFLLIFLFTVLANLLIVITISFSPTLSAPMYFFLTYLAFIDASFTSVTTPKITIDLLYQRTTISWGGCLTQLFLVHFLGATEVIVLIVMAYDRYVAICKPLHYTAIMRQGLCQLLVVVAWIGGIMHATVQILFMVNLTFCGLYVIDHFMCDFFSLLEIACGNTYKIGIIVAANSGAMCLLIFSMLLISYIVILSSLKSHGSEGRHKALSTCGAHFTVVVLYFVPCIFSYTRPVTTYSADKLVTVFFAILTPMLNPIIYTVRNIEVKNAMSSLFKRNVM", "length": 308, "header": "tr|A0ABI0P7U2-1|A0ABI0P7U2_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4C1E PE=3 SV=1 CANONICAL=A0ABI0P7U2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7U2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2/entry#A0ABI0P7U2-1", "sequence": { "sequence": "MDVLRPPSNVTEFVLLGLTQNPHLQKILFVVFLLIFLFTVLANLLIVITISFSPTLSAPMYFFLTYLAFIDASFTSVTTPKITIDLLYQRTTISWGGCLTQLFLVHFLGATEVIVLIVMAYDRYVAICKPLHYTAIMRQGLCQLLVVVAWIGGIMHATVQILFMVNLTFCGLYVIDHFMCDFFSLLEIACGNTYKIGIIVAANSGAMCLLIFSMLLISYIVILSSLKSHGSEGRHKALSTCGAHFTVVVLYFVPCIFSYTRPVTTYSADKLVTVFFAILTPMLNPIIYTVRNIEVKNAMSSLFKRNVM", "length": 308, "header": "tr|A0ABI0P7U2-1|A0ABI0P7U2_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR4C1E PE=3 SV=1 CANONICAL=A0ABI0P7U2-1" }, "locus": { "chromosome": "19", "start_pos": 182539, "end_pos": 181616, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000146650.1", "url": "https://www.ensembl.org/id/ENSBTAT00000146650.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107575.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107575.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7U2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7U2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7U2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 166, "end_pos": 168, "annotation": "n_glycosylation_sequon" }, { "start_pos": 9, "end_pos": 11, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7U2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7U2" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 42, "end_pos": 288, "start_aa": "Ala", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 166, "end_pos": 168 }, { "start_pos": 9, "end_pos": 11 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P7W0-1", "uniprot_ac": "A0ABI0P7W0", "uniprot_id": "A0ABI0P7W0_BOVIN", "mass": { "chemical_mass": 36228.0, "monoisotopic_mass": 36228.0 }, "refseq": { "ac": "NP_001376837", "name": "olfactory receptor family 12 subfamily D member 21", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376837" }, "gene_names": [ { "name": "OR12D21", "type": "recommended", "evidence": [ { "id": "A0ABI0P7W0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0" } ] }, { "name": "OR12D21", "type": "synonym", "evidence": [ { "id": "NP_001376837", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376837" } ] } ], "protein_names": [ { "name": "Olfactory receptor", "type": "recommended", "evidence": [ { "id": "A0ABI0P7W0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0/entry#names_and_taxonomy" } ] }, { "name": "olfactory receptor 12D3", "type": "synonym", "evidence": [ { "id": "NP_001376837", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376837" } ] }, { "name": "olfactory receptor family 12 subfamily D member 21", "type": "synonym", "evidence": [ { "id": "NP_001376837", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376837" } ] } ], "function": [ { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001376837", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376837" } ] }, { "annotation": "Putative odorant or sperm cell receptor.", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7W0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0#function" }, { "database": "UniProtKB", "id": "ARBA00003929", "url": "https://www.uniprot.org/uniprotkb/ARBA00003929#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7W0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "OR12D21", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0", "locus": {} } ], "crossref": [ { "id": "cd15915", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15915", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "512579", "url": "https://www.ncbi.nlm.nih.gov/gene/512579", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050516", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050516", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR26452", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR26452", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF13853", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "NP_001376837", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001376837", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0ABI0P7W0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P7W0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MENVTTVNEFLLLELTSTQELQPVLFVTLLIIYMIDLFGNGSILVVVILEPRLYSPMYFFLGNLSCLDICYSSVTLPILMANLLSAHKAVSFLGCITQLHFFHFLGCTESILLAIMGFDRFVAICYPLRYTLIMNLKACILLATVAWITSFFYALMHSVMTARLNFCHSLKLNHFFCDVKPLLELACGDIRLNQWLIFIVTGSLAMIPCFFTFLSYLYIISFLLFKNHTCRVLHKALSTCASHLMVVSLFYGTVGLTYIAPTSATSVIQEWYVTVIHTTVTSLLNPLIYTLRNKEVKLALSRVFGRKLKLPKENHWQH", "length": 318, "header": "tr|A0ABI0P7W0-1|A0ABI0P7W0_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR12D21 PE=3 SV=1 CANONICAL=A0ABI0P7W0-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P7W0-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0/entry#A0ABI0P7W0-1", "sequence": { "sequence": "MENVTTVNEFLLLELTSTQELQPVLFVTLLIIYMIDLFGNGSILVVVILEPRLYSPMYFFLGNLSCLDICYSSVTLPILMANLLSAHKAVSFLGCITQLHFFHFLGCTESILLAIMGFDRFVAICYPLRYTLIMNLKACILLATVAWITSFFYALMHSVMTARLNFCHSLKLNHFFCDVKPLLELACGDIRLNQWLIFIVTGSLAMIPCFFTFLSYLYIISFLLFKNHTCRVLHKALSTCASHLMVVSLFYGTVGLTYIAPTSATSVIQEWYVTVIHTTVTSLLNPLIYTLRNKEVKLALSRVFGRKLKLPKENHWQH", "length": 318, "header": "tr|A0ABI0P7W0-1|A0ABI0P7W0_BOVIN Isoform 1 of Olfactory receptor OS=Bos taurus OX=9913 GN=OR12D21 PE=3 SV=1 CANONICAL=A0ABI0P7W0-1" }, "locus": { "chromosome": "23", "start_pos": 29359395, "end_pos": 29358442, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000154461.1", "url": "https://www.ensembl.org/id/ENSBTAT00000154461.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107724.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107724.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 262, "start_aa": "Thr", "end_pos": 262, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr262", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7W0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7W0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P7W0", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 227, "end_pos": 229, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3, "end_pos": 5, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 63, "end_pos": 65, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P7W0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P7W0" }, { "id": "PS50262", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50262" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "G-protein coupled receptors family 1 profile", "eco_id": "ECO_0000259", "start_pos": 39, "end_pos": 289, "start_aa": "Gly", "end_aa": "Tyr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 262 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 227, "end_pos": 229 }, { "start_pos": 3, "end_pos": 5 }, { "start_pos": 40, "end_pos": 42 }, { "start_pos": 63, "end_pos": 65 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P800-1", "uniprot_ac": "A0ABI0P800", "uniprot_id": "A0ABI0P800_BOVIN", "mass": { "chemical_mass": 36481.0, "monoisotopic_mass": 36481.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Testis-specific Y-encoded protein 1", "type": "recommended", "evidence": [ { "id": "A0ABI0P800", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P800/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P800", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P800" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P800", "locus": {} } ], "crossref": [ { "id": "IPR002164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11875", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11875", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00956", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00956", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P800", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P800", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P800-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P800-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRPFASAPARGHRQGQEERERRSEEGGSVPGPRTFQVVSPVVTPGQEATLFRVEAVEEGEALVDGDVAGIGREFQLLAEDIVEEVEVVADEEQEQRPSQELEEKTVEEQGQERPGGPCERQELDALQALAALQVELSSEREQNRRAYVQFMRKNHQRRKRHLARRSAIIQGIPGFWAKAIMSHPQVSVLISDQDQDFLGYMMDLKVQVRSHPPSRCKLIFSFWDNPYFLNSVIIKEYYLDITGYRARRSTPVHWFWDFERGAPSRRLDTRSLNFLNWLSGHNGPESNRIAEIISEDVWDDPLKYYLREEGSSVRDN", "length": 317, "header": "tr|A0ABI0P800-1|A0ABI0P800_BOVIN Isoform 1 of Testis-specific Y-encoded protein 1 OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P800-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P800-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P800/entry#A0ABI0P800-1", "sequence": { "sequence": "MSRPFASAPARGHRQGQEERERRSEEGGSVPGPRTFQVVSPVVTPGQEATLFRVEAVEEGEALVDGDVAGIGREFQLLAEDIVEEVEVVADEEQEQRPSQELEEKTVEEQGQERPGGPCERQELDALQALAALQVELSSEREQNRRAYVQFMRKNHQRRKRHLARRSAIIQGIPGFWAKAIMSHPQVSVLISDQDQDFLGYMMDLKVQVRSHPPSRCKLIFSFWDNPYFLNSVIIKEYYLDITGYRARRSTPVHWFWDFERGAPSRRLDTRSLNFLNWLSGHNGPESNRIAEIISEDVWDDPLKYYLREEGSSVRDN", "length": 317, "header": "tr|A0ABI0P800-1|A0ABI0P800_BOVIN Isoform 1 of Testis-specific Y-encoded protein 1 OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P800-1" }, "locus": { "chromosome": "Y", "start_pos": 9216281, "end_pos": 9214064, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000138786.1", "url": "https://www.ensembl.org/id/ENSBTAT00000138786.