[ { "record_id": "GLY_001414_1_0", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a0aaa9rre8", "a0aaa9rre8 1", "847570", "30573663" ] }, { "record_id": "GLY_001414_1_0", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "npkmvkvasllvkr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 847570", "tested in", "in 8", "8 mhc", "mhc ligand", "ligand assays.", "npkmvkvasllvkr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 847570", "847570 tested", "tested in 8", "in 8 mhc", "8 mhc ligand", "mhc ligand assays.", "npkmvkvasllvkr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 847570 tested", "847570 tested in", "tested in 8 mhc", "in 8 mhc ligand", "8 mhc ligand assays.", "npkmvkvasllvkr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 847570", "epitope id 847570 tested", "id 847570 tested in", "847570 tested in 8", "tested in 8 mhc ligand", "in 8 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_1", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a0aaa9s1t1", "a0aaa9s1t1 1", "1872736", "30573663" ] }, { "record_id": "GLY_001414_1_1", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lehfihlitgvavf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872736", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lehfihlitgvavf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872736", "1872736 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lehfihlitgvavf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872736 tested", "1872736 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lehfihlitgvavf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872736", "epitope id 1872736 tested", "id 1872736 tested in", "1872736 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_2", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q7sih1", "q7sih1 1", "842581", "30573663" ] }, { "record_id": "GLY_001414_1_2", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dkpiykpeqtvkfr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 842581", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "dkpiykpeqtvkfr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 842581", "842581 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "dkpiykpeqtvkfr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 842581 tested", "842581 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "dkpiykpeqtvkfr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 842581", "epitope id 842581 tested", "id 842581 tested in", "842581 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_3", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a0jn51", "a0jn51 1", "497797", "26495903" ] }, { "record_id": "GLY_001414_1_3", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "daeqqlqpyvmvvsngf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497797", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "daeqqlqpyvmvvsngf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497797", "497797 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "daeqqlqpyvmvvsngf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497797 tested", "497797 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "daeqqlqpyvmvvsngf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497797", "epitope id 497797 tested", "id 497797 tested in", "497797 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_4", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a0jn51", "a0jn51 1", "498342", "26495903" ] }, { "record_id": "GLY_001414_1_4", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "edaeqqlqpyvmvvsngf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498342", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "edaeqqlqpyvmvvsngf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498342", "498342 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "edaeqqlqpyvmvvsngf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498342 tested", "498342 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "edaeqqlqpyvmvvsngf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498342", "epitope id 498342 tested", "id 498342 tested in", "498342 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_5", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a5d7d1", "a5d7d1 1", "532338", "30573663" ] }, { "record_id": "GLY_001414_1_5", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kaldfiaskgvklvs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 532338", "tested in", "in 50", "50 mhc", "mhc ligand", "ligand assays.", "kaldfiaskgvklvs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 532338", "532338 tested", "tested in 50", "in 50 mhc", "50 mhc ligand", "mhc ligand assays.", "kaldfiaskgvklvs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 532338 tested", "532338 tested in", "tested in 50 mhc", "in 50 mhc ligand", "50 mhc ligand assays.", "kaldfiaskgvklvs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 532338", "epitope id 532338 tested", "id 532338 tested in", "532338 tested in 50", "tested in 50 mhc ligand", "in 50 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_6", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a5pka5", "a5pka5 1", "1851017", "30573663" ] }, { "record_id": "GLY_001414_1_6", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yrefailhqnlkr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1851017", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "yrefailhqnlkr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1851017", "1851017 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "yrefailhqnlkr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1851017 tested", "1851017 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "yrefailhqnlkr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1851017", "epitope id 1851017 tested", "id 1851017 tested in", "1851017 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_7", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a6h7i5", "a6h7i5 1", "1292786", "30573663" ] }, { "record_id": "GLY_001414_1_7", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vdsyvaiinksirdl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1292786", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "vdsyvaiinksirdl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1292786", "1292786 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "vdsyvaiinksirdl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1292786 tested", "1292786 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "vdsyvaiinksirdl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1292786", "epitope id 1292786 tested", "id 1292786 tested in", "1292786 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_8", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a6qlr4", "a6qlr4 1", "440552", "30573663" ] }, { "record_id": "GLY_001414_1_8", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "skrafelqksafsee is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 440552", "tested in", "in 11", "11 mhc", "mhc ligand", "ligand assays.", "skrafelqksafsee is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 440552", "440552 tested", "tested in 11", "in 11 mhc", "11 mhc ligand", "mhc ligand assays.", "skrafelqksafsee is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 440552 tested", "440552 tested in", "tested in 11 mhc", "in 11 mhc ligand", "11 mhc ligand assays.", "skrafelqksafsee is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 440552", "epitope id 440552 tested", "id 440552 tested in", "440552 tested in 11", "tested in 11 mhc ligand", "in 11 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_9", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a6qlr4", "a6qlr4 1", "846932", "30573663" ] }, { "record_id": "GLY_001414_1_9", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lpasvhaltgvdlsk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 846932", "tested in", "in 10", "10 mhc", "mhc ligand", "ligand assays.", "lpasvhaltgvdlsk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 846932", "846932 tested", "tested in 10", "in 10 mhc", "10 mhc ligand", "mhc ligand assays.", "lpasvhaltgvdlsk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 846932 tested", "846932 tested in", "tested in 10 mhc", "in 10 mhc ligand", "10 mhc ligand assays.", "lpasvhaltgvdlsk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 846932", "epitope id 846932 tested", "id 846932 tested in", "846932 tested in 10", "tested in 10 mhc ligand", "in 10 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_10", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a6qlr4", "a6qlr4 1", "1177997", "30573663" ] }, { "record_id": "GLY_001414_1_10", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vnrllaelpasvha is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1177997", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "vnrllaelpasvha is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1177997", "1177997 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "vnrllaelpasvha is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1177997 tested", "1177997 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "vnrllaelpasvha is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1177997", "epitope id 1177997 tested", "id 1177997 tested in", "1177997 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_11", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a6qlr4", "a6qlr4 1", "1745408", "30573663" ] }, { "record_id": "GLY_001414_1_11", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "evniktaeaqlayel is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1745408", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "evniktaeaqlayel is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1745408", "1745408 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "evniktaeaqlayel is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1745408 tested", "1745408 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "evniktaeaqlayel is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1745408", "epitope id 1745408 tested", "id 1745408 tested in", "1745408 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_12", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a6qlr4", "a6qlr4 1", "1871407", "30573663" ] }, { "record_id": "GLY_001414_1_12", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eghlrsilgtltveq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871407", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "eghlrsilgtltveq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871407", "1871407 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eghlrsilgtltveq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871407 tested", "1871407 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "eghlrsilgtltveq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871407", "epitope id 1871407 tested", "id 1871407 tested in", "1871407 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_13", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a6qpu5", "a6qpu5 1", "1872362", "30573663" ] }, { "record_id": "GLY_001414_1_13", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ipelssfv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872362", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ipelssfv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872362", "1872362 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ipelssfv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872362 tested", "1872362 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ipelssfv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872362", "epitope id 1872362 tested", "id 1872362 tested in", "1872362 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_14", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a7e320", "a7e320 1", "500573", "26495903" ] }, { "record_id": "GLY_001414_1_14", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kveelrkkiqelfh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500573", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kveelrkkiqelfh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500573", "500573 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kveelrkkiqelfh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500573 tested", "500573 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kveelrkkiqelfh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500573", "epitope id 500573 tested", "id 500573 tested in", "500573 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_15", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a7ywh9", "a7ywh9 1", "647142", "30573663" ] }, { "record_id": "GLY_001414_1_15", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lpyraevgpagsqfg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 647142", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "lpyraevgpagsqfg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 647142", "647142 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "lpyraevgpagsqfg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 647142 tested", "647142 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "lpyraevgpagsqfg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 647142", "epitope id 647142 tested", "id 647142 tested in", "647142 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_16", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a7ywh9", "a7ywh9 1", "847038", "30573663" ] }, { "record_id": "GLY_001414_1_16", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lpyraevgpagsq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 847038", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "lpyraevgpagsq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 847038", "847038 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "lpyraevgpagsq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 847038 tested", "847038 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "lpyraevgpagsq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 847038", "epitope id 847038 tested", "id 847038 tested in", "847038 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_17", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bfr4", "e1bfr4 1", "1872836", "30573663" ] }, { "record_id": "GLY_001414_1_17", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lllillllll is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872836", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lllillllll is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872836", "1872836 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lllillllll is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872836 tested", "1872836 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lllillllll is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872836", "epitope id 1872836 tested", "id 1872836 tested in", "1872836 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_18", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bgj4", "e1bgj4 1", "1341413", "30573663" ] }, { "record_id": "GLY_001414_1_18", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gifftdlngfqvqpr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1341413", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "gifftdlngfqvqpr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1341413", "1341413 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "gifftdlngfqvqpr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1341413 tested", "1341413 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "gifftdlngfqvqpr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1341413", "epitope id 1341413 tested", "id 1341413 tested in", "1341413 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_19", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a0aaa9rrp2", "a0aaa9rrp2 1", "1870930", "30573663" ] }, { "record_id": "GLY_001414_1_19", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "agalaglvagl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1870930", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "agalaglvagl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1870930", "1870930 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "agalaglvagl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1870930 tested", "1870930 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "agalaglvagl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1870930", "epitope id 1870930 tested", "id 1870930 tested in", "1870930 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_20", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnq4", "e1bnq4 1", "640594", "30573663" ] }, { "record_id": "GLY_001414_1_20", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "apyfaaisalkvgad is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 640594", "tested in", "in 12", "12 mhc", "mhc ligand", "ligand assays.", "apyfaaisalkvgad is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 640594", "640594 tested", "tested in 12", "in 12 mhc", "12 mhc ligand", "mhc ligand assays.", "apyfaaisalkvgad is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 640594 tested", "640594 tested in", "tested in 12 mhc", "in 12 mhc ligand", "12 mhc ligand assays.", "apyfaaisalkvgad is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 640594", "epitope id 640594 tested", "id 640594 tested in", "640594 tested in 12", "tested in 12 mhc ligand", "in 12 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_21", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "419288", "8315383" ] }, { "record_id": "GLY_001414_1_21", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nlflksdgrikytln is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 419288", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "nlflksdgrikytln is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 419288", "419288 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "nlflksdgrikytln is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 419288 tested", "419288 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "nlflksdgrikytln is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 419288", "epitope id 419288 tested", "id 419288 tested in", "419288 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_22", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "419289", "8315383" ] }, { "record_id": "GLY_001414_1_22", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nlflksdgrikytlnk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 419289", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "nlflksdgrikytlnk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 419289", "419289 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "nlflksdgrikytlnk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 419289 tested", "419289 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "nlflksdgrikytlnk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 419289", "epitope id 419289 tested", "id 419289 tested in", "419289 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_23", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "419385", "8315383" ] }, { "record_id": "GLY_001414_1_23", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpeftilntlhipsft is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 419385", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "tpeftilntlhipsft is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 419385", "419385 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "tpeftilntlhipsft is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 419385 tested", "419385 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "tpeftilntlhipsft is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 419385", "epitope id 419385 tested", "id 419385 tested in", "419385 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_24", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "419386", "8315383" ] }, { "record_id": "GLY_001414_1_24", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpeftilntlhipsftid is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 419386", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "tpeftilntlhipsftid is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 419386", "419386 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "tpeftilntlhipsftid is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 419386 tested", "419386 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "tpeftilntlhipsftid is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 419386", "epitope id 419386 tested", "id 419386 tested in", "419386 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_25", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "845514", "30573663" ] }, { "record_id": "GLY_001414_1_25", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "isdyhqqftyklqe is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 845514", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "isdyhqqftyklqe is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 845514", "845514 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "isdyhqqftyklqe is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 845514 tested", "845514 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "isdyhqqftyklqe is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 845514", "epitope id 845514 tested", "id 845514 tested in", "845514 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_26", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "849169", "30573663" ] }, { "record_id": "GLY_001414_1_26", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "srsyqfsksislps is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 849169", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "srsyqfsksislps is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 849169", "849169 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "srsyqfsksislps is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 849169 tested", "849169 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "srsyqfsksislps is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 849169", "epitope id 849169 tested", "id 849169 tested in", "849169 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_27", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "1871010", "30573663" ] }, { "record_id": "GLY_001414_1_27", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "anlfhklvtelrg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871010", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "anlfhklvtelrg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871010", "1871010 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "anlfhklvtelrg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871010 tested", "1871010 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "anlfhklvtelrg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871010", "epitope id 1871010 tested", "id 1871010 tested in", "1871010 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_28", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "1871526", "30573663" ] }, { "record_id": "GLY_001414_1_28", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "elqrylflvgqvynt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871526", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "elqrylflvgqvynt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871526", "1871526 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "elqrylflvgqvynt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871526 tested", "1871526 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "elqrylflvgqvynt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871526", "epitope id 1871526 tested", "id 1871526 tested in", "1871526 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_29", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "1872410", "30573663" ] }, { "record_id": "GLY_001414_1_29", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "isdwwalaaknltd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872410", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "isdwwalaaknltd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872410", "1872410 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "isdwwalaaknltd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872410 tested", "1872410 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "isdwwalaaknltd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872410", "epitope id 1872410 tested", "id 1872410 tested in", "1872410 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_30", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "1872926", "30573663" ] }, { "record_id": "GLY_001414_1_30", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lrfftllsgslnshg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872926", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lrfftllsgslnshg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872926", "1872926 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lrfftllsgslnshg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872926 tested", "1872926 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lrfftllsgslnshg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872926", "epitope id 1872926 tested", "id 1872926 tested in", "1872926 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_31", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "1873114", "30573663" ] }, { "record_id": "GLY_001414_1_31", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nrkqylraataliyt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873114", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "nrkqylraataliyt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873114", "1873114 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "nrkqylraataliyt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873114 tested", "1873114 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "nrkqylraataliyt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873114", "epitope id 1873114 tested", "id 1873114 tested in", "1873114 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_32", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnr0", "e1bnr0 1", "1873307", "30573663" ] }, { "record_id": "GLY_001414_1_32", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rfftllsgslnshgl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873307", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rfftllsgslnshgl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873307", "1873307 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rfftllsgslnshgl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873307 tested", "1873307 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rfftllsgslnshgl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873307", "epitope id 1873307 tested", "id 1873307 tested in", "1873307 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_33", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bnw6", "e1bnw6 1", "1873351", "30573663" ] }, { "record_id": "GLY_001414_1_33", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rlgqfltkrgvslrk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873351", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rlgqfltkrgvslrk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873351", "1873351 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rlgqfltkrgvslrk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873351 tested", "1873351 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rlgqfltkrgvslrk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873351", "epitope id 1873351 tested", "id 1873351 tested in", "1873351 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_34", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bp91", "e1bp91 1", "1873055", "30573663" ] }, { "record_id": "GLY_001414_1_34", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ndlfslaragiist is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873055", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "ndlfslaragiist is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873055", "1873055 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "ndlfslaragiist is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873055 tested", "1873055 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "ndlfslaragiist is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873055", "epitope id 1873055 tested", "id 1873055 tested in", "1873055 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_35", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bp91", "e1bp91 1", "1873840", "30573663" ] }, { "record_id": "GLY_001414_1_35", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vkaffeshpapsaer is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873840", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vkaffeshpapsaer is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873840", "1873840 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vkaffeshpapsaer is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873840 tested", "1873840 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vkaffeshpapsaer is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873840", "epitope id 1873840 tested", "id 1873840 tested in", "1873840 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_36", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bpi1", "e1bpi1 1", "499109", "26495903" ] }, { "record_id": "GLY_001414_1_36", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ggggggavsardk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499109", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ggggggavsardk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499109", "499109 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ggggggavsardk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499109 tested", "499109 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ggggggavsardk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499109", "epitope id 499109 tested", "id 499109 tested in", "499109 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_37", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "e1bpi1", "e1bpi1 1", "499110", "26495903" ] }, { "record_id": "GLY_001414_1_37", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gggggggavsardk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499110", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "gggggggavsardk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499110", "499110 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gggggggavsardk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499110 tested", "499110 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "gggggggavsardk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499110", "epitope id 499110 tested", "id 499110 tested in", "499110 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_38", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1maw1", "f1maw1 1", "846012", "30573663" ] }, { "record_id": "GLY_001414_1_38", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kktfvlapssvlr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 846012", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "kktfvlapssvlr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 846012", "846012 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "kktfvlapssvlr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 846012 tested", "846012 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "kktfvlapssvlr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 846012", "epitope id 846012 tested", "id 846012 tested in", "846012 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_39", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1mdu7", "f1mdu7 1", "1873238", "30573663" ] }, { "record_id": "GLY_001414_1_39", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qiglpgkggkakgkk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873238", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "qiglpgkggkakgkk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873238", "1873238 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "qiglpgkggkakgkk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873238 tested", "1873238 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "qiglpgkggkakgkk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873238", "epitope id 1873238 tested", "id 1873238 tested in", "1873238 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_40", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1mqh8", "f1mqh8 1", "1598187", "30573663" ] }, { "record_id": "GLY_001414_1_40", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aedkikeleaskvke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1598187", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "aedkikeleaskvke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1598187", "1598187 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "aedkikeleaskvke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1598187 tested", "1598187 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "aedkikeleaskvke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1598187", "epitope id 1598187 tested", "id 1598187 tested in", "1598187 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_41", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1mrz8", "f1mrz8 1", "514466", "30573663" ] }, { "record_id": "GLY_001414_1_41", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eenlfeiitadevh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 514466", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "eenlfeiitadevh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 514466", "514466 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "eenlfeiitadevh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 514466 tested", "514466 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "eenlfeiitadevh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 514466", "epitope id 514466 tested", "id 514466 tested in", "514466 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_42", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1msb5", "f1msb5 1", "1871333", "30573663" ] }, { "record_id": "GLY_001414_1_42", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "edlfslietheakpl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871333", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "edlfslietheakpl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871333", "1871333 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "edlfslietheakpl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871333 tested", "1871333 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "edlfslietheakpl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871333", "epitope id 1871333 tested", "id 1871333 tested in", "1871333 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_43", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "a0aaa9tyn5", "a0aaa9tyn5 1", "503826", "26495903" ] }, { "record_id": "GLY_001414_1_43", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yialeiplkarsast is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503826", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "yialeiplkarsast is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503826", "503826 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "yialeiplkarsast is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503826 tested", "503826 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "yialeiplkarsast is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503826", "epitope id 503826 tested", "id 503826 tested in", "503826 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_44", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1mvc0", "f1mvc0 1", "543145", "30573663" ] }, { "record_id": "GLY_001414_1_44", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "keeillikaakarg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 543145", "tested in", "in 11", "11 mhc", "mhc ligand", "ligand assays.", "keeillikaakarg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 543145", "543145 tested", "tested in 11", "in 11 mhc", "11 mhc ligand", "mhc ligand assays.", "keeillikaakarg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 543145 tested", "543145 tested in", "tested in 11 mhc", "in 11 mhc ligand", "11 mhc ligand assays.", "keeillikaakarg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 543145", "epitope id 543145 tested", "id 543145 tested in", "543145 tested in 11", "tested in 11 mhc ligand", "in 11 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_45", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1mvc0", "f1mvc0 1", "544732", "30573663" ] }, { "record_id": "GLY_001414_1_45", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rkeeillikaakarg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 544732", "tested in", "in 15", "15 mhc", "mhc ligand", "ligand assays.", "rkeeillikaakarg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 544732", "544732 tested", "tested in 15", "in 15 mhc", "15 mhc ligand", "mhc ligand assays.", "rkeeillikaakarg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 544732 tested", "544732 tested in", "tested in 15 mhc", "in 15 mhc ligand", "15 mhc ligand assays.", "rkeeillikaakarg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 544732", "epitope id 544732 tested", "id 544732 tested in", "544732 tested in 15", "tested in 15 mhc ligand", "in 15 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_46", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1mvc0", "f1mvc0 1", "691039", "30573663" ] }, { "record_id": "GLY_001414_1_46", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "keeillikaakar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 691039", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "keeillikaakar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 691039", "691039 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "keeillikaakar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 691039 tested", "691039 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "keeillikaakar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 691039", "epitope id 691039 tested", "id 691039 tested in", "691039 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_47", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1mvc0", "f1mvc0 1", "1166090", "30573663" ] }, { "record_id": "GLY_001414_1_47", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rkeeillikaakar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1166090", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "rkeeillikaakar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1166090", "1166090 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "rkeeillikaakar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1166090 tested", "1166090 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "rkeeillikaakar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1166090", "epitope id 1166090 tested", "id 1166090 tested in", "1166090 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_48", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1n7j2", "f1n7j2 1", "642299", "30573663" ] }, { "record_id": "GLY_001414_1_48", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eqkftvirggqviq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 642299", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "eqkftvirggqviq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 642299", "642299 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "eqkftvirggqviq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 642299 tested", "642299 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "eqkftvirggqviq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 642299", "epitope id 642299 tested", "id 642299 tested in", "642299 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_49", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1n7j2", "f1n7j2 1", "648399", "30573663" ] }, { "record_id": "GLY_001414_1_49", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qeqkftvirggqviq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 648399", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "qeqkftvirggqviq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 648399", "648399 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "qeqkftvirggqviq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 648399 tested", "648399 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "qeqkftvirggqviq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 648399", "epitope id 648399 tested", "id 648399 tested in", "648399 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_50", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "f1n7j2", "f1n7j2 1", "1873853", "30573663" ] }, { "record_id": "GLY_001414_1_50", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vktviepmaseglrt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873853", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "vktviepmaseglrt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873853", "1873853 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "vktviepmaseglrt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873853 tested", "1873853 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "vktviepmaseglrt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873853", "epitope id 1873853 tested", "id 1873853 tested in", "1873853 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_51", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "o18756", "o18756 1", "1871037", "30573663" ] }, { "record_id": "GLY_001414_1_51", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "apykflseqhgvk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871037", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "apykflseqhgvk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871037", "1871037 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "apykflseqhgvk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871037 tested", "1871037 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "apykflseqhgvk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871037", "epitope id 1871037 tested", "id 1871037 tested in", "1871037 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_52", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "o97681", "o97681 1", "1834192", "30573663" ] }, { "record_id": "GLY_001414_1_52", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tnrltflnsfkmk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1834192", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "tnrltflnsfkmk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1834192", "1834192 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "tnrltflnsfkmk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1834192 tested", "1834192 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "tnrltflnsfkmk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1834192", "epitope id 1834192 tested", "id 1834192 tested in", "1834192 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_53", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "o97681", "o97681 1", "1872413", "30573663" ] }, { "record_id": "GLY_001414_1_53", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "isfwgeqighkvkk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872413", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "isfwgeqighkvkk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872413", "1872413 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "isfwgeqighkvkk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872413 tested", "1872413 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "isfwgeqighkvkk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872413", "epitope id 1872413 tested", "id 1872413 tested in", "1872413 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_54", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00415", "p00415 1", "858622", "12859984" ] }, { "record_id": "GLY_001414_1_54", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eyyeapftis is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 858622", "tested in", "in 3", "3 b", "b cell", "cell assays.", "eyyeapftis is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 858622", "858622 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "eyyeapftis is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 858622 tested", "858622 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "eyyeapftis is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 858622", "epitope id 858622 tested", "id 858622 tested in", "858622 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_55", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00415", "p00415 1", "858639", "12859984" ] }, { "record_id": "GLY_001414_1_55", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hhslmegdrkhm is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 858639", "tested in", "in 3", "3 b", "b cell", "cell assays.", "hhslmegdrkhm is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 858639", "858639 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "hhslmegdrkhm is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 858639 tested", "858639 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "hhslmegdrkhm is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 858639", "epitope id 858639 tested", "id 858639 tested in", "858639 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_56", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00415", "p00415 1", "858695", "12859984" ] }, { "record_id": "GLY_001414_1_56", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tgihplnple is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 858695", "tested in", "in 3", "3 b", "b cell", "cell assays.", "tgihplnple is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 858695", "858695 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "tgihplnple is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 858695 tested", "858695 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "tgihplnple is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 858695", "epitope id 858695 tested", "id 858695 tested in", "858695 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_57", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00415", "p00415 1", "858711", "12859984" ] }, { "record_id": "GLY_001414_1_57", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wwrdvirest is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 858711", "tested in", "in 3", "3 b", "b cell", "cell assays.", "wwrdvirest is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 858711", "858711 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "wwrdvirest is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 858711 tested", "858711 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "wwrdvirest is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 858711", "epitope id 858711 tested", "id 858711 tested in", "858711 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_58", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00432", "p00432 1", "534464", "30573663" ] }, { "record_id": "GLY_001414_1_58", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vwdfwslrpeslhq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 534464", "tested in", "in 37", "37 mhc", "mhc ligand", "ligand assays.", "vwdfwslrpeslhq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 534464", "534464 tested", "tested in 37", "in 37 mhc", "37 mhc ligand", "mhc ligand assays.", "vwdfwslrpeslhq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 534464 tested", "534464 tested in", "tested in 37 mhc", "in 37 mhc ligand", "37 mhc ligand assays.", "vwdfwslrpeslhq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 534464", "epitope id 534464 tested", "id 534464 tested in", "534464 tested in 37", "tested in 37 mhc ligand", "in 37 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_59", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00432", "p00432 1", "697220", "30573663" ] }, { "record_id": "GLY_001414_1_59", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ipervvhakgagafg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 697220", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "ipervvhakgagafg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 697220", "697220 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "ipervvhakgagafg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 697220 tested", "697220 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "ipervvhakgagafg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 697220", "epitope id 697220 tested", "id 697220 tested in", "697220 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_60", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00432", "p00432 1", "1301469", "30573663" ] }, { "record_id": "GLY_001414_1_60", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wdfwslrpeslhq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1301469", "tested in", "in 8", "8 mhc", "mhc ligand", "ligand assays.", "wdfwslrpeslhq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1301469", "1301469 tested", "tested in 8", "in 8 mhc", "8 mhc ligand", "mhc ligand assays.", "wdfwslrpeslhq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1301469 tested", "1301469 tested in", "tested in 8 mhc", "in 8 mhc ligand", "8 mhc ligand assays.", "wdfwslrpeslhq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1301469", "epitope id 1301469 tested", "id 1301469 tested in", "1301469 tested in 8", "tested in 8 mhc ligand", "in 8 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_61", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00711", "p00711 1", "30052", "1720415" ] }, { "record_id": "GLY_001414_1_61", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kcevfrelkdlkgy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 30052", "tested in", "in 1", "1 b", "b cell", "cell assay.", "kcevfrelkdlkgy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 30052", "30052 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "kcevfrelkdlkgy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 30052 tested", "30052 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "kcevfrelkdlkgy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 30052", "epitope id 30052 tested", "id 30052 tested in", "30052 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_62", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00711", "p00711 1", "30198", "12170271" ] }, { "record_id": "GLY_001414_1_62", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kdlkgyggvs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 30198", "tested in", "in 4", "4 b", "b cell", "cell assays.", "kdlkgyggvs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 30198", "30198 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "kdlkgyggvs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 30198 tested", "30198 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "kdlkgyggvs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 30198", "epitope id 30198 tested", "id 30198 tested in", "30198 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_63", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00711", "p00711 1", "97035", "9250594" ] }, { "record_id": "GLY_001414_1_63", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vginywlahk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 97035", "tested in", "in 5", "5 b", "b cell", "cell assays.", "vginywlahk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 97035", "97035 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "vginywlahk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 97035 tested", "97035 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "vginywlahk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 97035", "epitope id 97035 tested", "id 97035 tested in", "97035 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_64", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00711", "p00711 1", "227760", "24777233" ] }, { "record_id": "GLY_001414_1_64", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ewvcttfhtsgy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 227760", "tested in", "in 2", "2 t", "t cell", "cell assays.", "ewvcttfhtsgy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 227760", "227760 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "ewvcttfhtsgy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 227760 tested", "227760 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "ewvcttfhtsgy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 227760", "epitope id 227760 tested", "id 227760 tested in", "227760 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_65", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00711", "p00711 1", "2244220", "37604312" ] }, { "record_id": "GLY_001414_1_65", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ddimcvkkildkvgi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2244220", "tested in", "in 6", "6 t", "t cell", "cell assays.", "ddimcvkkildkvgi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2244220", "2244220 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays.", "ddimcvkkildkvgi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2244220 tested", "2244220 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays.", "ddimcvkkildkvgi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2244220", "epitope id 2244220 tested", "id 2244220 tested in", "2244220 tested in 6", "tested in 6 t cell", "in 6 t cell assays." ] }, { "record_id": "GLY_001414_1_66", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00711", "p00711 1", "2244330", "37604312" ] }, { "record_id": "GLY_001414_1_66", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dkvginywlahkalc is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2244330", "tested in", "in 6", "6 t", "t cell", "cell assays.", "dkvginywlahkalc is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2244330", "2244330 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays.", "dkvginywlahkalc is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2244330 tested", "2244330 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays.", "dkvginywlahkalc is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2244330", "epitope id 2244330 tested", "id 2244330 tested in", "2244330 tested in 6", "tested in 6 t cell", "in 6 t cell assays." ] }, { "record_id": "GLY_001414_1_67", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00711", "p00711 1", "2246888", "37604312" ] }, { "record_id": "GLY_001414_1_67", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nywlahkalcsekld is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2246888", "tested in", "in 6", "6 t", "t cell", "cell assays.", "nywlahkalcsekld is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2246888", "2246888 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays.", "nywlahkalcsekld is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2246888 tested", "2246888 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays.", "nywlahkalcsekld is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2246888", "epitope id 2246888 tested", "id 2246888 tested in", "2246888 tested in 6", "tested