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107441.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107441.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P800", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P800" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "nucleosome assembly", "id": "GO:0006334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006334", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P800", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P800" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 44 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P801-1", "uniprot_ac": "A0ABI0P801", "uniprot_id": "A0ABI0P801_BOVIN", "mass": { "chemical_mass": 36432.0, "monoisotopic_mass": 36432.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Testis-specific Y-encoded protein 1-like", "type": "recommended", "evidence": [ { "id": "A0ABI0P801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P801/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P801", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P801" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P801", "locus": {} } ], "crossref": [ { "id": "IPR002164", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002164", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11875", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11875", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00956", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00956", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P801", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P801", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P801-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P801-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSRPFASAPARGHRQGQEERERRSEEGGSVPGPRTFQAVSPVVTPGQEATLFRVEAVEEGEALVDGDVAGIGREFQLLAEDIVEEVEVVADEEQEQRPSQELEEKTVEEQGQERPGGPCERQELDALQALAALQVELSSEREQNRRAYVQFMRKNHQRRKCHLARRSAIIQGIPGFWAKAIMSHPQVSVLISDQDQDFLGYMMDLKVQVWSHPPSRCKLIFSFRDNPYFLNSVIIKEYYLDITGYRARRSTPVHWFWDFERGAPSRRLDTRSLNFLNWLSGHNGPESNRIAEIISEDVWDDPLKYYLREEGSSMRDN", "length": 317, "header": "tr|A0ABI0P801-1|A0ABI0P801_BOVIN Isoform 1 of Testis-specific Y-encoded protein 1-like OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P801-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P801-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P801/entry#A0ABI0P801-1", "sequence": { "sequence": "MSRPFASAPARGHRQGQEERERRSEEGGSVPGPRTFQAVSPVVTPGQEATLFRVEAVEEGEALVDGDVAGIGREFQLLAEDIVEEVEVVADEEQEQRPSQELEEKTVEEQGQERPGGPCERQELDALQALAALQVELSSEREQNRRAYVQFMRKNHQRRKCHLARRSAIIQGIPGFWAKAIMSHPQVSVLISDQDQDFLGYMMDLKVQVWSHPPSRCKLIFSFRDNPYFLNSVIIKEYYLDITGYRARRSTPVHWFWDFERGAPSRRLDTRSLNFLNWLSGHNGPESNRIAEIISEDVWDDPLKYYLREEGSSMRDN", "length": 317, "header": "tr|A0ABI0P801-1|A0ABI0P801_BOVIN Isoform 1 of Testis-specific Y-encoded protein 1-like OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=A0ABI0P801-1" }, "locus": { "chromosome": "Y", "start_pos": 10631336, "end_pos": 10629093, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000151458.1", "url": "https://www.ensembl.org/id/ENSBTAT00000151458.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107679.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107679.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "prediction_tool_list": [ { "label": "isoglyp", "url": "https://github.com/jonmohl/ISOGlyP" } ], "site_category": "predicted", "site_category_dict": { "predicted": true }, "site_seq": "", "relation": "attached", "comment": "", "icn3d_view": {}, "start_pos": 44, "start_aa": "Thr", "end_pos": 44, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr44", "evidence": [ { "id": "", "database": "GlyGen", "url": "https://data.glygen.org/" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P801", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P801" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "nucleosome assembly", "id": "GO:0006334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006334", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P801", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P801" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 44 ], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 1 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "exact_sites", "count": 1 }, { "field": "exact_o_linked_sites", "count": 1 }, { "field": "fuzzy_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P822-1", "uniprot_ac": "A0ABI0P822", "uniprot_id": "A0ABI0P822_BOVIN", "mass": { "chemical_mass": 13585.0, "monoisotopic_mass": 13585.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P822/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P822", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P822" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P822", "locus": {} } ], "crossref": [ { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050413", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050413", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23268:SF46", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23268:SF46", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P822", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P822", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P822-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P822-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDTEVTQSPGHLVKGKGQKAKMDCVPIKGHVHVYWYHKKPEGAFEFLVYLWNGKVTEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQSTVLHVSSSSNTNSPWTQLRKSVVL", "length": 122, "header": "tr|A0ABI0P822-1|A0ABI0P822_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P822-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P822-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P822/entry#A0ABI0P822-1", "sequence": { "sequence": "MDTEVTQSPGHLVKGKGQKAKMDCVPIKGHVHVYWYHKKPEGAFEFLVYLWNGKVTEDTAMFKQRFSAECPQNSPCSLEINSTEAADSALYFCASSQSTVLHVSSSSNTNSPWTQLRKSVVL", "length": 122, "header": "tr|A0ABI0P822-1|A0ABI0P822_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P822-1" }, "locus": { "chromosome": "4", "start_pos": 105987299, "end_pos": 105986934, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000137803.1", "url": "https://www.ensembl.org/id/ENSBTAT00000137803.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107733.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107733.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "immune system process", "id": "GO:0002376", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002376", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P822", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P822" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 81, "end_pos": 83, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P822", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P822" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 3, "end_pos": 104, "start_aa": "Thr", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 81, "end_pos": 83 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABI0P8I2-1", "uniprot_ac": "A0ABI0P8I2", "uniprot_id": "A0ABI0P8I2_BOVIN", "mass": { "chemical_mass": 13437.0, "monoisotopic_mass": 13437.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Ig-like domain-containing protein", "type": "recommended", "evidence": [ { "id": "A0ABI0P8I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P8I2/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P8I2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P8I2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P8I2", "locus": {} } ], "crossref": [ { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051896", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051896", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR19339", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19339", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19339:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19339:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABI0P8I2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P8I2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABI0P8I2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P8I2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "GVDVEQRPPVLSLQEGANSTLQCNFSTYPQNVNWYLKNPGGRLIHLVYVPSGTKQFGRLTATTVPTELRSSLHISSSQTTDSGTYFCAVQHSAPQAPAASTQTLRGLSPSSSHSHTVKPPQGICSA", "length": 126, "header": "tr|A0ABI0P8I2-1|A0ABI0P8I2_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P8I2-1" }, "isoforms": [ { "isoform_ac": "A0ABI0P8I2-1", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P8I2/entry#A0ABI0P8I2-1", "sequence": { "sequence": "GVDVEQRPPVLSLQEGANSTLQCNFSTYPQNVNWYLKNPGGRLIHLVYVPSGTKQFGRLTATTVPTELRSSLHISSSQTTDSGTYFCAVQHSAPQAPAASTQTLRGLSPSSSHSHTVKPPQGICSA", "length": 126, "header": "tr|A0ABI0P8I2-1|A0ABI0P8I2_BOVIN Isoform 1 of Ig-like domain-containing protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=A0ABI0P8I2-1" }, "locus": { "chromosome": "10", "start_pos": 22914506, "end_pos": 22914129, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000150724.1", "url": "https://www.ensembl.org/id/ENSBTAT00000150724.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000107758.1", "url": "https://www.ensembl.org/id/ENSBTAP00000107758.