in 6 t cell", "in 6 t cell assays." ] }, { "record_id": "GLY_001414_1_68", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p00711", "p00711 1", "2247757", "37604312" ] }, { "record_id": "GLY_001414_1_68", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "steyglfqinnkiwc is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2247757", "tested in", "in 6", "6 t", "t cell", "cell assays.", "steyglfqinnkiwc is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2247757", "2247757 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays.", "steyglfqinnkiwc is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2247757 tested", "2247757 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays.", "steyglfqinnkiwc is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2247757", "epitope id 2247757 tested", "id 2247757 tested in", "2247757 tested in 6", "tested in 6 t cell", "in 6 t cell assays." ] }, { "record_id": "GLY_001414_1_69", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133533", "10078873" ] }, { "record_id": "GLY_001414_1_69", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ckcgkcnt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133533", "tested in", "in 1", "1 b", "b cell", "cell assay.", "ckcgkcnt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133533", "133533 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "ckcgkcnt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133533 tested", "133533 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "ckcgkcnt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133533", "epitope id 133533 tested", "id 133533 tested in", "133533 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_70", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133537", "10078873" ] }, { "record_id": "GLY_001414_1_70", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "cltinttvca is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133537", "tested in", "in 1", "1 b", "b cell", "cell assay.", "cltinttvca is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133537", "133537 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "cltinttvca is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133537 tested", "133537 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "cltinttvca is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133537", "epitope id 133537 tested", "id 133537 tested in", "133537 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_71", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133549", "10078873" ] }, { "record_id": "GLY_001414_1_71", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dvngklfl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133549", "tested in", "in 1", "1 b", "b cell", "cell assay.", "dvngklfl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133549", "133549 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "dvngklfl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133549 tested", "133549 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "dvngklfl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133549", "epitope id 133549 tested", "id 133549 tested in", "133549 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_72", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133552", "10078873" ] }, { "record_id": "GLY_001414_1_72", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ecayclti is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133552", "tested in", "in 1", "1 b", "b cell", "cell assay.", "ecayclti is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133552", "133552 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "ecayclti is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133552 tested", "133552 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "ecayclti is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133552", "epitope id 133552 tested", "id 133552 tested in", "133552 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_73", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133570", "10078873" ] }, { "record_id": "GLY_001414_1_73", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "flpkyals is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133570", "tested in", "in 1", "1 b", "b cell", "cell assay.", "flpkyals is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133570", "133570 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "flpkyals is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133570 tested", "133570 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "flpkyals is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133570", "epitope id 133570 tested", "id 133570 tested in", "133570 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_74", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133584", "10078873" ] }, { "record_id": "GLY_001414_1_74", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gkcntdysd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133584", "tested in", "in 1", "1 b", "b cell", "cell assay.", "gkcntdysd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133584", "133584 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "gkcntdysd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133584 tested", "133584 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "gkcntdysd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133584", "epitope id 133584 tested", "id 133584 tested in", "133584 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_75", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133596", "10078873" ] }, { "record_id": "GLY_001414_1_75", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "heaiktnyc is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133596", "tested in", "in 1", "1 b", "b cell", "cell assay.", "heaiktnyc is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133596", "133596 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "heaiktnyc is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133596 tested", "133596 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "heaiktnyc is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133596", "epitope id 133596 tested", "id 133596 tested in", "133596 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_76", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133608", "10078873" ] }, { "record_id": "GLY_001414_1_76", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "inttvcagy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133608", "tested in", "in 1", "1 b", "b cell", "cell assay.", "inttvcagy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133608", "133608 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "inttvcagy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133608 tested", "133608 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "inttvcagy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133608", "epitope id 133608 tested", "id 133608 tested in", "133608 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_77", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133634", "10078873" ] }, { "record_id": "GLY_001414_1_77", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lsqdvcty is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133634", "tested in", "in 1", "1 b", "b cell", "cell assay.", "lsqdvcty is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133634", "133634 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "lsqdvcty is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133634 tested", "133634 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "lsqdvcty is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133634", "epitope id 133634 tested", "id 133634 tested in", "133634 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_78", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133647", "10078873" ] }, { "record_id": "GLY_001414_1_78", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mmhverkec is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133647", "tested in", "in 1", "1 b", "b cell", "cell assay.", "mmhverkec is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133647", "133647 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "mmhverkec is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133647 tested", "133647 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "mmhverkec is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133647", "epitope id 133647 tested", "id 133647 tested in", "133647 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_79", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133718", "10078873" ] }, { "record_id": "GLY_001414_1_79", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "trdvngklflp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133718", "tested in", "in 1", "1 b", "b cell", "cell assay.", "trdvngklflp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133718", "133718 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "trdvngklflp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133718 tested", "133718 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "trdvngklflp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133718", "epitope id 133718 tested", "id 133718 tested in", "133718 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_80", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133727", "10078873" ] }, { "record_id": "GLY_001414_1_80", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "verkecay is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133727", "tested in", "in 1", "1 b", "b cell", "cell assay.", "verkecay is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133727", "133727 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "verkecay is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133727 tested", "133727 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "verkecay is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133727", "epitope id 133727 tested", "id 133727 tested in", "133727 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_81", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01223", "p01223 1", "133737", "10078873" ] }, { "record_id": "GLY_001414_1_81", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vtpyfsypva is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 133737", "tested in", "in 1", "1 b", "b cell", "cell assay.", "vtpyfsypva is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 133737", "133737 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "vtpyfsypva is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 133737 tested", "133737 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "vtpyfsypva is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 133737", "epitope id 133737 tested", "id 133737 tested in", "133737 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_82", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01267", "p01267 1", "688823", "28701697" ] }, { "record_id": "GLY_001414_1_82", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "arcwqpgir is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 688823", "tested in", "in 1", "1 b", "b cell", "cell assay.", "arcwqpgir is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 688823", "688823 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "arcwqpgir is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 688823 tested", "688823 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "arcwqpgir is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 688823", "epitope id 688823 tested", "id 688823 tested in", "688823 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_83", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01267", "p01267 1", "688829", "28701697" ] }, { "record_id": "GLY_001414_1_83", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "clwecsr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 688829", "tested in", "in 1", "1 b", "b cell", "cell assay.", "clwecsr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 688829", "688829 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "clwecsr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 688829 tested", "688829 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "clwecsr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 688829", "epitope id 688829 tested", "id 688829 tested in", "688829 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_84", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01267", "p01267 1", "688859", "28701697" ] }, { "record_id": "GLY_001414_1_84", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "drclwecsr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 688859", "tested in", "in 1", "1 b", "b cell", "cell assay.", "drclwecsr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 688859", "688859 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "drclwecsr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 688859 tested", "688859 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "drclwecsr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 688859", "epitope id 688859 tested", "id 688859 tested in", "688859 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_85", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01267", "p01267 1", "688921", "28701697" ] }, { "record_id": "GLY_001414_1_85", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "flavqlvisgr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 688921", "tested in", "in 1", "1 b", "b cell", "cell assay.", "flavqlvisgr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 688921", "688921 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "flavqlvisgr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 688921 tested", "688921 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "flavqlvisgr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 688921", "epitope id 688921 tested", "id 688921 tested in", "688921 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_86", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01267", "p01267 1", "688922", "28701697" ] }, { "record_id": "GLY_001414_1_86", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fpdafvtfssfr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 688922", "tested in", "in 1", "1 b", "b cell", "cell assay.", "fpdafvtfssfr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 688922", "688922 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "fpdafvtfssfr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 688922 tested", "688922 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "fpdafvtfssfr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 688922", "epitope id 688922 tested", "id 688922 tested in", "688922 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_87", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01267", "p01267 1", "688933", "28701697" ] }, { "record_id": "GLY_001414_1_87", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gfcqiqvk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 688933", "tested in", "in 1", "1 b", "b cell", "cell assay.", "gfcqiqvk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 688933", "688933 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "gfcqiqvk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 688933 tested", "688933 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "gfcqiqvk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 688933", "epitope id 688933 tested", "id 688933 tested in", "688933 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_88", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01267", "p01267 1", "689012", "28701697" ] }, { "record_id": "GLY_001414_1_88", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "laaqstfdfyqr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 689012", "tested in", "in 1", "1 b", "b cell", "cell assay.", "laaqstfdfyqr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 689012", "689012 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "laaqstfdfyqr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 689012 tested", "689012 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "laaqstfdfyqr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 689012", "epitope id 689012 tested", "id 689012 tested in", "689012 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_89", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01267", "p01267 1", "689108", "28701697" ] }, { "record_id": "GLY_001414_1_89", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sissgffecer is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 689108", "tested in", "in 1", "1 b", "b cell", "cell assay.", "sissgffecer is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 689108", "689108 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "sissgffecer is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 689108 tested", "689108 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "sissgffecer is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 689108", "epitope id 689108 tested", "id 689108 tested in", "689108 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_90", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01267", "p01267 1", "689163", "28701697" ] }, { "record_id": "GLY_001414_1_90", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vifsadvavmvr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 689163", "tested in", "in 1", "1 b", "b cell", "cell assay.", "vifsadvavmvr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 689163", "689163 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "vifsadvavmvr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 689163 tested", "689163 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "vifsadvavmvr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 689163", "epitope id 689163 tested", "id 689163 tested in", "689163 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_91", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01966", "p01966 1", "78993", "7500030" ] }, { "record_id": "GLY_001414_1_91", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hlpsdftpav is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 78993", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "hlpsdftpav is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 78993", "78993 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "hlpsdftpav is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 78993 tested", "78993 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "hlpsdftpav is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 78993", "epitope id 78993 tested", "id 78993 tested in", "78993 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_92", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01966", "p01966 1", "156757", "21209280" ] }, { "record_id": "GLY_001414_1_92", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sldkflanv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 156757", "tested in", "in 20", "20 mhc", "mhc ligand", "ligand assays.", "sldkflanv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 156757", "156757 tested", "tested in 20", "in 20 mhc", "20 mhc ligand", "mhc ligand assays.", "sldkflanv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 156757 tested", "156757 tested in", "tested in 20 mhc", "in 20 mhc ligand", "20 mhc ligand assays.", "sldkflanv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 156757", "epitope id 156757 tested", "id 156757 tested in", "156757 tested in 20", "tested in 20 mhc ligand", "in 20 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_93", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01966", "p01966 1", "419083", "8315383" ] }, { "record_id": "GLY_001414_1_93", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aealermflsfpttkt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 419083", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "aealermflsfpttkt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 419083", "419083 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "aealermflsfpttkt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 419083 tested", "419083 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "aealermflsfpttkt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 419083", "epitope id 419083 tested", "id 419083 tested in", "419083 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_94", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01966", "p01966 1", "804797", "30573663" ] }, { "record_id": "GLY_001414_1_94", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ldkflanvstvlts is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 804797", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "ldkflanvstvlts is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 804797", "804797 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "ldkflanvstvlts is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 804797 tested", "804797 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "ldkflanvstvlts is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 804797", "epitope id 804797 tested", "id 804797 tested in", "804797 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_95", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01966", "p01966 1", "1871180", "30573663" ] }, { "record_id": "GLY_001414_1_95", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dkflanvstvltsky is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871180", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dkflanvstvltsky is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871180", "1871180 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dkflanvstvltsky is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871180 tested", "1871180 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dkflanvstvltsky is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871180", "epitope id 1871180 tested", "id 1871180 tested in", "1871180 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_96", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p01966", "p01966 1", "1871235", "30573663" ] }, { "record_id": "GLY_001414_1_96", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dpvnfkllshsll is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871235", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dpvnfkllshsll is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871235", "1871235 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dpvnfkllshsll is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871235 tested", "1871235 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dpvnfkllshsll is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871235", "epitope id 1871235 tested", "id 1871235 tested in", "1871235 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_97", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02081", "p02081 1", "196971", "10958351" ] }, { "record_id": "GLY_001414_1_97", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vvtgvanalahry is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 196971", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "vvtgvanalahry is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 196971", "196971 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "vvtgvanalahry is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 196971 tested", "196971 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "vvtgvanalahry is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 196971", "epitope id 196971 tested", "id 196971 tested in", "196971 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_98", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02081", "p02081 1", "790887", "30573663" ] }, { "record_id": "GLY_001414_1_98", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fgdlssadailgnpk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 790887", "tested in", "in 7", "7 mhc", "mhc ligand", "ligand assays.", "fgdlssadailgnpk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 790887", "790887 tested", "tested in 7", "in 7 mhc", "7 mhc ligand", "mhc ligand assays.", "fgdlssadailgnpk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 790887 tested", "790887 tested in", "tested in 7 mhc", "in 7 mhc ligand", "7 mhc ligand assays.", "fgdlssadailgnpk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 790887", "epitope id 790887 tested", "id 790887 tested in", "790887 tested in 7", "tested in 7 mhc ligand", "in 7 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_99", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02081", "p02081 1", "1871223", "30573663" ] }, { "record_id": "GLY_001414_1_99", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dpenfrllgnvlvv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871223", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dpenfrllgnvlvv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871223", "1871223 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dpenfrllgnvlvv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871223 tested", "1871223 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dpenfrllgnvlvv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871223", "epitope id 1871223 tested", "id 1871223 tested in", "1871223 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_100", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02081", "p02081 1", "1871224", "30573663" ] }, { "record_id": "GLY_001414_1_100", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dpenfrllgnvlvvv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871224", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dpenfrllgnvlvvv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871224", "1871224 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dpenfrllgnvlvvv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871224 tested", "1871224 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dpenfrllgnvlvvv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871224", "epitope id 1871224 tested", "id 1871224 tested in", "1871224 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_101", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02453", "p02453 1", "107126", "10517180" ] }, { "record_id": "GLY_001414_1_101", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gapgtpgpqg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 107126", "tested in", "in 1", "1 b", "b cell", "cell assay.", "gapgtpgpqg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 107126", "107126 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "gapgtpgpqg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 107126 tested", "107126 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "gapgtpgpqg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 107126", "epitope id 107126 tested", "id 107126 tested in", "107126 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_102", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02453", "p02453 1", "108397", "10605045" ] }, { "record_id": "GLY_001414_1_102", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gppgpagpagergeq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 108397", "tested in", "in 6", "6 t", "t cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "gppgpagpagergeq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 108397", "108397 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "gppgpagpagergeq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 108397 tested", "108397 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "gppgpagpagergeq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 108397", "epitope id 108397 tested", "id 108397 tested in", "108397 tested in 6", "tested in 6 t cell", "in 6 t cell assays", "6 t cell assays and", "t cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_103", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02453", "p02453 1", "108782", "1721846" ] }, { "record_id": "GLY_001414_1_103", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "apgfpgar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 108782", "tested in", "in 3", "3 b", "b cell", "cell assays.", "apgfpgar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 108782", "108782 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "apgfpgar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 108782 tested", "108782 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "apgfpgar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 108782", "epitope id 108782 tested", "id 108782 tested in", "108782 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_104", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02453", "p02453 1", "109021", "1721846" ] }, { "record_id": "GLY_001414_1_104", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gapgfpga is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 109021", "tested in", "in 3", "3 b", "b cell", "cell assays.", "gapgfpga is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 109021", "109021 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "gapgfpga is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 109021 tested", "109021 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "gapgfpga is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 109021", "epitope id 109021 tested", "id 109021 tested in", "109021 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_105", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02453", "p02453 1", "109091", "1721846" ] }, { "record_id": "GLY_001414_1_105", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gfpgargp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 109091", "tested in", "in 3", "3 b", "b cell", "cell assays.", "gfpgargp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 109091", "109091 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "gfpgargp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 109091 tested", "109091 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "gfpgargp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 109091", "epitope id 109091 tested", "id 109091 tested in", "109091 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_106", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02453", "p02453 1", "109672", "1721846" ] }, { "record_id": "GLY_001414_1_106", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pgfpgarg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 109672", "tested in", "in 3", "3 b", "b cell", "cell assays.", "pgfpgarg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 109672", "109672 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "pgfpgarg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 109672 tested", "109672 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "pgfpgarg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 109672", "epitope id 109672 tested", "id 109672 tested in", "109672 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_107", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02453", "p02453 1", "110182", "7514515" ] }, { "record_id": "GLY_001414_1_107", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "agnpgadg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 110182", "tested in", "in 2", "2 b", "b cell", "cell assays.", "agnpgadg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 110182", "110182 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "agnpgadg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 110182 tested", "110182 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "agnpgadg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 110182", "epitope id 110182 tested", "id 110182 tested in", "110182 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_108", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02453", "p02453 1", "499072", "26495903" ] }, { "record_id": "GLY_001414_1_108", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "geggpqgprgsegpqg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499072", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "geggpqgprgsegpqg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499072", "499072 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "geggpqgprgsegpqg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499072 tested", "499072 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "geggpqgprgsegpqg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499072", "epitope id 499072 tested", "id 499072 tested in", "499072 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_109", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02453", "p02453 1", "499214", "26495903" ] }, { "record_id": "GLY_001414_1_109", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gksgdrgetgpagpagpigpv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499214", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "gksgdrgetgpagpagpigpv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499214", "499214 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gksgdrgetgpagpagpigpv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499214 tested", "499214 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "gksgdrgetgpagpagpigpv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499214", "epitope id 499214 tested", "id 499214 tested in", "499214 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_110", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02459", "p02459 1", "1509", "32738771" ] }, { "record_id": "GLY_001414_1_110", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "agfkgeqgpkgep is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1509", "tested in", "in 33", "33 t", "t cell", "cell assays", "assays and", "and 6", "6 mhc", "mhc ligand", "ligand assays.", "agfkgeqgpkgep is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1509", "1509 tested", "tested in 33", "in 33 t", "33 t cell", "t cell assays", "cell assays and", "assays and 6", "and 6 mhc", "6 mhc ligand", "mhc ligand assays.", "agfkgeqgpkgep is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1509 tested", "1509 tested in", "tested in 33 t", "in 33 t cell", "33 t cell assays", "t cell assays and", "cell assays and 6", "assays and 6 mhc", "and 6 mhc ligand", "6 mhc ligand assays.", "agfkgeqgpkgep is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1509", "epitope id 1509 tested", "id 1509 tested in", "1509 tested in 33", "tested in 33 t cell", "in 33 t cell assays", "33 t cell assays and", "t cell assays and 6", "cell assays and 6 mhc", "assays and 6 mhc ligand", "and 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_111", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02465", "p02465 1", "27850", "12373276" ] }, { "record_id": "GLY_001414_1_111", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ipgefglpgp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 27850", "tested in", "in 1", "1 b", "b cell", "cell assay.", "ipgefglpgp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 27850", "27850 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "ipgefglpgp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 27850 tested", "27850 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "ipgefglpgp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 27850", "epitope id 27850 tested", "id 27850 tested in", "27850 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_112", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02465", "p02465 1", "109026", "1721846" ] }, { "record_id": "GLY_001414_1_112", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gapgpaga is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 109026", "tested in", "in 3", "3 b", "b cell", "cell assays.", "gapgpaga is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 109026", "109026 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "gapgpaga is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 109026 tested", "109026 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "gapgpaga is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 109026", "epitope id 109026 tested", "id 109026 tested in", "109026 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_113", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02465", "p02465 1", "109043", "1721846" ] }, { "record_id": "GLY_001414_1_113", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gargppgp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 109043", "tested in", "in 3", "3 b", "b cell", "cell assays.", "gargppgp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 109043", "109043 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "gargppgp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 109043 tested", "109043 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "gargppgp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 109043", "epitope id 109043 tested", "id 109043 tested in", "109043 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_114", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02465", "p02465 1", "109662", "1721846" ] }, { "record_id": "GLY_001414_1_114", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pgargppg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 109662", "tested in", "in 3", "3 b", "b cell", "cell assays.", "pgargppg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 109662", "109662 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "pgargppg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 109662 tested", "109662 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "pgargppg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 109662", "epitope id 109662 tested", "id 109662 tested in", "109662 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_115", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02584", "p02584 1", "429145", "30573663" ] }, { "record_id": "GLY_001414_1_115", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpgktfvnitpaevg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 429145", "tested in", "in 72", "72 mhc", "mhc ligand", "ligand assays.", "vpgktfvnitpaevg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 429145", "429145 tested", "tested in 72", "in 72 mhc", "72 mhc ligand", "mhc ligand assays.", "vpgktfvnitpaevg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 429145 tested", "429145 tested in", "tested in 72 mhc", "in 72 mhc ligand", "72 mhc ligand assays.", "vpgktfvnitpaevg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 429145", "epitope id 429145 tested", "id 429145 tested in", "429145 tested in 72", "tested in 72 mhc ligand", "in 72 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_116", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02584", "p02584 1", "532593", "30573663" ] }, { "record_id": "GLY_001414_1_116", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktlvllmgkegvhg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 532593", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "ktlvllmgkegvhg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 532593", "532593 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "ktlvllmgkegvhg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 532593 tested", "532593 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "ktlvllmgkegvhg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 532593", "epitope id 532593 tested", "id 532593 tested in", "532593 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_117", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02584", "p02584 1", "646176", "30573663" ] }, { "record_id": "GLY_001414_1_117", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktlvllmgkegvhgg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 646176", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "ktlvllmgkegvhgg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 646176", "646176 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "ktlvllmgkegvhgg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 646176 tested", "646176 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "ktlvllmgkegvhgg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 646176", "epitope id 646176 tested", "id 646176 tested in", "646176 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_118", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "3080", "11174208" ] }, { "record_id": "GLY_001414_1_118", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "amedikqmea is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 3080", "tested in", "in 2", "2 b", "b cell", "cell assays.", "amedikqmea is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 3080", "3080 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "amedikqmea is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 3080 tested", "3080 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "amedikqmea is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 3080", "epitope id 3080 tested", "id 3080 tested in", "3080 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_119", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "5709", "11174208" ] }, { "record_id": "GLY_001414_1_119", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "awyyvplgtq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 5709", "tested in", "in 2", "2 b", "b cell", "cell assays.", "awyyvplgtq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 5709", "5709 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "awyyvplgtq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 5709 tested", "5709 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "awyyvplgtq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 5709", "epitope id 5709 tested", "id 5709 tested in", "5709 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_120", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "5710", "17228168" ] }, { "record_id": "GLY_001414_1_120", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "awyyvplgtqyt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 5710", "tested in", "in 1", "1 t", "t cell", "cell assay.", "awyyvplgtqyt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 5710", "5710 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay.", "awyyvplgtqyt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 5710 tested", "5710 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay.", "awyyvplgtqyt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 5710", "epitope id 5710 tested", "id 5710 tested in", "5710 tested in 1", "tested in 1 t cell", "in 1 t cell assay." ] }, { "record_id": "GLY_001414_1_121", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "5780", "11174208" ] }, { "record_id": "GLY_001414_1_121", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ayfypelfrq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 5780", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ayfypelfrq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 5780", "5780 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ayfypelfrq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 5780 tested", "5780 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ayfypelfrq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 5780", "epitope id 5780 tested", "id 5780 tested in", "5780 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_122", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "7616", "11174208" ] }, { "record_id": "GLY_001414_1_122", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dapsfsdipn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 7616", "tested in", "in 2", "2 b", "b cell", "cell assays.", "dapsfsdipn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 7616", "7616 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "dapsfsdipn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 7616 tested", "7616 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "dapsfsdipn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 7616", "epitope id 7616 tested", "id 7616 tested in", "7616 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_123", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "7689", "11174208" ] }, { "record_id": "GLY_001414_1_123", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "daypsgawyy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 7689", "tested in", "in 2", "2 b", "b cell", "cell assays.", "daypsgawyy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 7689", "7689 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "daypsgawyy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 7689 tested", "7689 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "daypsgawyy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 7689", "epitope id 7689 tested", "id 7689 tested in", "7689 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_124", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "8754", "11174208" ] }, { "record_id": "GLY_001414_1_124", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dipnpigsen is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 8754", "tested in", "in 2", "2 b", "b cell", "cell assays.", "dipnpigsen is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 8754", "8754 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "dipnpigsen is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 8754 tested", "8754 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "dipnpigsen is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 8754", "epitope id 8754 tested", "id 8754 tested in", "8754 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_125", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "8756", "15541041" ] }, { "record_id": "GLY_001414_1_125", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dipnpigsensekttmplw is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 8756", "tested in", "in 4", "4 t", "t cell", "cell assays", "10 b", "b cell", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "dipnpigsensekttmplw is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 8756", "8756 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays", "assays 10", "10 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dipnpigsensekttmplw is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 8756 tested", "8756 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays", "cell assays 10", "assays 10 b", "10 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "dipnpigsensekttmplw is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 8756", "epitope id 8756 tested", "id 8756 tested in", "8756 tested in 4", "tested in 4 t cell", "in 4 t cell assays", "t cell assays 10", "cell assays 10 b", "assays 10 b cell", "10 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_126", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "9822", "11174208" ] }, { "record_id": "GLY_001414_1_126", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dqamedikqm is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 9822", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "dqamedikqm is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 9822", "9822 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dqamedikqm is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 9822 tested", "9822 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "dqamedikqm is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 9822", "epitope id 9822 tested", "id 9822 tested in", "9822 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_127", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "10695", "11174208" ] }, { "record_id": "GLY_001414_1_127", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dvpserylgy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 10695", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "dvpserylgy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 10695", "10695 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dvpserylgy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 10695 tested", "10695 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "dvpserylgy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 10695", "epitope id 10695 tested", "id 10695 tested in", "10695 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_128", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "11033", "15541041" ] }, { "record_id": "GLY_001414_1_128", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eaesissseeivpnsve is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 11033", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 2", "2 b", "b cell", "cell assays.", "eaesissseeivpnsve is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 11033", "11033 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 2", "and 2 b", "2 b cell", "b cell assays.", "eaesissseeivpnsve is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 11033 tested", "11033 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 2", "assay and 2 b", "and 2 b cell", "2 b cell assays.", "eaesissseeivpnsve is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 11033", "epitope id 11033 tested", "id 11033 tested in", "11033 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 2", "cell assay and 2 b", "assay and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_129", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "11348", "11174208" ] }, { "record_id": "GLY_001414_1_129", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "edikqmeaes is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 11348", "tested in", "in 2", "2 b", "b cell", "cell assays.", "edikqmeaes is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 11348", "11348 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "edikqmeaes is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 11348 tested", "11348 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "edikqmeaes is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 11348", "epitope id 11348 tested", "id 11348 tested in", "11348 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_130", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "11349", "17228168" ] }, { "record_id": "GLY_001414_1_130", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "edikqmeaesis is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 11349", "tested in", "in 1", "1 t", "t cell", "cell assay.", "edikqmeaesis is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 11349", "11349 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay.", "edikqmeaesis is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 11349 tested", "11349 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay.", "edikqmeaesis is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 11349", "epitope id 11349 tested", "id 11349 tested in", "11349 tested in 1", "tested in 1 t cell", "in 1 t cell assay." ] }, { "record_id": "GLY_001414_1_131", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "11704", "11174208" ] }, { "record_id": "GLY_001414_1_131", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eeivpnsveq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 11704", "tested in", "in 4", "4 b", "b cell", "cell assays.", "eeivpnsveq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 11704", "11704 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "eeivpnsveq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 11704 tested", "11704 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "eeivpnsveq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 11704", "epitope id 11704 tested", "id 11704 tested in", "11704 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_132", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "11704", "11678861" ] }, { "record_id": "GLY_001414_1_132", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eeivpnsveq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 11704", "tested in", "in 4", "4 b", "b cell", "cell assays.", "eeivpnsveq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 11704", "11704 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "eeivpnsveq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 11704 tested", "11704 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "eeivpnsveq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 11704", "epitope id 11704 tested", "id 11704 tested in", "11704 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_133", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "11860", "11174208" ] }, { "record_id": "GLY_001414_1_133", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eerlhsmkeg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 11860", "tested in", "in 2", "2 b", "b cell", "cell assays.", "eerlhsmkeg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 11860", "11860 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "eerlhsmkeg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 11860 tested", "11860 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "eerlhsmkeg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 11860", "epitope id 11860 tested", "id 11860 tested in", "11860 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_134", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "12187", "11174208" ] }, { "record_id": "GLY_001414_1_134", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "egihaqqkep is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 12187", "tested in", "in 4", "4 b", "b cell", "cell assays.", "egihaqqkep is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 12187", "12187 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "egihaqqkep is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 12187 tested", "12187 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "egihaqqkep is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 12187", "epitope id 12187 tested", "id 12187 tested in", "12187 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_135", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "12187", "8836334" ] }, { "record_id": "GLY_001414_1_135", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "egihaqqkep is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 12187", "tested in", "in 4", "4 b", "b cell", "cell assays.", "egihaqqkep is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 12187", "12187 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "egihaqqkep is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 12187 tested", "12187 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "egihaqqkep is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 12187", "epitope id 12187 tested", "id 12187 tested in", "12187 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_136", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "12896", "11174208" ] }, { "record_id": "GLY_001414_1_136", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ekvnelskdi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 12896", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ekvnelskdi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 12896", "12896 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ekvnelskdi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 12896 tested", "12896 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ekvnelskdi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 12896", "epitope id 12896 tested", "id 12896 tested in", "12896 