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "T cell receptor complex", "id": "GO:0042101", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042101", "evidence": [ { "database": "UniProtKB", "id": "A0ABI0P8I2", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P8I2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 18, "end_pos": 20, "annotation": "n_glycosylation_sequon" }, { "start_pos": 24, "end_pos": 26, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "A0ABI0P8I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABI0P8I2" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 2, "end_pos": 105, "start_aa": "Val", "end_aa": "Arg", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 18, "end_pos": 20 }, { "start_pos": 24, "end_pos": 26 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "A0ABZ3NNI9-1", "uniprot_ac": "A0ABZ3NNI9", "uniprot_id": "A0ABZ3NNI9_BOVIN", "mass": { "chemical_mass": 19430.0, "monoisotopic_mass": 19430.0 }, "refseq": {}, "gene_names": [ { "name": "PTMS", "type": "recommended", "evidence": [ { "id": "A0ABZ3NNI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNI9" } ] } ], "protein_names": [ { "name": "Parathymosin", "type": "synonym", "evidence": [ { "id": "A0ABZ3NNI9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNI9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "A0ABZ3NNI9", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNI9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "PTMS", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNI9", "locus": { "chromosome": "5", "start_pos": 103674103, "end_pos": 103678727, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000018451", "url": "https://www.ensembl.org/id/ENSBTAG00000018451" } ] } } ], "crossref": [ { "id": "ENSBTAG00000018451", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000018451", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "IPR004931", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004931", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:613777", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:613777", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "HEEKSAH", "url": "https://omabrowser.org/oma/group/HEEKSAH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR22745", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22745", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22745:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22745:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF03247", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF03247", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "A0ABZ3NNI9", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNI9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0ABZ3NNI9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNI9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRVSAPDPPPPHPARLCRLFLSPSLPSGRRCRCRRRRRHRARFRPRPASAVQGPSVQAPGPRLPASPGPGPGTMSEKSVEAAAELSAKDLKEKKEKVEEKAGRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGDEEDEEEEEDEDEGPALKRAAEEEDEADPKRQKTENGASA", "length": 175, "header": "tr|A0ABZ3NNI9-1|A0ABZ3NNI9_BOVIN Isoform 1 of Parathymosin OS=Bos taurus OX=9913 GN=PTMS PE=3 SV=1 CANONICAL=A0ABZ3NNI9-1" }, "isoforms": [ { "isoform_ac": "A0ABZ3NNI9-1", "url": "https://www.uniprot.org/uniprotkb/A0ABZ3NNI9/entry#A0ABZ3NNI9-1", "sequence": { "sequence": "MRVSAPDPPPPHPARLCRLFLSPSLPSGRRCRCRRRRRHRARFRPRPASAVQGPSVQAPGPRLPASPGPGPGTMSEKSVEAAAELSAKDLKEKKEKVEEKAGRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGDEEDEEEEEDEDEGPALKRAAEEEDEADPKRQKTENGASA", "length": 175, "header": "tr|A0ABZ3NNI9-1|A0ABZ3NNI9_BOVIN Isoform 1 of Parathymosin OS=Bos taurus OX=9913 GN=PTMS PE=3 SV=1 CANONICAL=A0ABZ3NNI9-1" }, "locus": { "chromosome": "5", "start_pos": 103678747, "end_pos": 103674611, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000024555.7", "url": "https://www.ensembl.org/id/ENSBTAT00000024555.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000024555.7", "url": "https://www.ensembl.org/id/ENSBTAP00000024555.7" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:613777", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:613777", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "V9GVP2-1", "uniprot_ac": "V9GVP2", "uniprot_id": "V9GVP2_BOVIN", "mass": { "chemical_mass": 53875.0, "monoisotopic_mass": 53875.0 }, "refseq": { "ac": "XP_059740043", "name": "U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740043" }, "gene_names": [ { "name": "ZRSR2Y", "type": "recommended", "evidence": [ { "id": "V9GVP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/V9GVP2" } ] }, { "name": "ZRSR2Y", "type": "synonym", "evidence": [ { "id": "XP_059740043", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740043" } ] } ], "protein_names": [ { "name": "Zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2", "type": "recommended", "evidence": [ { "id": "V9GVP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/V9GVP2/entry#names_and_taxonomy" } ] }, { "name": "U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2", "type": "synonym", "evidence": [ { "id": "XP_059740043", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740043" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "V9GVP2", "url": "https://www.uniprot.org/uniprotkb/V9GVP2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "ZRSR2Y", "url": "https://www.uniprot.org/uniprotkb/V9GVP2", "locus": {} } ], "crossref": [ { "id": "cd12540", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12540", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "100306950", "url": "https://www.ncbi.nlm.nih.gov/gene/100306950", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000504", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000504", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000571", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000571", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003954", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003954", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009145", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009145", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:100306950", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:100306950", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR12620", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12620", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00076", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00076", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF00642", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00642", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_059740043", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_059740043", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "V9GVP2", "url": "https://www.uniprot.org/uniprotkb/V9GVP2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GVP2-1", "url": "https://www.uniprot.org/uniprotkb/V9GVP2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEKVAARELFPKTQGHKKYRAFLKKEKRKKRRRELARLRDSGLSQKEEENPAVIEKQLKEEKLLELERQNLHDEWLLREQKAQEEFRIKKEKEETARKQEEEQETNLKEKWEEHQRREREEKEQKQQGKREEEEPVQKMLKQAENELESGTIWHNPEPPMEIRIMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCGRDDYDPDANLEYSEEEIYQQFLDFYDDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTQWNMAICGLFEIQQCPRGKYCNFLHVFRNPNNEFCEGNEDIYLPPIWTGSTFGKSSVRRVRLDHHDDYYNLQRRRRSPVWAHSYKRKDEADRKRRSSHEGEKSQKHGSRSRGRHSSQSSGRKRDHSSRNSSQSSSMSRGGRRLGSRD", "length": 452, "header": "tr|V9GVP2-1|V9GVP2_BOVIN Isoform 1 of Zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2 OS=Bos taurus OX=9913 GN=ZRSR2Y PE=4 SV=1 CANONICAL=V9GVP2-1" }, "isoforms": [ { "isoform_ac": "V9GVP2-1", "url": "https://www.uniprot.org/uniprotkb/V9GVP2/entry#V9GVP2-1", "sequence": { "sequence": "MEKVAARELFPKTQGHKKYRAFLKKEKRKKRRRELARLRDSGLSQKEEENPAVIEKQLKEEKLLELERQNLHDEWLLREQKAQEEFRIKKEKEETARKQEEEQETNLKEKWEEHQRREREEKEQKQQGKREEEEPVQKMLKQAENELESGTIWHNPEPPMEIRIMEKDRANCPFYSKTGACRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCGRDDYDPDANLEYSEEEIYQQFLDFYDDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCEFCPVTQWNMAICGLFEIQQCPRGKYCNFLHVFRNPNNEFCEGNEDIYLPPIWTGSTFGKSSVRRVRLDHHDDYYNLQRRRRSPVWAHSYKRKDEADRKRRSSHEGEKSQKHGSRSRGRHSSQSSGRKRDHSSRNSSQSSSMSRGGRRLGSRD", "length": 452, "header": "tr|V9GVP2-1|V9GVP2_BOVIN Isoform 1 of Zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2 OS=Bos taurus OX=9913 GN=ZRSR2Y PE=4 SV=1 CANONICAL=V9GVP2-1" }, "locus": { "chromosome": "Y", "start_pos": 7381764, "end_pos": 7326392, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000150999.1", "url": "https://www.ensembl.org/id/ENSBTAT00000150999.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104829.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104829.