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_137", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "12961", "11174208" ] }, { "record_id": "GLY_001414_1_137", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "elayfypelf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 12961", "tested in", "in 5", "5 b", "b cell", "cell assays.", "elayfypelf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 12961", "12961 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "elayfypelf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 12961 tested", "12961 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "elayfypelf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 12961", "epitope id 12961 tested", "id 12961 tested in", "12961 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_138", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "12961", "8836334" ] }, { "record_id": "GLY_001414_1_138", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "elayfypelf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 12961", "tested in", "in 5", "5 b", "b cell", "cell assays.", "elayfypelf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 12961", "12961 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "elayfypelf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 12961 tested", "12961 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "elayfypelf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 12961", "epitope id 12961 tested", "id 12961 tested in", "12961 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_139", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "13272", "11174208" ] }, { "record_id": "GLY_001414_1_139", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "elskdigses is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 13272", "tested in", "in 4", "4 b", "b cell", "cell assays.", "elskdigses is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 13272", "13272 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "elskdigses is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 13272 tested", "13272 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "elskdigses is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 13272", "epitope id 13272 tested", "id 13272 tested in", "13272 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_140", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "13272", "12170271" ] }, { "record_id": "GLY_001414_1_140", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "elskdigses is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 13272", "tested in", "in 4", "4 b", "b cell", "cell assays.", "elskdigses is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 13272", "13272 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "elskdigses is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 13272 tested", "13272 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "elskdigses is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 13272", "epitope id 13272 tested", "id 13272 tested in", "13272 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_141", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "13587", "11174208" ] }, { "record_id": "GLY_001414_1_141", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ensekttmpl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 13587", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ensekttmpl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 13587", "13587 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ensekttmpl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 13587 tested", "13587 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ensekttmpl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 13587", "epitope id 13587 tested", "id 13587 tested in", "13587 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_142", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "13714", "11174208" ] }, { "record_id": "GLY_001414_1_142", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "epmigvnqel is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 13714", "tested in", "in 2", "2 b", "b cell", "cell assays.", "epmigvnqel is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 13714", "13714 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "epmigvnqel is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 13714 tested", "13714 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "epmigvnqel is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 13714", "epitope id 13714 tested", "id 13714 tested in", "13714 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_143", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "13715", "17228168" ] }, { "record_id": "GLY_001414_1_143", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "epmigvnqelay is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 13715", "tested in", "in 3", "3 t", "t cell", "cell assays.", "epmigvnqelay is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 13715", "13715 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "epmigvnqelay is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 13715 tested", "13715 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "epmigvnqelay is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 13715", "epitope id 13715 tested", "id 13715 tested in", "13715 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_144", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "14099", "11174208" ] }, { "record_id": "GLY_001414_1_144", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "erylgyleql is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 14099", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "erylgyleql is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 14099", "14099 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "erylgyleql is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 14099 tested", "14099 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "erylgyleql is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 14099", "epitope id 14099 tested", "id 14099 tested in", "14099 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_145", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "15930", "11174208" ] }, { "record_id": "GLY_001414_1_145", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ffvapfpevf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 15930", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "ffvapfpevf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 15930", "15930 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "ffvapfpevf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 15930 tested", "15930 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "ffvapfpevf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 15930", "epitope id 15930 tested", "id 15930 tested in", "15930 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_146", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "17689", "11174208" ] }, { "record_id": "GLY_001414_1_146", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fsdipnpigs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 17689", "tested in", "in 2", "2 b", "b cell", "cell assays.", "fsdipnpigs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 17689", "17689 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "fsdipnpigs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 17689 tested", "17689 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "fsdipnpigs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 17689", "epitope id 17689 tested", "id 17689 tested in", "17689 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_147", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "18442", "11174208" ] }, { "record_id": "GLY_001414_1_147", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fypelfrqfy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 18442", "tested in", "in 2", "2 b", "b cell", "cell assays.", "fypelfrqfy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 18442", "18442 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "fypelfrqfy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 18442 tested", "18442 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "fypelfrqfy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 18442", "epitope id 18442 tested", "id 18442 tested in", "18442 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_148", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "18452", "11174208" ] }, { "record_id": "GLY_001414_1_148", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fyqldaypsg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 18452", "tested in", "in 2", "2 b", "b cell", "cell assays.", "fyqldaypsg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 18452", "18452 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "fyqldaypsg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 18452 tested", "18452 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "fyqldaypsg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 18452", "epitope id 18452 tested", "id 18452 tested in", "18452 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_149", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "20548", "11174208" ] }, { "record_id": "GLY_001414_1_149", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gkekvnelsk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 20548", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "gkekvnelsk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 20548", "20548 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gkekvnelsk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 20548 tested", "20548 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "gkekvnelsk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 20548", "epitope id 20548 tested", "id 20548 tested in", "20548 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_150", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "23078", "11174208" ] }, { "record_id": "GLY_001414_1_150", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gvnqelayfy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 23078", "tested in", "in 2", "2 b", "b cell", "cell assays.", "gvnqelayfy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 23078", "23078 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "gvnqelayfy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 23078 tested", "23078 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "gvnqelayfy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 23078", "epitope id 23078 tested", "id 23078 tested in", "23078 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_151", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "23397", "11174208" ] }, { "record_id": "GLY_001414_1_151", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gyleqllrlk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 23397", "tested in", "in 2", "2 b", "b cell", "cell assays.", "gyleqllrlk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 23397", "23397 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "gyleqllrlk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 23397 tested", "23397 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "gyleqllrlk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 23397", "epitope id 23397 tested", "id 23397 tested in", "23397 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_152", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "24812", "11174208" ] }, { "record_id": "GLY_001414_1_152", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hsmkegihaq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 24812", "tested in", "in 2", "2 b", "b cell", "cell assays.", "hsmkegihaq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 24812", "24812 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "hsmkegihaq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 24812 tested", "24812 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "hsmkegihaq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 24812", "epitope id 24812 tested", "id 24812 tested in", "24812 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_153", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "24814", "15541041" ] }, { "record_id": "GLY_001414_1_153", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hsmkegihaqqkepmigvnq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 24814", "tested in", "in 4", "4 t", "t cell", "cell assays", "assays and", "and 9", "9 b", "b cell", "cell assays.", "hsmkegihaqqkepmigvnq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 24814", "24814 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays", "cell assays and", "assays and 9", "and 9 b", "9 b cell", "b cell assays.", "hsmkegihaqqkepmigvnq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 24814 tested", "24814 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays", "t cell assays and", "cell assays and 9", "assays and 9 b", "and 9 b cell", "9 b cell assays.", "hsmkegihaqqkepmigvnq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 24814", "epitope id 24814 tested", "id 24814 tested in", "24814 tested in 4", "tested in 4 t cell", "in 4 t cell assays", "4 t cell assays and", "t cell assays and 9", "cell assays and 9 b", "assays and 9 b cell", "and 9 b cell assays." ] }, { "record_id": "GLY_001414_1_154", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "26341", "15541041" ] }, { "record_id": "GLY_001414_1_154", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "igvnqelayfypelfrqfyq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 26341", "tested in", "in 5", "5 t", "t cell", "cell assays", "assays and", "and 9", "9 b", "b cell", "cell assays.", "igvnqelayfypelfrqfyq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 26341", "26341 tested", "tested in 5", "in 5 t", "5 t cell", "t cell assays", "cell assays and", "assays and 9", "and 9 b", "9 b cell", "b cell assays.", "igvnqelayfypelfrqfyq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 26341 tested", "26341 tested in", "tested in 5 t", "in 5 t cell", "5 t cell assays", "t cell assays and", "cell assays and 9", "assays and 9 b", "and 9 b cell", "9 b cell assays.", "igvnqelayfypelfrqfyq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 26341", "epitope id 26341 tested", "id 26341 tested in", "26341 tested in 5", "tested in 5 t cell", "in 5 t cell assays", "5 t cell assays and", "t cell assays and 9", "cell assays and 9 b", "assays and 9 b cell", "and 9 b cell assays." ] }, { "record_id": "GLY_001414_1_155", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "26363", "11174208" ] }, { "record_id": "GLY_001414_1_155", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ihaqqkepmi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 26363", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ihaqqkepmi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 26363", "26363 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ihaqqkepmi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 26363 tested", "26363 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ihaqqkepmi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 26363", "epitope id 26363 tested", "id 26363 tested in", "26363 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_156", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "28169", "11174208" ] }, { "record_id": "GLY_001414_1_156", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "iqkedvpser is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 28169", "tested in", "in 2", "2 b", "b cell", "cell assays.", "iqkedvpser is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 28169", "28169 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "iqkedvpser is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 28169 tested", "28169 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "iqkedvpser is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 28169", "epitope id 28169 tested", "id 28169 tested in", "28169 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_157", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "28732", "11174208" ] }, { "record_id": "GLY_001414_1_157", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "issseeivpn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 28732", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "issseeivpn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 28732", "28732 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "issseeivpn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 28732 tested", "28732 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "issseeivpn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 28732", "epitope id 28732 tested", "id 28732 tested in", "28732 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_158", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "29402", "11174208" ] }, { "record_id": "GLY_001414_1_158", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ivpnsaeerl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 29402", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "ivpnsaeerl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 29402", "29402 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ivpnsaeerl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 29402 tested", "29402 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "ivpnsaeerl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 29402", "epitope id 29402 tested", "id 29402 tested in", "29402 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_159", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "29403", "11174208" ] }, { "record_id": "GLY_001414_1_159", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ivpnsveqkh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 29403", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ivpnsveqkh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 29403", "29403 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ivpnsveqkh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 29403 tested", "29403 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ivpnsveqkh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 29403", "epitope id 29403 tested", "id 29403 tested in", "29403 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_160", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "30333", "11174208" ] }, { "record_id": "GLY_001414_1_160", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kedvpseryl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 30333", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "kedvpseryl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 30333", "30333 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kedvpseryl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 30333 tested", "30333 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "kedvpseryl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 30333", "epitope id 30333 tested", "id 30333 tested in", "30333 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_161", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "30400", "9600504" ] }, { "record_id": "GLY_001414_1_161", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kegihaqqkepm is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 30400", "tested in", "in 2", "2 t", "t cell", "cell assays", "assays and", "and 1", "1 b", "b cell", "cell assay.", "kegihaqqkepm is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 30400", "30400 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 b", "1 b cell", "b cell assay.", "kegihaqqkepm is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 30400 tested", "30400 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 b", "and 1 b cell", "1 b cell assay.", "kegihaqqkepm is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 30400", "epitope id 30400 tested", "id 30400 tested in", "30400 tested in 2", "tested in 2 t cell", "in 2 t cell assays", "2 t cell assays and", "t cell assays and 1", "cell assays and 1 b", "assays and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_162", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "31120", "17228168" ] }, { "record_id": "GLY_001414_1_162", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "khiqkedvpser is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 31120", "tested in", "in 1", "1 t", "t cell", "cell assay.", "khiqkedvpser is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 31120", "31120 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay.", "khiqkedvpser is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 31120 tested", "31120 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay.", "khiqkedvpser is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 31120", "epitope id 31120 tested", "id 31120 tested in", "31120 tested in 1", "tested in 1 t cell", "in 1 t cell assay." ] }, { "record_id": "GLY_001414_1_163", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "31141", "11174208" ] }, { "record_id": "GLY_001414_1_163", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "khpikhqglp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 31141", "tested in", "in 2", "2 b", "b cell", "cell assays.", "khpikhqglp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 31141", "31141 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "khpikhqglp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 31141 tested", "31141 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "khpikhqglp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 31141", "epitope id 31141 tested", "id 31141 tested in", "31141 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_164", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "34490", "11174208" ] }, { "record_id": "GLY_001414_1_164", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kykvpqleiv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 34490", "tested in", "in 2", "2 b", "b cell", "cell assays.", "kykvpqleiv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 34490", "34490 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "kykvpqleiv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 34490 tested", "34490 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "kykvpqleiv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 34490", "epitope id 34490 tested", "id 34490 tested in", "34490 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_165", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "35528", "12170271" ] }, { "record_id": "GLY_001414_1_165", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "leivpnsae is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 35528", "tested in", "in 2", "2 b", "b cell", "cell assays.", "leivpnsae is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 35528", "35528 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "leivpnsae is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 35528 tested", "35528 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "leivpnsae is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 35528", "epitope id 35528 tested", "id 35528 tested in", "35528 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_166", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "35529", "11174208" ] }, { "record_id": "GLY_001414_1_166", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "leivpnsaee is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 35529", "tested in", "in 2", "2 b", "b cell", "cell assays.", "leivpnsaee is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 35529", "35529 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "leivpnsaee is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 35529 tested", "35529 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "leivpnsaee is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 35529", "epitope id 35529 tested", "id 35529 tested in", "35529 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_167", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "35530", "17228168" ] }, { "record_id": "GLY_001414_1_167", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "leivpnsaeerl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 35530", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 2", "2 b", "b cell", "cell assays.", "leivpnsaeerl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 35530", "35530 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 2", "and 2 b", "2 b cell", "b cell assays.", "leivpnsaeerl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 35530 tested", "35530 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 2", "assay and 2 b", "and 2 b cell", "2 b cell assays.", "leivpnsaeerl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 35530", "epitope id 35530 tested", "id 35530 tested in", "35530 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 2", "cell assay and 2 b", "assay and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_168", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "35659", "11174208" ] }, { "record_id": "GLY_001414_1_168", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "leqllrlkky is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 35659", "tested in", "in 2", "2 b", "b cell", "cell assays.", "leqllrlkky is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 35659", "35659 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "leqllrlkky is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 35659 tested", "35659 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "leqllrlkky is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 35659", "epitope id 35659 tested", "id 35659 tested in", "35659 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_169", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "35962", "11174208" ] }, { "record_id": "GLY_001414_1_169", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lfrqfyqlda is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 35962", "tested in", "in 2", "2 b", "b cell", "cell assays.", "lfrqfyqlda is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 35962", "35962 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "lfrqfyqlda is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 35962 tested", "35962 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "lfrqfyqlda is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 35962", "epitope id 35962 tested", "id 35962 tested in", "35962 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_170", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "36333", "11174208" ] }, { "record_id": "GLY_001414_1_170", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lgtqytdaps is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 36333", "tested in", "in 2", "2 b", "b cell", "cell assays.", "lgtqytdaps is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 36333", "36333 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "lgtqytdaps is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 36333 tested", "36333 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "lgtqytdaps is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 36333", "epitope id 36333 tested", "id 36333 tested in", "36333 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_171", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "36334", "17228168" ] }, { "record_id": "GLY_001414_1_171", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lgtqytdapsfs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 36334", "tested in", "in 1", "1 t", "t cell", "cell assay.", "lgtqytdapsfs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 36334", "36334 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay.", "lgtqytdapsfs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 