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:100306950", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:100306950", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "V9GVP2", "url": "https://www.uniprot.org/uniprotkb/V9GVP2" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "V9GVP2", "url": "https://www.uniprot.org/uniprotkb/V9GVP2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mRNA splicing, via spliceosome", "id": "GO:0000398", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000398", "evidence": [ { "database": "UniProtKB", "id": "V9GVP2", "url": "https://www.uniprot.org/uniprotkb/V9GVP2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "V9GVP2", "url": "https://www.uniprot.org/uniprotkb/V9GVP2" } ], "pmid": "" }, { "name": "U2AF complex", "id": "GO:0089701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0089701", "evidence": [ { "database": "UniProtKB", "id": "V9GVP2", "url": "https://www.uniprot.org/uniprotkb/V9GVP2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 434, "end_pos": 436, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "V9GVP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/V9GVP2" }, { "id": "PS50103", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50103" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "C3H1-type", "eco_id": "ECO_0000259", "start_pos": 166, "end_pos": 194, "start_aa": "Glu", "end_aa": "Pro", "glycosite_overlap": "" }, { "evidence": [ { "id": "V9GVP2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/V9GVP2" }, { "id": "PS50102", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50102" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "RRM", "eco_id": "ECO_0000259", "start_pos": 198, "end_pos": 304, "start_aa": "Pro", "end_aa": "Val", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 434, "end_pos": 436 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6PNN2-1", "uniprot_ac": "F6PNN2", "uniprot_id": "F6PNN2_BOVIN", "mass": { "chemical_mass": 36769.0, "monoisotopic_mass": 36769.0 }, "refseq": { "ac": "XP_005203591", "name": "death effector domain-containing protein isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005203591" }, "gene_names": [ { "name": "DEDD", "type": "recommended", "evidence": [ { "id": "F6PNN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6PNN2" } ] }, { "name": "DEDD", "type": "synonym", "evidence": [ { "id": "XP_005203591", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005203591" } ] } ], "protein_names": [ { "name": "Death effector domain-containing protein", "type": "recommended", "evidence": [ { "id": "F6PNN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6PNN2/entry#names_and_taxonomy" } ] }, { "name": "death effector domain-containing protein isoform X1", "type": "synonym", "evidence": [ { "id": "XP_005203591", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005203591" } ] } ], "function": [ { "annotation": "A scaffold protein that directs CASP3 to certain substrates and facilitates their ordered degradation during apoptosis. May also play a role in mediating CASP3 cleavage of KRT18. Regulates degradation of intermediate filaments during apoptosis. May play a role in the general transcription machinery in the nucleus and might be an important regulator of the activity of GTF3C3. Inhibits DNA transcription in vitro.", "evidence": [ { "database": "UniProtKB", "id": "F6PNN2", "url": "https://www.uniprot.org/uniprotkb/F6PNN2#function" }, { "database": "UniProtKB", "id": "ARBA00056861", "url": "https://www.uniprot.org/uniprotkb/ARBA00056861#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6PNN2", "url": "https://www.uniprot.org/uniprotkb/F6PNN2" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "DEDD", "url": "https://www.uniprot.org/uniprotkb/F6PNN2", "locus": { "chromosome": "3", "start_pos": 8373311, "end_pos": 8362999, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000020154", "url": "https://www.ensembl.org/id/ENSBTAG00000020154" } ] } } ], "crossref": [ { "id": "ENSBTAG00000020154", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000020154", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd08790", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08790", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "538428", "url": "https://www.ncbi.nlm.nih.gov/gene/538428", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR001875", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001875", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011029", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011029", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038856", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038856", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR049341", "url": "https://www.ebi.ac.uk/interpro/entry/IPR049341", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:538428", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:538428", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR15205", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15205", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15205:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15205:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01335", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01335", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF20694", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF20694", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_005203591", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005203591", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F6PNN2", "url": "https://www.uniprot.org/uniprotkb/F6PNN2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6PNN2-1", "url": "https://www.uniprot.org/uniprotkb/F6PNN2-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGLIRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSVRYVTPRALSDPEPRPPHPPKTVPPHYPVVCCPASGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEEDYELGRQKLLRNLMLQALP", "length": 318, "header": "tr|F6PNN2-1|F6PNN2_BOVIN Isoform 1 of Death effector domain-containing protein OS=Bos taurus OX=9913 GN=DEDD PE=4 SV=1 CANONICAL=F6PNN2-1" }, "isoforms": [ { "isoform_ac": "F6PNN2-1", "url": "https://www.uniprot.org/uniprotkb/F6PNN2/entry#F6PNN2-1", "sequence": { "sequence": "MAGLKRRASQVWPEEHGEQEHGLYSLHRMFDIVGTHLTHRDVRVLSFLFVDVIDDHERGLIRNGRDFLLALERQGRCDESNFRQVLQLLRIITRHDLLPYVTLKRRRAVCPDLVDKYLEETSVRYVTPRALSDPEPRPPHPPKTVPPHYPVVCCPASGPQMCSKRPARGRATLGSQRKRRKSVTPDPKEKQTCDIRLRVRAEYCQHETALQGNVFSNKQDPLERQFERFNQANTILKSRDLGSIICDIKFSELTYLDAFWRDYINGSLLEALKGVFITDSLKQAVGHEAIKLLVNVDEEDYELGRQKLLRNLMLQALP", "length": 318, "header": "tr|F6PNN2-1|F6PNN2_BOVIN Isoform 1 of Death effector domain-containing protein OS=Bos taurus OX=9913 GN=DEDD PE=4 SV=1 CANONICAL=F6PNN2-1" }, "locus": { "chromosome": "3", "start_pos": 8372821, "end_pos": 8370615, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000026845.6", "url": "https://www.ensembl.org/id/ENSBTAT00000026845.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000026845.5", "url": "https://www.ensembl.org/id/ENSBTAP00000026845.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:538428", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:538428", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "F6PNN2", "url": "https://www.uniprot.org/uniprotkb/F6PNN2" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "F6PNN2", "url": "https://www.uniprot.org/uniprotkb/F6PNN2" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "F6PNN2", "url": "https://www.uniprot.org/uniprotkb/F6PNN2" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "F6PNN2", "url": "https://www.uniprot.org/uniprotkb/F6PNN2" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "F6PNN2", "url": "https://www.uniprot.org/uniprotkb/F6PNN2" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 265, "end_pos": 267, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "F6PNN2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6PNN2" }, { "id": "PS50168", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50168" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "DED", "eco_id": "ECO_0000259", "start_pos": 25, "end_pos": 103, "start_aa": "Ser", "end_aa": "Leu", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 265, "end_pos": 267 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6PYM9-1", "uniprot_ac": "F6PYM9", "uniprot_id": "F6PYM9_BOVIN", "mass": { "chemical_mass": 34562.0, "monoisotopic_mass": 34562.0 }, "refseq": {}, "gene_names": [ { "name": "DNAJB13", "type": "recommended", "evidence": [ { "id": "F6PYM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6PYM9" } ] } ], "protein_names": [ { "name": "DnaJ heat shock protein family (Hsp40) member B13", "type": "synonym", "evidence": [ { "id": "F6PYM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6PYM9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6PYM9", "url": "https://www.uniprot.org/uniprotkb/F6PYM9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "DNAJB13", "url": "https://www.uniprot.org/uniprotkb/F6PYM9", "locus": { "chromosome": "15", "start_pos": 53406519, "end_pos": 53393973, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000003682", "url": "https://www.ensembl.org/id/ENSBTAG00000003682" } ] } } ], "crossref": [ { "id": "ENSBTAG00000003682", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000003682", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06257", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06257", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd10747", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10747", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR001623", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001623", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002939", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002939", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008971", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008971", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018253", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018253", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036869", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036869", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051339", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051339", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:520270", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:520270", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SSKYVYH", "url": "https://omabrowser.org/oma/group/SSKYVYH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR24078", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24078", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24078:SF519", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24078:SF519", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00226", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00226", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF01556", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01556", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "F6PYM9", "url": "https://www.uniprot.org/uniprotkb/F6PYM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6PYM9-1", "url": "https://www.uniprot.org/uniprotkb/F6PYM9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "TFLHSLGQARYRKLALKNHPLRSIEPGAVETFRQIAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPEKVFHEFFGGDNPFNEFFDAEGNEADLKFGGLRGRGVKKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNDDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNSIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKKVPGEGMPLPEDPTKKGDLFIYFDIQFPTRLTPQKKQMLRQALLT", "length": 