36334 tested", "36334 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay.", "lgtqytdapsfs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 36334", "epitope id 36334 tested", "id 36334 tested in", "36334 tested in 1", "tested in 1 t cell", "in 1 t cell assay." ] }, { "record_id": "GLY_001414_1_172", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "36929", "11174208" ] }, { "record_id": "GLY_001414_1_172", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lkkykvpqle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 36929", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 5", "5 b", "b cell", "cell assays.", "lkkykvpqle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 36929", "36929 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 5", "and 5 b", "5 b cell", "b cell assays.", "lkkykvpqle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 36929 tested", "36929 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 5", "assays and 5 b", "and 5 b cell", "5 b cell assays.", "lkkykvpqle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 36929", "epitope id 36929 tested", "id 36929 tested in", "36929 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 5", "cell assays and 5 b", "assays and 5 b cell", "and 5 b cell assays." ] }, { "record_id": "GLY_001414_1_173", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "36929", "1710568" ] }, { "record_id": "GLY_001414_1_173", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lkkykvpqle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 36929", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 5", "5 b", "b cell", "cell assays.", "lkkykvpqle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 36929", "36929 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 5", "and 5 b", "5 b cell", "b cell assays.", "lkkykvpqle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 36929 tested", "36929 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 5", "assays and 5 b", "and 5 b cell", "5 b cell assays.", "lkkykvpqle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 36929", "epitope id 36929 tested", "id 36929 tested in", "36929 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 5", "cell assays and 5 b", "assays and 5 b cell", "and 5 b cell assays." ] }, { "record_id": "GLY_001414_1_174", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "38207", "15541041" ] }, { "record_id": "GLY_001414_1_174", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lnenllrffvapfpevfgke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 38207", "tested in", "in 4", "4 t", "t cell", "cell assays", "assays and", "and 8", "8 b", "b cell", "cell assays.", "lnenllrffvapfpevfgke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 38207", "38207 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays", "cell assays and", "assays and 8", "and 8 b", "8 b cell", "b cell assays.", "lnenllrffvapfpevfgke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 38207 tested", "38207 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays", "t cell assays and", "cell assays and 8", "assays and 8 b", "and 8 b cell", "8 b cell assays.", "lnenllrffvapfpevfgke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 38207", "epitope id 38207 tested", "id 38207 tested in", "38207 tested in 4", "tested in 4 t cell", "in 4 t cell assays", "4 t cell assays and", "t cell assays and 8", "cell assays and 8 b", "assays and 8 b cell", "and 8 b cell assays." ] }, { "record_id": "GLY_001414_1_175", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "39083", "11174208" ] }, { "record_id": "GLY_001414_1_175", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lrffvapfpe is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 39083", "tested in", "in 2", "2 b", "b cell", "cell assays.", "lrffvapfpe is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 39083", "39083 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "lrffvapfpe is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 39083 tested", "39083 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "lrffvapfpe is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 39083", "epitope id 39083 tested", "id 39083 tested in", "39083 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_176", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "39136", "11174208" ] }, { "record_id": "GLY_001414_1_176", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lrlkkykvpq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 39136", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "lrlkkykvpq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 39136", "39136 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lrlkkykvpq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 39136 tested", "39136 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "lrlkkykvpq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 39136", "epitope id 39136 tested", "id 39136 tested in", "39136 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_177", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "41811", "11174208" ] }, { "record_id": "GLY_001414_1_177", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mkegihaqqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 41811", "tested in", "in 4", "4 b", "b cell", "cell assays.", "mkegihaqqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 41811", "41811 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "mkegihaqqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 41811 tested", "41811 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "mkegihaqqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 41811", "epitope id 41811 tested", "id 41811 tested in", "41811 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_178", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "41811", "12170271" ] }, { "record_id": "GLY_001414_1_178", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mkegihaqqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 41811", "tested in", "in 4", "4 b", "b cell", "cell assays.", "mkegihaqqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 41811", "41811 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "mkegihaqqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 41811 tested", "41811 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "mkegihaqqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 41811", "epitope id 41811 tested", "id 41811 tested in", "41811 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_179", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "43703", "11174208" ] }, { "record_id": "GLY_001414_1_179", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nenllrffva is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 43703", "tested in", "in 2", "2 b", "b cell", "cell assays.", "nenllrffva is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 43703", "43703 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "nenllrffva is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 43703 tested", "43703 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "nenllrffva is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 43703", "epitope id 43703 tested", "id 43703 tested in", "43703 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_180", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "44793", "11174208" ] }, { "record_id": "GLY_001414_1_180", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nllrffvapf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 44793", "tested in", "in 2", "2 b", "b cell", "cell assays.", "nllrffvapf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 44793", "44793 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "nllrffvapf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 44793 tested", "44793 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "nllrffvapf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 44793", "epitope id 44793 tested", "id 44793 tested in", "44793 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_181", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "45538", "11174208" ] }, { "record_id": "GLY_001414_1_181", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nqelayfype is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 45538", "tested in", "in 2", "2 b", "b cell", "cell assays.", "nqelayfype is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 45538", "45538 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "nqelayfype is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 45538 tested", "45538 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "nqelayfype is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 45538", "epitope id 45538 tested", "id 45538 tested in", "45538 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_182", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "45539", "17228168" ] }, { "record_id": "GLY_001414_1_182", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nqelayfypelf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 45539", "tested in", "in 2", "2 t", "t cell", "cell assays.", "nqelayfypelf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 45539", "45539 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "nqelayfypelf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 45539 tested", "45539 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "nqelayfypelf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 45539", "epitope id 45539 tested", "id 45539 tested in", "45539 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_183", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "47345", "11174208" ] }, { "record_id": "GLY_001414_1_183", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pelfrqfyql is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 47345", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pelfrqfyql is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 47345", "47345 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pelfrqfyql is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 47345 tested", "47345 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pelfrqfyql is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 47345", "epitope id 47345 tested", "id 47345 tested in", "47345 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_184", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "47450", "11174208" ] }, { "record_id": "GLY_001414_1_184", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pevfgkekvn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 47450", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pevfgkekvn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 47450", "47450 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pevfgkekvn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 47450 tested", "47450 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pevfgkekvn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 47450", "epitope id 47450 tested", "id 47450 tested in", "47450 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_185", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "47537", "11174208" ] }, { "record_id": "GLY_001414_1_185", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pfpevfgkek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 47537", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pfpevfgkek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 47537", "47537 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pfpevfgkek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 47537 tested", "47537 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pfpevfgkek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 47537", "epitope id 47537 tested", "id 47537 tested in", "47537 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_186", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "47907", "11174208" ] }, { "record_id": "GLY_001414_1_186", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pigsensekt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 47907", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pigsensekt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 47907", "47907 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pigsensekt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 47907 tested", "47907 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pigsensekt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 47907", "epitope id 47907 tested", "id 47907 tested in", "47907 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_187", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "48684", "11174208" ] }, { "record_id": "GLY_001414_1_187", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pnpigsense is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 48684", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pnpigsense is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 48684", "48684 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pnpigsense is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 48684 tested", "48684 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pnpigsense is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 48684", "epitope id 48684 tested", "id 48684 tested in", "48684 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_188", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "49022", "11174208" ] }, { "record_id": "GLY_001414_1_188", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pqleivpnsa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 49022", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pqleivpnsa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 49022", "49022 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pqleivpnsa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 49022 tested", "49022 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pqleivpnsa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 49022", "epitope id 49022 tested", "id 49022 tested in", "49022 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_189", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "49356", "11174208" ] }, { "record_id": "GLY_001414_1_189", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pserylgyle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 49356", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pserylgyle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 49356", "49356 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pserylgyle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 49356 tested", "49356 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pserylgyle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 49356", "epitope id 49356 tested", "id 49356 tested in", "49356 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_190", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "49368", "11174208" ] }, { "record_id": "GLY_001414_1_190", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "psfsdipnpi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 49368", "tested in", "in 4", "4 b", "b cell", "cell assays.", "psfsdipnpi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 49368", "49368 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "psfsdipnpi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 49368 tested", "49368 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "psfsdipnpi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 49368", "epitope id 49368 tested", "id 49368 tested in", "49368 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_191", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "49368", "11678861" ] }, { "record_id": "GLY_001414_1_191", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "psfsdipnpi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 49368", "tested in", "in 4", "4 b", "b cell", "cell assays.", "psfsdipnpi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 49368", "49368 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "psfsdipnpi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 49368 tested", "49368 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "psfsdipnpi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 49368", "epitope id 49368 tested", "id 49368 tested in", "49368 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_192", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "50721", "11174208" ] }, { "record_id": "GLY_001414_1_192", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qevlnenllr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 50721", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qevlnenllr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 50721", "50721 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qevlnenllr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 50721 tested", "50721 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qevlnenllr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 50721", "epitope id 50721 tested", "id 50721 tested in", "50721 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_193", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "50824", "15541041" ] }, { "record_id": "GLY_001414_1_193", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qfyqldaypsgawyyvpl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 50824", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 2", "2 b", "b cell", "cell assays.", "qfyqldaypsgawyyvpl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 50824", "50824 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 2", "and 2 b", "2 b cell", "b cell assays.", "qfyqldaypsgawyyvpl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 50824 tested", "50824 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 2", "assay and 2 b", "and 2 b cell", "2 b cell assays.", "qfyqldaypsgawyyvpl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 50824", "epitope id 50824 tested", "id 50824 tested in", "50824 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 2", "cell assay and 2 b", "assay and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_194", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "50900", "11174208" ] }, { "record_id": "GLY_001414_1_194", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qglpqevlne is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 50900", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qglpqevlne is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 50900", "50900 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qglpqevlne is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 50900 tested", "50900 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qglpqevlne is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 50900", "epitope id 50900 tested", "id 50900 tested in", "50900 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_195", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "51181", "11174208" ] }, { "record_id": "GLY_001414_1_195", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qkepmigvnq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 51181", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qkepmigvnq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 51181", "51181 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qkepmigvnq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 51181 tested", "51181 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qkepmigvnq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 51181", "epitope id 51181 tested", "id 51181 tested in", "51181 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_196", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "51431", "11174208" ] }, { "record_id": "GLY_001414_1_196", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qllrlkkykv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 51431", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qllrlkkykv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 51431", "51431 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qllrlkkykv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 51431 tested", "51431 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qllrlkkykv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 51431", "epitope id 51431 tested", "id 51431 tested in", "51431 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_197", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "55185", "11174208" ] }, { "record_id": "GLY_001414_1_197", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rpkhpikhqg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 55185", "tested in", "in 3", "3 b", "b cell", "cell assays.", "rpkhpikhqg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 55185", "55185 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "rpkhpikhqg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 55185 tested", "55185 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "rpkhpikhqg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 55185", "epitope id 55185 tested", "id 55185 tested in", "55185 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_198", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "55185", "8836334" ] }, { "record_id": "GLY_001414_1_198", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rpkhpikhqg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 55185", "tested in", "in 3", "3 b", "b cell", "cell assays.", "rpkhpikhqg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 55185", "55185 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "rpkhpikhqg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 55185 tested", "55185 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "rpkhpikhqg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 55185", "epitope id 55185 tested", "id 55185 tested in", "55185 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_199", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "55186", "15541041" ] }, { "record_id": "GLY_001414_1_199", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rpkhpikhqglpqevlne is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 55186", "tested in", "in 3", "3 t", "t cell", "cell assays", "2 b", "b cell", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "rpkhpikhqglpqevlne is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 55186", "55186 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "assays 2", "2 b cell", "b cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "rpkhpikhqglpqevlne is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 55186 tested", "55186 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "cell assays 2", "assays 2 b", "2 b cell assays", "b cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "rpkhpikhqglpqevlne is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 55186", "epitope id 55186 tested", "id 55186 tested in", "55186 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "t cell assays 2", "cell assays 2 b", "assays 2 b cell", "2 b cell assays and", "b cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_200", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "55416", "11174208" ] }, { "record_id": "GLY_001414_1_200", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqfyqldayp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 55416", "tested in", "in 2", "2 b", "b cell", "cell assays.", "rqfyqldayp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 55416", "55416 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "rqfyqldayp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 55416 tested", "55416 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "rqfyqldayp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 55416", "epitope id 55416 tested", "id 55416 tested in", "55416 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_201", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "55417", "17228168" ] }, { "record_id": "GLY_001414_1_201", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqfyqldaypsg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 55417", "tested in", "in 2", "2 t", "t cell", "cell assays.", "rqfyqldaypsg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 55417", "55417 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "rqfyqldaypsg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 55417 tested", "55417 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "rqfyqldaypsg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 55417", "epitope id 55417 tested", "id 55417 tested in", "55417 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_202", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "56749", "11174208" ] }, { "record_id": "GLY_001414_1_202", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "saeerlhsmk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 56749", "tested in", "in 2", "2 b", "b cell", "cell assays.", "saeerlhsmk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 56749", "56749 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "saeerlhsmk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 56749 tested", "56749 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "saeerlhsmk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 56749", "epitope id 56749 tested", "id 56749 tested in", "56749 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_203", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "57509", "11174208" ] }, { "record_id": "GLY_001414_1_203", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sekttmplw is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 57509", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "sekttmplw is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 57509", "57509 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "sekttmplw is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 57509 tested", "57509 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "sekttmplw is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 57509", "epitope id 57509 tested", "id 57509 tested in", "57509 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_204", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "57630", "15541041" ] }, { "record_id": "GLY_001414_1_204", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sestedqamedikqmeae is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 57630", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 2", "2 b", "b cell", "cell assays.", "sestedqamedikqmeae is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 57630", "57630 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 2", "and 2 b", "2 b cell", "b cell assays.", "sestedqamedikqmeae is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 57630 tested", "57630 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 2", "assay and 2 b", "and 2 b cell", "2 b cell assays.", "sestedqamedikqmeae is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 57630", "epitope id 57630 tested", "id 57630 tested in", "57630 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 2", "cell assay and 2 b", "assay and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_205", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "57990", "11174208" ] }, { "record_id": "GLY_001414_1_205", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sgawyyvplg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 57990", "tested in", "in 2", "2 b", "b cell", "cell assays.", "sgawyyvplg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 57990", "57990 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "sgawyyvplg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 57990 tested", "57990 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "sgawyyvplg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 57990", "epitope id 57990 tested", "id 57990 tested in", "57990 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_206", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "60966", "11174208" ] }, { "record_id": "GLY_001414_1_206", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sseeivpnsv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 60966", "tested in", "in 2", "2 b", "b cell", "cell assays.", "sseeivpnsv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 60966", "60966 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "sseeivpnsv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 60966 tested", "60966 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "sseeivpnsv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 60966", "epitope id 60966 tested", "id 60966 tested in", "60966 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_207", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "63325", "11174208" ] }, { "record_id": "GLY_001414_1_207", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tedqamedik is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 63325", "tested in", "in 2", "2 b", "b cell", "cell assays.", "tedqamedik is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 63325", "63325 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "tedqamedik is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 63325 tested", "63325 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "tedqamedik is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 63325", "epitope id 63325 tested", "id 63325 tested in", "63325 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_208", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "65983", "11174208" ] }, { "record_id": "GLY_001414_1_208", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tqytdapsfs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 65983", "tested in", "in 2", "2 b", "b cell", "cell assays.", "tqytdapsfs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 65983", "65983 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "tqytdapsfs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 65983 tested", "65983 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "tqytdapsfs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 65983", "epitope id 65983 tested", "id 65983 tested in", "65983 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_209", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "67707", "11174208" ] }, { "record_id": "GLY_001414_1_209", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vapfpevfgk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 67707", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "vapfpevfgk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 67707", "67707 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "vapfpevfgk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 67707 tested", "67707 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "vapfpevfgk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 67707", "epitope id 67707 tested", "id 67707 tested in", "67707 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_210", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "67708", "17228168" ] }, { "record_id": "GLY_001414_1_210", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vapfpevfgkek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 67708", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "vapfpevfgkek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 67708", "67708 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "vapfpevfgkek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 67708 tested", "67708 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 2", "assay and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "vapfpevfgkek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 67708", "epitope id 67708 tested", "id 67708 tested in", "67708 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 2", "cell assay and 2 mhc", "assay and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_211", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "68322", "15541041" ] }, { "record_id": "GLY_001414_1_211", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "veqkhiqkedvpserylgyl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 68322", "tested in", "in 7", "7 t", "t cell", "cell assays", "assays and", "and 13", "13 b", "b cell", "cell assays.", "veqkhiqkedvpserylgyl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 68322", "68322 tested", "tested in 7", "in 7 t", "7 t cell", "t cell assays", "cell assays and", "assays and 13", "and 13 b", "13 b cell", "b cell assays.", "veqkhiqkedvpserylgyl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 68322 tested", "68322 tested in", "tested in 7 t", "in 7 t cell", "7 t cell assays", "t cell assays and", "cell assays and 13", "assays and 13 b", "and 13 b cell", "13 b cell assays.", "veqkhiqkedvpserylgyl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 68322", "epitope id 68322 tested", "id 68322 tested in", "68322 tested in 7", "tested in 7 t cell", "in 7 t cell assays", "7 t cell assays and", "t cell assays and 13", "cell assays and 13 b", "assays and 13 b cell", "and 13 b cell assays." ] }, { "record_id": "GLY_001414_1_212", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "68471", "11174208" ] }, { "record_id": "GLY_001414_1_212", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vfgkekvnel is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 68471", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "vfgkekvnel is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 68471", "68471 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "vfgkekvnel is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 68471 tested", "68471 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "vfgkekvnel is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 68471", "epitope id 68471 tested", "id 68471 tested in", "68471 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_213", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "68473", "15541041" ] }, { "record_id": "GLY_001414_1_213", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vfgkekvnelskdigseste is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 68473", "tested in", "in 5", "5 t", "t cell", "cell assays", "assays and", "and 10", "10 b", "b cell", "cell assays.", "vfgkekvnelskdigseste is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 68473", "68473 tested", "tested in 5", "in 5 t", "5 t cell", "t cell assays", "cell assays and", "assays and 10", "and 10 b", "10 b cell", "b cell assays.", "vfgkekvnelskdigseste is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 68473 tested", "68473 tested in", "tested in 5 t", "in 5 t cell", "5 t cell assays", "t cell assays and", "cell assays and 10", "assays and 10 b", "and 10 b cell", "10 b cell assays.", "vfgkekvnelskdigseste is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 68473", "epitope id 68473 tested", "id 68473 tested in", "68473 tested in 5", "tested in 5 t cell", "in 5 t cell assays", "5 t cell assays and", "t cell assays and 10", "cell assays and 10 b", "assays and 10 b cell", "and 10 b cell assays." ] }, { "record_id": "GLY_001414_1_214", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "69659", "11174208" ] }, { "record_id": "GLY_001414_1_214", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vlnenllrff is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 69659", "tested in", "in 2", "2 b", "b cell", "cell assays.", "vlnenllrff is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 69659", "69659 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "vlnenllrff is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 69659 tested", "69659 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "vlnenllrff is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 69659", "epitope id 69659 tested", "id 69659 tested in", "69659 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_215", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "70058", "11174208" ] }, { "record_id": "GLY_001414_1_215", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vnelskdigs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 70058", "tested in", "in 2", "2 b", "b cell", "cell assays.", "vnelskdigs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 70058", "70058 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "vnelskdigs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 70058 tested", "70058 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "vnelskdigs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 70058", "epitope id 70058 tested", "id 70058 tested in", "70058 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_216", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "70355", "11174208" ] }, { "record_id": "GLY_001414_1_216", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vplgtqytda is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 70355", "tested in", "in 2", "2 b", "b cell", "cell assays.", "vplgtqytda is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 70355", "70355 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "vplgtqytda is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 70355 tested", "70355 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "vplgtqytda is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 70355", "epitope id 70355 tested", "id 70355 tested in", "70355 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_217", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "70444", "15541041" ] }, { "record_id": "GLY_001414_1_217", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpqleivpnsaeerlhsmke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 70444", "tested in", "in 5", "5 t", "t cell", "cell assays", "assays and", "and 11", "11 b", "b cell", "cell assays.", "vpqleivpnsaeerlhsmke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 70444", "70444 tested", "tested in 5", "in 5 t", "5 t cell", "t cell assays", "cell assays and", "assays and 11", "and 11 b", "11 b cell", "b cell assays.", "vpqleivpnsaeerlhsmke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 70444 tested", "70444 tested in", "tested in 5 t", "in 5 t cell", "5 t cell assays", "t cell assays and", "cell assays and 11", "assays and 11 b", "and 11 b cell", "11 b cell assays.", "vpqleivpnsaeerlhsmke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 70444", "epitope id 70444 tested", "id 70444 tested in", "70444 tested in 5", "tested in 5 t cell", "in 5 t cell assays", "5 t cell assays and", "t cell assays and 11", "cell assays and 11 b", "assays and 11 b cell", "and 11 b cell assays." ] }, { "record_id": "GLY_001414_1_218", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "74687", "11174208" ] }, { "record_id": "GLY_001414_1_218", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylgyleqllr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 74687", "tested in", "in 3", "3 t", "t cell", "cell assays", "7 b", "b cell", "assays and", "and 10", "10 mhc", "mhc ligand", "ligand assays.", "ylgyleqllr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 74687", "74687 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "assays 7", "7 b cell", "b cell assays", "cell assays and", "assays and 10", "and 10 mhc", "10 mhc ligand", "mhc ligand assays.", "ylgyleqllr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 74687 tested", "74687 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "cell assays 7", "assays 7 b", "7 b cell assays", "b cell assays and", "cell assays and 10", "assays and 10 mhc", "and 10 mhc ligand", "10 mhc ligand assays.", "ylgyleqllr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 74687", "epitope id 74687 tested", "id 74687 tested in", "74687 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "t cell assays 7", "cell assays 7 b", "assays 7 b cell", "7 b cell assays and", "b cell assays and 10", "cell assays and 10 mhc", "assays and 10 mhc ligand", "and 10 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_219", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "74687", "12170271" ] }, { "record_id": "GLY_001414_1_219", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylgyleqllr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 74687", "tested in", "in 3", "3 t", "t cell", "cell assays", "7 b", "b cell", "assays and", "and 10", "10 mhc", "mhc ligand", "ligand assays.", "ylgyleqllr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 74687", "74687 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "assays 7", "7 b cell", "b cell assays", "cell assays and", "assays and 10", "and 10 mhc", "10 mhc ligand", "mhc ligand assays.", "ylgyleqllr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 74687 tested", "74687 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "cell assays 7", "assays 7 b", "7 b cell assays", "b cell assays and", "cell assays and 10", "assays and 10 mhc", "and 10 mhc ligand", "10 mhc ligand assays.", "ylgyleqllr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 74687", "epitope id 74687 tested", "id 74687 tested in", "74687 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "t cell assays 7", "cell assays 7 b", "assays 7 b cell", "7 b cell assays and", "b cell assays and 10", "cell assays and 10 mhc", "assays and 10 mhc ligand", "and 10 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_220", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "74687", "1710568" ] }, { "record_id": "GLY_001414_1_220", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylgyleqllr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 74687", "tested in", "in 3", "3 t", "t cell", "cell assays", "7 b", "b cell", "assays and", "and 10", "10 mhc", "mhc ligand", "ligand assays.", "ylgyleqllr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 74687", "74687 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "assays 7", "7 b cell", "b cell assays", "cell assays and", "assays and 10", "and 10 mhc", "10 mhc ligand", "mhc ligand assays.", "ylgyleqllr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 74687 tested", "74687 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "cell assays 7", "assays 7 b", "7 b cell assays", "b cell assays and", "cell assays and 10", "assays and 10 mhc", "and 10 mhc ligand", "10 mhc ligand assays.", "ylgyleqllr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 74687", "epitope id 74687 tested", "id 74687 tested in", "74687 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "t cell assays 7", "cell assays 7 b", "assays 7 b cell", "7 b cell assays and", "b cell assays and 10", "cell assays and 10 mhc", "assays and 10 mhc ligand", "and 10 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_221", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "74689", "15541041" ] }, { "record_id": "GLY_001414_1_221", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylgyleqllrlkkykvpqle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 74689", "tested in", "in 14", "14 t", "t cell", "cell assays", "assays and", "and 16", "16 b", "b cell", "cell assays.", "ylgyleqllrlkkykvpqle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 74689", "74689 tested", "tested in 14", "in 14 t", "14 t cell", "t cell assays", "cell assays and", "assays and 16", "and 16 b", "16 b cell", "b cell assays.", "ylgyleqllrlkkykvpqle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 74689 tested", "74689 tested in", "tested in 14 t", "in 14 t cell", "14 t cell assays", "t cell assays and", "cell assays and 16", "assays and 16 b", "and 16 b cell", "16 b cell assays.", "ylgyleqllrlkkykvpqle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 74689", "epitope id 74689 tested", "id 74689 tested in", "74689 tested in 14", "tested in 14 t cell", "in 14 t cell assays", "14 t cell assays and", "t cell assays and 16", "cell assays and 16 b", "assays and 16 b cell", "and 16 b cell assays." ] }, { "record_id": "GLY_001414_1_222", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "75409", "11174208" ] }, { "record_id": "GLY_001414_1_222", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ypsgawyyvp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 75409", "tested in", "in 4", "4 b", "b cell", "cell assays.", "ypsgawyyvp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 75409", "75409 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "ypsgawyyvp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 75409 tested", "75409 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "ypsgawyyvp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 75409", "epitope id 75409 tested", "id 75409 tested in", "75409 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_223", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "75409", "12170271" ] }, { "record_id": "GLY_001414_1_223", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ypsgawyyvp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 75409", "tested in", "in 4", "4 b", "b cell", "cell assays.", "ypsgawyyvp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 75409", "75409 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "ypsgawyyvp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 75409 tested", "75409 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "ypsgawyyvp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 75409", "epitope id 75409 tested", "id 75409 tested in", "75409 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_224", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "75990", "11174208" ] }, { "record_id": "GLY_001414_1_224", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ytdapsfsdi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 75990", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ytdapsfsdi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 75990", "75990 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ytdapsfsdi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 75990 tested", "75990 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ytdapsfsdi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 75990", "epitope id 75990 tested", "id 75990 tested in", "75990 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_225", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "76384", "15541041" ] }, { "record_id": "GLY_001414_1_225", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yvplgtqytdapsfsdipn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 76384", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 2", "2 b", "b cell", "cell assays.", "yvplgtqytdapsfsdipn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 76384", "76384 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 2", "and 2 b", "2 b cell", "b cell assays.", "yvplgtqytdapsfsdipn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 76384 tested", "76384 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 2", "assay and 2 b", "and 2 b cell", "2 b cell assays.", "yvplgtqytdapsfsdipn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 76384", "epitope id 76384 tested", "id 76384 tested in", "76384 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 2", "cell assay and 2 b", "assay and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_226", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "76634", "11174208" ] }, { "record_id": "GLY_001414_1_226", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yyvplgtqyt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 76634", "tested in", "in 2", "2 b", "b cell", "cell assays.", "yyvplgtqyt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 76634", "76634 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "yyvplgtqyt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 76634 tested", "76634 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "yyvplgtqyt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 76634", "epitope id 76634 tested", "id 76634 tested in", "76634 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_227", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "190407", "37604312" ] }, { "record_id": "GLY_001414_1_227", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "elayfypelfrqfyq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 190407", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "elayfypelfrqfyq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 190407", "190407 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "elayfypelfrqfyq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 190407 tested", "190407 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "elayfypelfrqfyq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 190407", "epitope id 190407 tested", "id 190407 tested in", "190407 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_228", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "190408", "37604312" ] }, { "record_id": "GLY_001414_1_228", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eqllrlkkykvpqle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 190408", "tested in", "in 7", "7 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "eqllrlkkykvpqle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 190408", "190408 tested", "tested in 7", "in 7 t", "7 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "eqllrlkkykvpqle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 190408 tested", "190408 tested in", "tested in 7 t", "in 7 t cell", "7 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "eqllrlkkykvpqle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 190408", "epitope id 190408 tested", "id 190408 tested in", "190408 tested in 7", "tested in 7 t cell", "in 7 t cell assays", "7 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_229", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "190447", "37604312" ] }, { "record_id": "GLY_001414_1_229", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "igvnqelayfypelf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 190447", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "igvnqelayfypelf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 190447", "190447 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "igvnqelayfypelf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 190447 tested", "190447 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "igvnqelayfypelf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 190447", "epitope id 190447 tested", "id 190447 tested in", "190447 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_230", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "190475", "37604312" ] }, { "record_id": "GLY_001414_1_230", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lpqevlnenllrffv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 190475", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "lpqevlnenllrffv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 190475", "190475 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "lpqevlnenllrffv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 190475 tested", "190475 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "lpqevlnenllrffv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 190475", "epitope id 190475 tested", "id 190475 tested in", "190475 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_231", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "190531", "37604312" ] }, { "record_id": "GLY_001414_1_231", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqfyqldaypsgawy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 190531", "tested in", "in 7", "7 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "rqfyqldaypsgawy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 190531", "190531 tested", "tested in 7", "in 7 t", "7 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "rqfyqldaypsgawy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 190531 tested", "190531 tested in", "tested in 7 t", "in 7 t cell", "7 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "rqfyqldaypsgawy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 190531", "epitope id 190531 tested", "id 190531 tested in", "190531 tested in 7", "tested in 7 t cell", "in 7 t cell assays", "7 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_232", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "190580", "37604312" ] }, { "record_id": "GLY_001414_1_232", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpserylgyleqllr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 190580", "tested in", "in 7", "7 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "vpserylgyleqllr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 190580", "190580 tested", "tested in 7", "in 7 t", "7 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "vpserylgyleqllr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 190580 tested", "190580 tested in", "tested in 7 t", "in 7 t cell", "7 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "vpserylgyleqllr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 190580", "epitope id 190580 tested", "id 190580 tested in", "190580 tested in 7", "tested in 7 t cell", "in 7 t cell assays", "7 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_233", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "190595", "37604312" ] }, { "record_id": "GLY_001414_1_233", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylgyleqllrlkkyk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 190595", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "ylgyleqllrlkkyk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 190595", "190595 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "ylgyleqllrlkkyk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 190595 tested", "190595 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "ylgyleqllrlkkyk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 190595", "epitope id 190595 tested", "id 190595 tested in", "190595 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_234", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "606414", "36307246" ] }, { "record_id": "GLY_001414_1_234", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "egihaqqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 606414", "tested in", "in 3", "3 b", "b cell", "cell assays.", "egihaqqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 606414", "606414 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "egihaqqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 606414 tested", "606414 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "egihaqqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 606414", "epitope id 606414 tested", "id 606414 tested in", "606414 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_235", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "606414", "18992943" ] }, { "record_id": "GLY_001414_1_235", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "egihaqqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 606414", "tested in", "in 3", "3 b", "b cell", "cell assays.", "egihaqqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 606414", "606414 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "egihaqqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 606414 tested", "606414 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "egihaqqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 606414", "epitope id 606414 tested", "id 606414 tested in", "606414 