303, "header": "tr|F6PYM9-1|F6PYM9_BOVIN Isoform 1 of DnaJ heat shock protein family (Hsp40) member B13 OS=Bos taurus OX=9913 GN=DNAJB13 PE=4 SV=1 CANONICAL=F6PYM9-1" }, "isoforms": [ { "isoform_ac": "F6PYM9-1", "url": "https://www.uniprot.org/uniprotkb/F6PYM9/entry#F6PYM9-1", "sequence": { "sequence": "TFLHSLGQARYRKLALKNHPLRSIEPGAVETFRQIAEAYDVLSDPVKRGIYDKFGEEGLKGGIPLEFGSQTPWTTGYVFHGNPEKVFHEFFGGDNPFNEFFDAEGNEADLKFGGLRGRGVKKQDPPIERDLYLSLEDLFFGCTKKIKISRRVLNDDGYSSTIKDKILTIDVKPGWRQGTRITFEKEGDQGPNIIPADIIFIVKEKLHPRFRRENDNLFFVNSIPLGKALTCCTVEVKTLDDRLLNIPINDIVHPKYFKKVPGEGMPLPEDPTKKGDLFIYFDIQFPTRLTPQKKQMLRQALLT", "length": 303, "header": "tr|F6PYM9-1|F6PYM9_BOVIN Isoform 1 of DnaJ heat shock protein family (Hsp40) member B13 OS=Bos taurus OX=9913 GN=DNAJB13 PE=4 SV=1 CANONICAL=F6PYM9-1" }, "locus": { "chromosome": "15", "start_pos": 53406339, "end_pos": 53394138, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000004797.5", "url": "https://www.ensembl.org/id/ENSBTAT00000004797.5" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000004797.3", "url": "https://www.ensembl.org/id/ENSBTAP00000004797.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:520270", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:520270", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "unfolded protein binding", "id": "GO:0051082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051082", "evidence": [ { "database": "UniProtKB", "id": "F6PYM9", "url": "https://www.uniprot.org/uniprotkb/F6PYM9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "protein folding", "id": "GO:0006457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006457", "evidence": [ { "database": "UniProtKB", "id": "F6PYM9", "url": "https://www.uniprot.org/uniprotkb/F6PYM9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "F6PYM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6PYM9" }, { "id": "PS50076", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50076" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "J", "eco_id": "ECO_0000259", "start_pos": 1, "end_pos": 55, "start_aa": "Thr", "end_aa": "Gly", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6Q919-1", "uniprot_ac": "F6Q919", "uniprot_id": "F6Q919_BOVIN", "mass": { "chemical_mass": 39625.0, "monoisotopic_mass": 39625.0 }, "refseq": {}, "gene_names": [ { "name": "LOC534913", "type": "recommended", "evidence": [ { "id": "F6Q919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6Q919" } ] } ], "protein_names": [ { "name": "Mos1 transposase HTH domain-containing protein", "type": "recommended", "evidence": [ { "id": "F6Q919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6Q919/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6Q919", "url": "https://www.uniprot.org/uniprotkb/F6Q919" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC534913", "url": "https://www.uniprot.org/uniprotkb/F6Q919", "locus": {} } ], "crossref": [ { "id": "IPR001888", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001888", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036397", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036397", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041426", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041426", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR052709", "url": "https://www.ebi.ac.uk/interpro/entry/IPR052709", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR46060", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46060", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46060:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46060:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01359", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF01359", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF17906", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17906", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "F6Q919", "url": "https://www.uniprot.org/uniprotkb/F6Q919", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6Q919-1", "url": "https://www.uniprot.org/uniprotkb/F6Q919-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "TMEMMLEKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTAKERTVQWWFKKFRKGDESLEDDERSARPSEVDNDQLREIIDADPLKTTRKIAEELKVNHSTVVRHLKQIGKVKKLNKWVPHELTEIQKNRRFEVSSSLILRNKNEPFLDRIVTCHEKWILSDNQRQPAQRLDRGKTLNLYQKKIMVTVWWSAAGLIHYSFLNPGETITSEKYAQQINEMHQKLQHLQPALVNRKGPVLLHDNARPHVAQPALQKFNELGYEVLPHPPHSPDLLPTHYHFFKHLDNFLQGKRFHNQQDAENAFQEFVESRSTGFYATGINELTSRWQKCVDCNGSYFD", "length": 338, "header": "tr|F6Q919-1|F6Q919_BOVIN Isoform 1 of Mos1 transposase HTH domain-containing protein OS=Bos taurus OX=9913 GN=LOC534913 PE=4 SV=1 CANONICAL=F6Q919-1" }, "isoforms": [ { "isoform_ac": "F6Q919-1", "url": "https://www.uniprot.org/uniprotkb/F6Q919/entry#F6Q919-1", "sequence": { "sequence": "TMEMMLEKKQIRAIFLFEFKMGRKAAETTRNINNAFGPGTAKERTVQWWFKKFRKGDESLEDDERSARPSEVDNDQLREIIDADPLKTTRKIAEELKVNHSTVVRHLKQIGKVKKLNKWVPHELTEIQKNRRFEVSSSLILRNKNEPFLDRIVTCHEKWILSDNQRQPAQRLDRGKTLNLYQKKIMVTVWWSAAGLIHYSFLNPGETITSEKYAQQINEMHQKLQHLQPALVNRKGPVLLHDNARPHVAQPALQKFNELGYEVLPHPPHSPDLLPTHYHFFKHLDNFLQGKRFHNQQDAENAFQEFVESRSTGFYATGINELTSRWQKCVDCNGSYFD", "length": 338, "header": "tr|F6Q919-1|F6Q919_BOVIN Isoform 1 of Mos1 transposase HTH domain-containing protein OS=Bos taurus OX=9913 GN=LOC534913 PE=4 SV=1 CANONICAL=F6Q919-1" }, "locus": { "chromosome": "1", "start_pos": 139423616, "end_pos": 139422603, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000030356.6", "url": "https://www.ensembl.org/id/ENSBTAT00000030356.6" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000030340.5", "url": "https://www.ensembl.org/id/ENSBTAP00000030340.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "nucleic acid binding", "id": "GO:0003676", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003676", "evidence": [ { "database": "UniProtKB", "id": "F6Q919", "url": "https://www.uniprot.org/uniprotkb/F6Q919" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 333, "end_pos": 335, "annotation": "n_glycosylation_sequon" }, { "start_pos": 99, "end_pos": 101, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "F6Q919", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6Q919" }, { "id": "PF17906", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17906" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Mos1 transposase HTH", "eco_id": "ECO_0000259", "start_pos": 8, "end_pos": 57, "start_aa": "Lys", "end_aa": "Asp", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 333, "end_pos": 335 }, { "start_pos": 99, "end_pos": 101 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6Q9B9-1", "uniprot_ac": "F6Q9B9", "uniprot_id": "F6Q9B9_BOVIN", "mass": { "chemical_mass": 75982.0, "monoisotopic_mass": 75982.0 }, "refseq": { "ac": "XP_005215993", "name": "phospholipid transfer protein C2CD2L isoform X1", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005215993" }, "gene_names": [ { "name": "C2CD2L", "type": "recommended", "evidence": [ { "id": "F6Q9B9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6Q9B9" } ] }, { "name": "C2CD2L", "type": "synonym", "evidence": [ { "id": "XP_005215993", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005215993" } ] }, { "name": "TMEM24", "type": "synonym", "evidence": [ { "id": "XP_005215993", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005215993" } ] } ], "protein_names": [ { "name": "C2CD2 like", "type": "synonym", "evidence": [ { "id": "F6Q9B9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6Q9B9/entry#names_and_taxonomy" } ] }, { "name": "phospholipid transfer protein C2CD2L isoform X1", "type": "synonym", "evidence": [ { "id": "XP_005215993", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005215993" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6Q9B9", "url": "https://www.uniprot.org/uniprotkb/F6Q9B9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "C2CD2L", "url": "https://www.uniprot.org/uniprotkb/F6Q9B9", "locus": { "chromosome": "15", "start_pos": 29695830, "end_pos": 29685939, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000015013", "url": "https://www.ensembl.org/id/ENSBTAG00000015013" } ] } } ], "crossref": [ { "id": "ENSBTAG00000015013", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000015013", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd21683", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21683", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "511966", "url": "https://www.ncbi.nlm.nih.gov/gene/511966", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000008", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000008", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035892", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035892", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR039934", "url": "https://www.ebi.ac.uk/interpro/entry/IPR039934", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040885", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040885", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:511966", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:511966", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "SWAFKDC", "url": "https://omabrowser.org/oma/group/SWAFKDC/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR21119", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21119", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21119:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21119:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00168", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00168", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF18696", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF18696", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_005215993", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_005215993", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F6Q9B9", "url": "https://www.uniprot.org/uniprotkb/F6Q9B9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6Q9B9-1", "url": "https://www.uniprot.org/uniprotkb/F6Q9B9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPGWGQRDVGWAALLILFAASLLTVLGWLLQYARGLWLARARGGRGQGPAFAAEPAVSLRELGVWRSLLRLRATRAGAPEEPGVRGLLASLFAFKSFRENWQRAWVRALNEQACRDGSSIQIAFEEVPQLPPKASISHVTCIDQSERTMVLHCQLSAEEVMFPVSVTQQSPAAVSMETYHVTLTLPPTQLEVNLEEILGEGLLVSWAFTDRPDLSLTVLPKLQARERGEEQVELSTIEELIEDAIVSTQPAMMVNLRACSALGGLVPSEKPPMAPQAQPSIPRPIRLFLRQLRASHLGGELEGTGEVCCVAELDNPMQQKWTKPTRAGPEVEWSEDLTLDLGPQSRELTLKVLRSSSCGDTELLGQATLSVASPSRPLSRRQVCPLTPGPGKALGQAATMAIELQYEEGSPQNLGTSTPSTPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRVDGKLDSPSRSPSKVEVTEKTTTVLSESGGPSSTSHSSSRESHLSNGLDPVAETAIRQLTEPSGRAAKKTPTKRSTLIISGVSKVPIAQDELALSLGYAASLDASIQDDAGPSGGPSSPPSDPPAMSPGPVDALSSPTSVQEADETTRSDISERPSVDDVESETGSTGALETRSLKDHKVSFLRSGTKLIFRRRPRQKEAGLSQSHDDLSNTATTPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL", "length": 706, "header": "tr|F6Q9B9-1|F6Q9B9_BOVIN Isoform 1 of C2CD2 like OS=Bos taurus OX=9913 GN=C2CD2L PE=4 SV=1 CANONICAL=F6Q9B9-1" }, "isoforms": [ { "isoform_ac": "F6Q9B9-1", "url": "https://www.uniprot.org/uniprotkb/F6Q9B9/entry#F6Q9B9-1", "sequence": { "sequence": "MDPGWGQRDVGWAALLILFAASLLTVLGWLLQYARGLWLARARGGRGQGPAFAAEPAVSLRELGVWRSLLRLRATRAGAPEEPGVRGLLASLFAFKSFRENWQRAWVRALNEQACRDGSSIQIAFEEVPQLPPKASISHVTCIDQSERTMVLHCQLSAEEVMFPVSVTQQSPAAVSMETYHVTLTLPPTQLEVNLEEILGEGLLVSWAFTDRPDLSLTVLPKLQARERGEEQVELSTIEELIEDAIVSTQPAMMVNLRACSALGGLVPSEKPPMAPQAQPSIPRPIRLFLRQLRASHLGGELEGTGEVCCVAELDNPMQQKWTKPTRAGPEVEWSEDLTLDLGPQSRELTLKVLRSSSCGDTELLGQATLSVASPSRPLSRRQVCPLTPGPGKALGQAATMAIELQYEEGSPQNLGTSTPSTPRPSITPTKKIELDRTIMPDGTIVTTVTTVQSRPRVDGKLDSPSRSPSKVEVTEKTTTVLSESGGPSSTSHSSSRESHLSNGLDPVAETAIRQLTEPSGRAAKKTPTKRSTLIISGVSKVPIAQDELALSLGYAASLDASIQDDAGPSGGPSSPPSDPPAMSPGPVDALSSPTSVQEADETTRSDISERPSVDDVESETGSTGALETRSLKDHKVSFLRSGTKLIFRRRPRQKEAGLSQSHDDLSNTATTPSVRKKAGSFSRRLIKRFSFKSKPKANGNPSPQL", "length": 706, "header": "tr|F6Q9B9-1|F6Q9B9_BOVIN Isoform 1 of C2CD2 like OS=Bos taurus OX=9913 GN=C2CD2L PE=4 SV=1 CANONICAL=F6Q9B9-1" }, "locus": { "chromosome": "15", "start_pos": 29694917, "end_pos": 29686225, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000019988.7", "url": "https://www.ensembl.org/id/ENSBTAT00000019988.7" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000019988.5", "url": "https://www.ensembl.org/id/ENSBTAP00000019988.5" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:511966", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:511966", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "F6Q9B9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6Q9B9" }, { "id": "PS50004", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50004" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "C2", "eco_id": "ECO_0000259", "start_pos": 268, "end_pos": 389, "start_aa": "Pro", "end_aa": "Pro", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6QF74-1", "uniprot_ac": "F6QF74", "uniprot_id": "F6QF74_BOVIN", "mass": { "chemical_mass": 19133.0, "monoisotopic_mass": 19133.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "F6QF74", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6QF74/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6QF74", "url": "https://www.uniprot.org/uniprotkb/F6QF74" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/F6QF74", "locus": {} } ], "crossref": [ { "id": "ENSBTAG00000038146", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000038146", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "bta:785804", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:785804", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "KTAPDHE", "url": "https://omabrowser.org/oma/group/KTAPDHE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "F6QF74", "url": "https://www.uniprot.org/uniprotkb/F6QF74", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6QF74-1", "url": "https://www.uniprot.org/uniprotkb/F6QF74-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "GVVYYYFQGSLGKTAPAHELAVESSQPIGETLRPVWGPMDKCYPVTAQRRRVRSGKKHDSEAMTPQAMGAPNDAAPKEESAVLSREEGQVGPPGEEPASLIPGAKGVTEKEEVARTPGWQENNKVRKEMAVYVSEASEEDVMEERPGGWVPHLLRKLWLGWFPASDIPKAQSHE", "length": 174, "header": "tr|F6QF74-1|F6QF74_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=F6QF74-1" }, "isoforms": [ { "isoform_ac": "F6QF74-1", "url": "https://www.uniprot.org/uniprotkb/F6QF74/entry#F6QF74-1", "sequence": { "sequence": "GVVYYYFQGSLGKTAPAHELAVESSQPIGETLRPVWGPMDKCYPVTAQRRRVRSGKKHDSEAMTPQAMGAPNDAAPKEESAVLSREEGQVGPPGEEPASLIPGAKGVTEKEEVARTPGWQENNKVRKEMAVYVSEASEEDVMEERPGGWVPHLLRKLWLGWFPASDIPKAQSHE", "length": 174, "header": "tr|F6QF74-1|F6QF74_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=4 SV=1 CANONICAL=F6QF74-1" }, "locus": { "chromosome": "5", "start_pos": 113089064, "end_pos": 113083377, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000055282.3", "url": "https://www.ensembl.org/id/ENSBTAT00000055282.3" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000052965.2", "url": "https://www.ensembl.org/id/ENSBTAP00000052965.2" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:785804", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:785804", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": {}, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6QSD1-1", "uniprot_ac": "F6QSD1", "uniprot_id": "F6QSD1_BOVIN", "mass": { "chemical_mass": 37992.0, "monoisotopic_mass": 37992.0 }, "refseq": {}, "gene_names": [ { "name": "CD86", "type": "recommended", "evidence": [ { "id": "F6QSD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6QSD1" } ] } ], "protein_names": [ { "name": "T-lymphocyte activation antigen CD86", "type": "recommended", "evidence": [ { "id": "F6QSD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6QSD1/entry#names_and_taxonomy" } ] }, { "name": "Activation B7-2 antigen", "type": "synonym", "evidence": [ { "id": "F6QSD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6QSD1/entry#names_and_taxonomy" } ] } ], "function": [ { "annotation": "Costimulatory molecule that belongs to the immunoglobulin superfamily that plays an important role in T-lymphocyte activation. Acts as the primary auxiliary signal augmenting the MHC/TCR signal in naive T-cells by acting as a ligand for the CD28 receptor which is constitutively expressed on the cell surface of T-cells. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T-cells within 24 hours after activation. Also involved in the regulation of B cells function, plays a role in regulating the level of IgG(1) produced. Upon CD40 engagement, activates NF-kappa-B signaling pathway via phospholipase C and protein kinase C activation. Also acts as an inhibitor of T-cell activation by acting as a ligand for CTLA4, a decoy receptor, thereby blocking CD28-mediated T-cell priming.", "evidence": [ { "database": "UniProtKB", "id": "F6QSD1", "url": "https://www.uniprot.org/uniprotkb/F6QSD1#function" }, { "database": "UniProtKB", "id": "ARBA00094340", "url": "https://www.uniprot.org/uniprotkb/ARBA00094340#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6QSD1", "url": "https://www.uniprot.org/uniprotkb/F6QSD1" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "CD86", "url": "https://www.uniprot.org/uniprotkb/F6QSD1", "locus": { "chromosome": "1", "start_pos": 66610934, "end_pos": 66544199, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000013118", "url": "https://www.ensembl.org/id/ENSBTAG00000013118" } ] } } ], "crossref": [ { "id": "ENSBTAG00000013118", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000013118", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd16087", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16087", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "IPR003599", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003599", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007110", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007110", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013106", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013106", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036179", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036179", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR037677", "url": "https://www.ebi.ac.uk/interpro/entry/IPR037677", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR051713", "url": "https://www.ebi.ac.uk/interpro/entry/IPR051713", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "LPCQFTN", "url": "https://omabrowser.org/oma/group/LPCQFTN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR25466", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR25466", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR25466:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR25466:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF07686", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF07686", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "F6QSD1", "url": "https://www.uniprot.org/uniprotkb/F6QSD1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6QSD1-1", "url": "https://www.uniprot.org/uniprotkb/F6QSD1-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRFKCTMGLRNTLIVMALLLSVSTVPFSGAASLKSHAFFNETGELPCHFPNTQNLSLDELVIFWQDQNKLVLYELFKGQEKPNNVNPKYIGRTSFDQDSWTLRLHNVQIKDTGSYQCFIHHRRSQGLVSIHQMSSDLIVLANFSQPEIRLIANQTEKSNIINLTCSSIQGYPEPQRMYVSLNTTNSSSTYDAVMKKSQSNITELYNVSISVSFPIPPETNVTIFCALQLEPTKIILSQPYNIDAKSPVPSPPVPDHILWIAALLVTVVVSGMVFLTLKKRKKKQPGPSNECEIIKVEEKESEQTAKRVELQEPERSDEVQCDVNISKTASDNKSATNL", "length": 338, "header": "tr|F6QSD1-1|F6QSD1_BOVIN Isoform 1 of T-lymphocyte activation antigen CD86 OS=Bos taurus OX=9913 GN=CD86 PE=4 SV=1 CANONICAL=F6QSD1-1" }, "isoforms": [ { "isoform_ac": "F6QSD1-1", "url": "https://www.uniprot.org/uniprotkb/F6QSD1/entry#F6QSD1-1", "sequence": { "sequence": "MRFKCTMGLRNTLIVMALLLSVSTVPFSGAASLKSHAFFNETGELPCHFPNTQNLSLDELVIFWQDQNKLVLYELFKGQEKPNNVNPKYIGRTSFDQDSWTLRLHNVQIKDTGSYQCFIHHRRSQGLVSIHQMSSDLIVLANFSQPEIRLIANQTEKSNIINLTCSSIQGYPEPQRMYVSLNTTNSSSTYDAVMKKSQSNITELYNVSISVSFPIPPETNVTIFCALQLEPTKIILSQPYNIDAKSPVPSPPVPDHILWIAALLVTVVVSGMVFLTLKKRKKKQPGPSNECEIIKVEEKESEQTAKRVELQEPERSDEVQCDVNISKTASDNKSATNL", "length": 338, "header": "tr|F6QSD1-1|F6QSD1_BOVIN Isoform 1 of T-lymphocyte activation antigen CD86 OS=Bos taurus OX=9913 GN=CD86 PE=4 SV=1 CANONICAL=F6QSD1-1" }, "locus": { "chromosome": "1", "start_pos": 66609177, "end_pos": 66544322, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000032289.4", "url": "https://www.ensembl.org/id/ENSBTAT00000032289.4" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000032224.3", "url": "https://www.ensembl.org/id/ENSBTAP00000032224.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "F6QSD1", "url": "https://www.uniprot.org/uniprotkb/F6QSD1" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 142, "end_pos": 144, "annotation": "n_glycosylation_sequon" }, { "start_pos": 153, "end_pos": 155, "annotation": "n_glycosylation_sequon" }, { "start_pos": 162, "end_pos": 164, "annotation": "n_glycosylation_sequon" }, { "start_pos": 182, "end_pos": 184, "annotation": "n_glycosylation_sequon" }, { "start_pos": 185, "end_pos": 187, "annotation": "n_glycosylation_sequon" }, { "start_pos": 200, "end_pos": 202, "annotation": "n_glycosylation_sequon" }, { "start_pos": 206, "end_pos": 208, "annotation": "n_glycosylation_sequon" }, { "start_pos": 220, "end_pos": 222, "annotation": "n_glycosylation_sequon" }, { "start_pos": 324, "end_pos": 326, "annotation": "n_glycosylation_sequon" }, { "start_pos": 332, "end_pos": 334, "annotation": "n_glycosylation_sequon" }, { "start_pos": 40, "end_pos": 42, "annotation": "n_glycosylation_sequon" }, { "start_pos": 54, "end_pos": 56, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "F6QSD1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6QSD1" }, { "id": "PS50835", "database": "PROSITE", "url": "https://prosite.expasy.org/PS50835" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Ig-like", "eco_id": "ECO_0000259", "start_pos": 26, "end_pos": 134, "start_aa": "Pro", "end_aa": "Ser", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 142, "end_pos": 144 }, { "start_pos": 153, "end_pos": 155 }, { "start_pos": 162, "end_pos": 164 }, { "start_pos": 182, "end_pos": 184 }, { "start_pos": 185, "end_pos": 187 }, { "start_pos": 200, "end_pos": 202 }, { "start_pos": 206, "end_pos": 208 }, { "start_pos": 220, "end_pos": 222 }, { "start_pos": 324, "end_pos": 326 }, { "start_pos": 332, "end_pos": 334 }, { "start_pos": 40, "end_pos": 42 }, { "start_pos": 54, "end_pos": 56 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "F6REE4-1", "uniprot_ac": "F6REE4", "uniprot_id": "F6REE4_BOVIN", "mass": { "chemical_mass": 19383.0, "monoisotopic_mass": 19383.0 }, "refseq": { "ac": "XP_024832813", "name": "methylsterol monooxygenase 1 isoform X2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024832813" }, "gene_names": [ { "name": "MSMO1", "type": "recommended", "evidence": [ { "id": "F6REE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6REE4" } ] }, { "name": "MSMO1", "type": "synonym", "evidence": [ { "id": "XP_024832813", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024832813" } ] }, { "name": "SC4MOL", "type": "synonym", "evidence": [ { "id": "XP_024832813", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024832813" } ] } ], "protein_names": [ { "name": "Methylsterol monooxygenase 1", "type": "synonym", "evidence": [ { "id": "F6REE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6REE4/entry#names_and_taxonomy" } ] }, { "name": "methylsterol monooxygenase 1 isoform X2", "type": "synonym", "evidence": [ { "id": "XP_024832813", "database": "RefSeq", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024832813" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "F6REE4", "url": "https://www.uniprot.org/uniprotkb/F6REE4" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "MSMO1", "url": "https://www.uniprot.org/uniprotkb/F6REE4", "locus": { "chromosome": "17", "start_pos": 534143, "end_pos": 517453, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSBTAG00000003068", "url": "https://www.ensembl.org/id/ENSBTAG00000003068" } ] } } ], "crossref": [ { "id": "ENSBTAG00000003068", "url": "https://bgee.org/?page=gene&gene_id=ENSBTAG00000003068", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "504481", "url": "https://www.ncbi.nlm.nih.gov/gene/504481", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR006694", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006694", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR050307", "url": "https://www.ebi.ac.uk/interpro/entry/IPR050307", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "bta:504481", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:504481", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "IVHEFIY", "url": "https://omabrowser.org/oma/group/IVHEFIY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR11863", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11863", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04116", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF04116", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "XP_024832813", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_024832813", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F6REE4", "url": "https://www.uniprot.org/uniprotkb/F6REE4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6REE4-1", "url": "https://www.uniprot.org/uniprotkb/F6REE4-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPRWYMLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETIILGTGFFIGIMLLCDHVILLWAWVTVRLIETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQFNAYNEKMKKVEKKTE", "length": 162, "header": "tr|F6REE4-1|F6REE4_BOVIN Isoform 1 of Methylsterol monooxygenase 1 OS=Bos taurus OX=9913 GN=MSMO1 PE=4 SV=1 CANONICAL=F6REE4-1" }, "isoforms": [ { "isoform_ac": "F6REE4-1", "url": "https://www.uniprot.org/uniprotkb/F6REE4/entry#F6REE4-1", "sequence": { "sequence": "MPRWYMLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETIILGTGFFIGIMLLCDHVILLWAWVTVRLIETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQFNAYNEKMKKVEKKTE", "length": 162, "header": "tr|F6REE4-1|F6REE4_BOVIN Isoform 1 of Methylsterol monooxygenase 1 OS=Bos taurus OX=9913 GN=MSMO1 PE=4 SV=1 CANONICAL=F6REE4-1" }, "locus": { "chromosome": "17", "start_pos": 533365, "end_pos": 527616, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000003991.5", "url": "https://www.ensembl.org/id/ENSBTAT00000003991.5" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000003991.3", "url": "https://www.ensembl.org/id/ENSBTAP00000003991.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [ { "id": "bta:504481", "name": "", "url": "https://www.genome.jp/dbget-bin/www_bget?bta:504481", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "iron ion binding", "id": "GO:0005506", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005506", "evidence": [ { "database": "UniProtKB", "id": "F6REE4", "url": "https://www.uniprot.org/uniprotkb/F6REE4" } ], "pmid": "" }, { "name": "oxidoreductase activity", "id": "GO:0016491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016491", "evidence": [ { "database": "UniProtKB", "id": "F6REE4", "url": "https://www.uniprot.org/uniprotkb/F6REE4" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "lipid biosynthetic process", "id": "GO:0008610", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008610", "evidence": [ { "database": "UniProtKB", "id": "F6REE4", "url": "https://www.uniprot.org/uniprotkb/F6REE4" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "F6REE4", "url": "https://www.uniprot.org/uniprotkb/F6REE4" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "F6REE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/F6REE4" }, { "id": "PF04116", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF04116" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "Fatty acid hydroxylase", "eco_id": "ECO_0000259", "start_pos": 13, "end_pos": 143, "start_aa": "Gly", "end_aa": "Thr", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "G0ZIA9-1", "uniprot_ac": "G0ZIA9", "uniprot_id": "G0ZIA9_BOVIN", "mass": { "chemical_mass": 47798.0, "monoisotopic_mass": 47798.0 }, "refseq": {}, "gene_names": [ { "name": "LOC132344719", "type": "recommended", "evidence": [ { "id": "G0ZIA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9" } ] }, { "name": "LOC132344677", "type": "synonym", "evidence": [ { "id": "G0ZIA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9" } ] } ], "protein_names": [ { "name": "Heat shock transcription factor Y-linked 2", "type": "synonym", "evidence": [ { "id": "G0ZIA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "G0ZIA9", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "LOC132344719", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9", "locus": {} } ], "crossref": [ { "id": "IPR000232", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000232", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036388", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036388", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036390", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036390", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR10015", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10015", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10015:SF336", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10015:SF336", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00447", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF00447", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "G0ZIA9", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G0ZIA9-1", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAHIPSEIQDGPPKDESTDSETSIRSLYDYTLTRDSVLRSMIEEYAFQALSEDLVIKRPCYKYSVSETDEVTNFLSLTFPQKLWNIVESDQFESIWWDERGTCIVIHEELFKKEVLERKAPFRIFETKSMKSLIRQLNLYGFSKKRQTFQRSASLPVFLEEENNISLLSKLQTYYNPNFKRGHPQLLLRVQRRERRVGINNVSQISSLVQDNKKHVKASVNEDDRNSEFIPEISRESAFSASTSLPVPFIQKPHTIQIVTNTNALSPCDLPNHPSPISVRQTEQILVNQPAVLKKLSIFNWHSHSSYTQVNGPIEDFATTTTSTSQNHIVSPLQSTYSGLMVEPSKFPVRHSDMSGHDNPFPNLQETGNSWFSVPTSTYTSASSLSSQLINNHHYMETMLIKTDLPNTCQIMEPKED", "length": 417, "header": "tr|G0ZIA9-1|G0ZIA9_BOVIN Isoform 1 of Heat shock transcription factor Y-linked 2 OS=Bos taurus OX=9913 GN=LOC132344719 PE=3 SV=1 CANONICAL=G0ZIA9-1" }, "isoforms": [ { "isoform_ac": "G0ZIA9-1", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9/entry#G0ZIA9-1", "sequence": { "sequence": "MAHIPSEIQDGPPKDESTDSETSIRSLYDYTLTRDSVLRSMIEEYAFQALSEDLVIKRPCYKYSVSETDEVTNFLSLTFPQKLWNIVESDQFESIWWDERGTCIVIHEELFKKEVLERKAPFRIFETKSMKSLIRQLNLYGFSKKRQTFQRSASLPVFLEEENNISLLSKLQTYYNPNFKRGHPQLLLRVQRRERRVGINNVSQISSLVQDNKKHVKASVNEDDRNSEFIPEISRESAFSASTSLPVPFIQKPHTIQIVTNTNALSPCDLPNHPSPISVRQTEQILVNQPAVLKKLSIFNWHSHSSYTQVNGPIEDFATTTTSTSQNHIVSPLQSTYSGLMVEPSKFPVRHSDMSGHDNPFPNLQETGNSWFSVPTSTYTSASSLSSQLINNHHYMETMLIKTDLPNTCQIMEPKED", "length": 417, "header": "tr|G0ZIA9-1|G0ZIA9_BOVIN Isoform 1 of Heat shock transcription factor Y-linked 2 OS=Bos taurus OX=9913 GN=LOC132344719 PE=3 SV=1 CANONICAL=G0ZIA9-1" }, "locus": { "chromosome": "Y", "start_pos": 51428256, "end_pos": 51426576, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000143069.1", "url": "https://www.ensembl.org/id/ENSBTAT00000143069.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000105166.1", "url": "https://www.ensembl.org/id/ENSBTAP00000105166.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "G0ZIA9", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9" } ], "pmid": "" }, { "name": "sequence-specific DNA binding", "id": "GO:0043565", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043565", "evidence": [ { "database": "UniProtKB", "id": "G0ZIA9", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "G0ZIA9", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "G0ZIA9", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 164, "end_pos": 166, "annotation": "n_glycosylation_sequon" }, { "start_pos": 201, "end_pos": 203, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "G0ZIA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/G0ZIA9" }, { "id": "SM00415", "database": "SMART", "url": "http://smart.embl.de/smart/do_annotation.pl?DOMAIN=SM00415" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "HSF-type DNA-binding", "eco_id": "ECO_0000259", "start_pos": 70, "end_pos": 193, "start_aa": "Glu", "end_aa": "Arg", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 164, "end_pos": 166 }, { "start_pos": 201, "end_pos": 203 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] }, { "uniprot_canonical_ac": "Q1L836-1", "uniprot_ac": "Q1L836", "uniprot_id": "Q1L836_BOVIN", "mass": { "chemical_mass": 36832.0, "monoisotopic_mass": 36832.0 }, "refseq": {}, "gene_names": [], "protein_names": [ { "name": "Uncharacterized protein", "type": "synonym", "evidence": [ { "id": "Q1L836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q1L836/entry#names_and_taxonomy" } ] } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Bos taurus", "taxid": 9913, "evidence": [ { "database": "UniProtKB", "id": "Q1L836", "url": "https://www.uniprot.org/uniprotkb/Q1L836" } ], "common_name": "Bovine", "glygen_name": "Bovine", "reference_species": "Bos taurus [9913]" } ], "gene": [ { "name": "", "url": "https://www.uniprot.org/uniprotkb/Q1L836", "locus": {} } ], "crossref": [ { "id": "IPR004244", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004244", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035300", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035300", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035301", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035301", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042566", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042566", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043636", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043636", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "PTHR11505", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11505", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02994", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02994", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF17489", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17489", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "PF17490", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17490", "database": "Pfam", "categories": [ "Protein Classification", "Other" ] }, { "id": "Q1L836", "url": "https://www.uniprot.org/uniprotkb/Q1L836", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q1L836-1", "url": "https://www.uniprot.org/uniprotkb/Q1L836-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKRQRNTQQIKEQDKCPPNQTKEEEIGNLPDKEFRIMIVKLIQNLETKMESQINSLETRIEKMQERFNKDLEEIKKSQYIMNNAISEIKNTLEATNSRITEAEDRISELEDRMVEINESERIKEKRIKRNEDNLRDLQDNIKRYNIRIIGVPEEEDKKKDHEKILEEIIVENFPKMGKEIITQVQETQRVPNRINPRRNTPRHILIKLTTIKHKEQILKAAREKQQITHKGIPIRITADLSIETLQARREWQDILKMMKENNLQPRLLYPARISFKYEGEIKSFSDKQKLREFCTTKPALQQILKDIL", "length": 308, "header": "tr|Q1L836-1|Q1L836_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=Q1L836-1" }, "isoforms": [ { "isoform_ac": "Q1L836-1", "url": "https://www.uniprot.org/uniprotkb/Q1L836/entry#Q1L836-1", "sequence": { "sequence": "MKRQRNTQQIKEQDKCPPNQTKEEEIGNLPDKEFRIMIVKLIQNLETKMESQINSLETRIEKMQERFNKDLEEIKKSQYIMNNAISEIKNTLEATNSRITEAEDRISELEDRMVEINESERIKEKRIKRNEDNLRDLQDNIKRYNIRIIGVPEEEDKKKDHEKILEEIIVENFPKMGKEIITQVQETQRVPNRINPRRNTPRHILIKLTTIKHKEQILKAAREKQQITHKGIPIRITADLSIETLQARREWQDILKMMKENNLQPRLLYPARISFKYEGEIKSFSDKQKLREFCTTKPALQQILKDIL", "length": 308, "header": "tr|Q1L836-1|Q1L836_BOVIN Isoform 1 of Uncharacterized protein OS=Bos taurus OX=9913 GN= PE=3 SV=1 CANONICAL=Q1L836-1" }, "locus": { "chromosome": "14", "start_pos": 77676460, "end_pos": 77675537, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENSBTAT00000139032.1", "url": "https://www.ensembl.org/id/ENSBTAT00000139032.1" }, { "database": "Ensembl Peptide", "id": "ENSBTAP00000104952.1", "url": "https://www.ensembl.org/id/ENSBTAP00000104952.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [], "pathway": [], "orthologs": [], "go_annotation": {}, "pro_annotation": [ { "name": "glycoprotein", "definition": "A protein that contains at least one glycosylated residue. [PRO:DAN]", "evidence": [ { "id": "PR:000037069", "database": "PRO", "url": "https://proconsortium.org/cgi-bin/entry_pro?id=PR:000037069" } ] } ], "site_annotation": [ { "start_pos": 117, "end_pos": 119, "annotation": "n_glycosylation_sequon" }, { "start_pos": 19, "end_pos": 21, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "structures": [], "lectin_list": [], "domain_list": [ { "evidence": [ { "id": "Q1L836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q1L836" }, { "id": "PF02994", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF02994" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "L1 transposable element RRM", "eco_id": "ECO_0000259", "start_pos": 143, "end_pos": 239, "start_aa": "Arg", "end_aa": "Asp", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q1L836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q1L836" }, { "id": "PF17490", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17490" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "L1 transposable element dsRBD-like", "eco_id": "ECO_0000259", "start_pos": 243, "end_pos": 306, "start_aa": "Glu", "end_aa": "Asp", "glycosite_overlap": "" }, { "evidence": [ { "id": "Q1L836", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprotkb/Q1L836" }, { "id": "PF17489", "database": "Pfam", "url": "https://www.ebi.ac.uk/interpro/entry/pfam/PF17489" } ], "ann_type": "Domain_Extent_Annotation", "uniprotkb_annotation": "L1 transposable element trimerization", "eco_id": "ECO_0000259", "start_pos": 102, "end_pos": 139, "start_aa": "Ala", "end_aa": "Asp", "glycosite_overlap": "" } ], "binding_sites": [], "synthesized_glycans": [], "enzyme_annotation": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 117, "end_pos": 119 }, { "start_pos": 19, "end_pos": 21 } ] }, "class_list": [], "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_sites", "count": 0 }, { "field": "o_linked_sites", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "total", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 0 } ], "sort_fields": [] } ] } ]