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_236", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "858198", "9512346" ] }, { "record_id": "GLY_001414_1_236", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "layfypel is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 858198", "tested in", "in 4", "4 t", "t cell", "cell assays.", "layfypel is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 858198", "858198 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays.", "layfypel is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 858198 tested", "858198 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays.", "layfypel is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 858198", "epitope id 858198 tested", "id 858198 tested in", "858198 tested in 4", "tested in 4 t cell", "in 4 t cell assays." ] }, { "record_id": "GLY_001414_1_237", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "858429", "1710568" ] }, { "record_id": "GLY_001414_1_237", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qllrlkkykvpqle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 858429", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 3", "3 b", "b cell", "cell assays.", "qllrlkkykvpqle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 858429", "858429 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 3", "and 3 b", "3 b cell", "b cell assays.", "qllrlkkykvpqle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 858429 tested", "858429 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 3", "assays and 3 b", "and 3 b cell", "3 b cell assays.", "qllrlkkykvpqle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 858429", "epitope id 858429 tested", "id 858429 tested in", "858429 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 3", "cell assays and 3 b", "assays and 3 b cell", "and 3 b cell assays." ] }, { "record_id": "GLY_001414_1_238", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02662", "p02662 1", "1007427", "36307246" ] }, { "record_id": "GLY_001414_1_238", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "edvpser is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1007427", "tested in", "in 1", "1 b", "b cell", "cell assay", "assay and", "and 7", "7 mhc", "mhc ligand", "ligand assays.", "edvpser is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1007427", "1007427 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay", "cell assay and", "assay and 7", "and 7 mhc", "7 mhc ligand", "mhc ligand assays.", "edvpser is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1007427 tested", "1007427 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay", "b cell assay and", "cell assay and 7", "assay and 7 mhc", "and 7 mhc ligand", "7 mhc ligand assays.", "edvpser is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1007427", "epitope id 1007427 tested", "id 1007427 tested in", "1007427 tested in 1", "tested in 1 b cell", "in 1 b cell assay", "1 b cell assay and", "b cell assay and 7", "cell assay and 7 mhc", "assay and 7 mhc ligand", "and 7 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_239", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "13509", "12170271" ] }, { "record_id": "GLY_001414_1_239", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "enlcstfcke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 13509", "tested in", "in 3", "3 b", "b cell", "cell assays.", "enlcstfcke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 13509", "13509 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "enlcstfcke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 13509 tested", "13509 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "enlcstfcke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 13509", "epitope id 13509 tested", "id 13509 tested in", "13509 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_240", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "13509", "12373003" ] }, { "record_id": "GLY_001414_1_240", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "enlcstfcke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 13509", "tested in", "in 3", "3 b", "b cell", "cell assays.", "enlcstfcke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 13509", "13509 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "enlcstfcke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 13509 tested", "13509 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "enlcstfcke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 13509", "epitope id 13509 tested", "id 13509 tested in", "13509 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_241", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "14697", "12170271" ] }, { "record_id": "GLY_001414_1_241", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "evftkktklt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 14697", "tested in", "in 3", "3 b", "b cell", "cell assays.", "evftkktklt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 14697", "14697 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "evftkktklt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 14697 tested", "14697 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "evftkktklt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 14697", "epitope id 14697 tested", "id 14697 tested in", "14697 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_242", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "14697", "12373003" ] }, { "record_id": "GLY_001414_1_242", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "evftkktklt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 14697", "tested in", "in 3", "3 b", "b cell", "cell assays.", "evftkktklt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 14697", "14697 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "evftkktklt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 14697 tested", "14697 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "evftkktklt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 14697", "epitope id 14697 tested", "id 14697 tested in", "14697 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_243", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "45706", "12170271" ] }, { "record_id": "GLY_001414_1_243", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nrlnflkkis is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 45706", "tested in", "in 3", "3 b", "b cell", "cell assays.", "nrlnflkkis is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 45706", "45706 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "nrlnflkkis is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 45706 tested", "45706 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "nrlnflkkis is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 45706", "epitope id 45706 tested", "id 45706 tested in", "45706 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_244", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "45706", "12373003" ] }, { "record_id": "GLY_001414_1_244", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nrlnflkkis is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 45706", "tested in", "in 3", "3 b", "b cell", "cell assays.", "nrlnflkkis is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 45706", "45706 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "nrlnflkkis is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 45706 tested", "45706 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "nrlnflkkis is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 45706", "epitope id 45706 tested", "id 45706 tested in", "45706 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_245", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "50823", "12170271" ] }, { "record_id": "GLY_001414_1_245", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qfyqkfpqyl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 50823", "tested in", "in 3", "3 b", "b cell", "cell assays.", "qfyqkfpqyl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 50823", "50823 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "qfyqkfpqyl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 50823 tested", "50823 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "qfyqkfpqyl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 50823", "epitope id 50823 tested", "id 50823 tested in", "50823 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_246", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "50823", "12373003" ] }, { "record_id": "GLY_001414_1_246", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qfyqkfpqyl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 50823", "tested in", "in 3", "3 b", "b cell", "cell assays.", "qfyqkfpqyl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 50823", "50823 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "qfyqkfpqyl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 50823 tested", "50823 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "qfyqkfpqyl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 50823", "epitope id 50823 tested", "id 50823 tested in", "50823 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_247", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "75506", "12170271" ] }, { "record_id": "GLY_001414_1_247", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yqkfalpqyl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 75506", "tested in", "in 3", "3 b", "b cell", "cell assays.", "yqkfalpqyl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 75506", "75506 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "yqkfalpqyl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 75506 tested", "75506 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "yqkfalpqyl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 75506", "epitope id 75506 tested", "id 75506 tested in", "75506 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_248", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "75506", "12373003" ] }, { "record_id": "GLY_001414_1_248", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yqkfalpqyl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 75506", "tested in", "in 3", "3 b", "b cell", "cell assays.", "yqkfalpqyl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 75506", "75506 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "yqkfalpqyl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 75506 tested", "75506 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "yqkfalpqyl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 75506", "epitope id 75506 tested", "id 75506 tested in", "75506 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_249", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95237", "12373003" ] }, { "record_id": "GLY_001414_1_249", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "alpqylktvy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95237", "tested in", "in 1", "1 b", "b cell", "cell assay", "assay and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "alpqylktvy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95237", "95237 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay", "cell assay and", "assay and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "alpqylktvy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95237 tested", "95237 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay", "b cell assay and", "cell assay and 1", "assay and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "alpqylktvy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95237", "epitope id 95237 tested", "id 95237 tested in", "95237 tested in 1", "tested in 1 b cell", "in 1 b cell assay", "1 b cell assay and", "b cell assay and 1", "cell assay and 1 mhc", "assay and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_250", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95244", "12373003" ] }, { "record_id": "GLY_001414_1_250", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aneeeysigs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95244", "tested in", "in 1", "1 b", "b cell", "cell assay.", "aneeeysigs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95244", "95244 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "aneeeysigs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95244 tested", "95244 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "aneeeysigs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95244", "epitope id 95244 tested", "id 95244 tested in", "95244 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_251", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95351", "12373003" ] }, { "record_id": "GLY_001414_1_251", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eknrlnflkk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95351", "tested in", "in 1", "1 b", "b cell", "cell assay.", "eknrlnflkk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95351", "95351 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "eknrlnflkk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95351 tested", "95351 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "eknrlnflkk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95351", "epitope id 95351 tested", "id 95351 tested in", "95351 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_252", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95387", "12373003" ] }, { "record_id": "GLY_001414_1_252", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "flkkisqryq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95387", "tested in", "in 1", "1 b", "b cell", "cell assay.", "flkkisqryq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95387", "95387 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "flkkisqryq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95387 tested", "95387 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "flkkisqryq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95387", "epitope id 95387 tested", "id 95387 tested in", "95387 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_253", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95395", "12373003" ] }, { "record_id": "GLY_001414_1_253", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ftkktkltee is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95395", "tested in", "in 1", "1 b", "b cell", "cell assay.", "ftkktkltee is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95395", "95395 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "ftkktkltee is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95395 tested", "95395 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "ftkktkltee is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95395", "epitope id 95395 tested", "id 95395 tested in", "95395 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_254", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95467", "12373003" ] }, { "record_id": "GLY_001414_1_254", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "inqfyqkfpq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95467", "tested in", "in 1", "1 b", "b cell", "cell assay.", "inqfyqkfpq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95467", "95467 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "inqfyqkfpq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95467 tested", "95467 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "inqfyqkfpq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95467", "epitope id 95467 tested", "id 95467 tested in", "95467 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_255", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95478", "12373003" ] }, { "record_id": "GLY_001414_1_255", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "isqryqkfal is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95478", "tested in", "in 1", "1 b", "b cell", "cell assay.", "isqryqkfal is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95478", "95478 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "isqryqkfal is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95478 tested", "95478 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "isqryqkfal is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95478", "epitope id 95478 tested", "id 95478 tested in", "95478 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_256", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95481", "12373003" ] }, { "record_id": "GLY_001414_1_256", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "itptlnreql is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95481", "tested in", "in 1", "1 b", "b cell", "cell assay.", "itptlnreql is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95481", "95481 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "itptlnreql is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95481 tested", "95481 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "itptlnreql is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95481", "epitope id 95481 tested", "id 95481 tested in", "95481 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_257", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95491", "12373003" ] }, { "record_id": "GLY_001414_1_257", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kfalpqylkt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95491", "tested in", "in 1", "1 b", "b cell", "cell assay.", "kfalpqylkt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95491", "95491 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "kfalpqylkt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95491 tested", "95491 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "kfalpqylkt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95491", "epitope id 95491 tested", "id 95491 tested in", "95491 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_258", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95493", "12373003" ] }, { "record_id": "GLY_001414_1_258", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kfpqylqyly is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95493", "tested in", "in 1", "1 b", "b cell", "cell assay.", "kfpqylqyly is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95493", "95493 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "kfpqylqyly is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95493 tested", "95493 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "kfpqylqyly is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95493", "epitope id 95493 tested", "id 95493 tested in", "95493 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_259", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95501", "12373003" ] }, { "record_id": "GLY_001414_1_259", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kkisqryqkf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95501", "tested in", "in 1", "1 b", "b cell", "cell assay.", "kkisqryqkf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95501", "95501 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "kkisqryqkf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95501 tested", "95501 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "kkisqryqkf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95501", "epitope id 95501 tested", "id 95501 tested in", "95501 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_260", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95503", "12373003" ] }, { "record_id": "GLY_001414_1_260", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kktklteeek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95503", "tested in", "in 1", "1 b", "b cell", "cell assay.", "kktklteeek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95503", "95503 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "kktklteeek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95503 tested", "95503 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "kktklteeek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95503", "epitope id 95503 tested", "id 95503 tested in", "95503 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_261", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95514", "12373003" ] }, { "record_id": "GLY_001414_1_261", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kpwiqpktkv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95514", "tested in", "in 1", "1 b", "b cell", "cell assay.", "kpwiqpktkv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95514", "95514 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "kpwiqpktkv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95514 tested", "95514 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "kpwiqpktkv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95514", "epitope id 95514 tested", "id 95514 tested in", "95514 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_262", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95544", "12373003" ] }, { "record_id": "GLY_001414_1_262", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lcstfckevv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95544", "tested in", "in 1", "1 b", "b cell", "cell assay.", "lcstfckevv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95544", "95544 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "lcstfckevv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95544 tested", "95544 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "lcstfckevv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95544", "epitope id 95544 tested", "id 95544 tested in", "95544 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_263", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95560", "12373003" ] }, { "record_id": "GLY_001414_1_263", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lnflkkisqr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95560", "tested in", "in 1", "1 b", "b cell", "cell assay.", "lnflkkisqr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95560", "95560 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "lnflkkisqr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95560 tested", "95560 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "lnflkkisqr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95560", "epitope id 95560 tested", "id 95560 tested in", "95560 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_264", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95614", "12373003" ] }, { "record_id": "GLY_001414_1_264", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "neinqfyqkf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95614", "tested in", "in 1", "1 b", "b cell", "cell assay.", "neinqfyqkf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95614", "95614 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "neinqfyqkf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95614 tested", "95614 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "neinqfyqkf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95614", "epitope id 95614 tested", "id 95614 tested in", "95614 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_265", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95681", "12373003" ] }, { "record_id": "GLY_001414_1_265", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pqylktvyqh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95681", "tested in", "in 1", "1 b", "b cell", "cell assay.", "pqylktvyqh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95681", "95681 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "pqylktvyqh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95681 tested", "95681 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "pqylktvyqh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95681", "epitope id 95681 tested", "id 95681 tested in", "95681 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_266", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95682", "12373003" ] }, { "record_id": "GLY_001414_1_266", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pqylqylyqg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95682", "tested in", "in 1", "1 b", "b cell", "cell assay.", "pqylqylyqg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95682", "95682 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "pqylqylyqg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95682 tested", "95682 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "pqylqylyqg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95682", "epitope id 95682 tested", "id 95682 tested in", "95682 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_267", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95739", "12373003" ] }, { "record_id": "GLY_001414_1_267", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qryqkfalpq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95739", "tested in", "in 1", "1 b", "b cell", "cell assay.", "qryqkfalpq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95739", "95739 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "qryqkfalpq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95739 tested", "95739 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "qryqkfalpq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95739", "epitope id 95739 tested", "id 95739 tested in", "95739 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_268", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95750", "12373003" ] }, { "record_id": "GLY_001414_1_268", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qylyqgpivl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95750", "tested in", "in 1", "1 b", "b cell", "cell assay.", "qylyqgpivl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95750", "95750 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "qylyqgpivl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95750 tested", "95750 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "qylyqgpivl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95750", "epitope id 95750 tested", "id 95750 tested in", "95750 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_269", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95766", "12373003" ] }, { "record_id": "GLY_001414_1_269", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rnaneeeysi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95766", "tested in", "in 1", "1 b", "b cell", "cell assay.", "rnaneeeysi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95766", "95766 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "rnaneeeysi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95766 tested", "95766 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "rnaneeeysi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95766", "epitope id 95766 tested", "id 95766 tested in", "95766 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_270", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95856", "12373003" ] }, { "record_id": "GLY_001414_1_270", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "skenlcstfc is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95856", "tested in", "in 1", "1 b", "b cell", "cell assay.", "skenlcstfc is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95856", "95856 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "skenlcstfc is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95856 tested", "95856 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "skenlcstfc is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95856", "epitope id 95856 tested", "id 95856 tested in", "95856 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_271", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95881", "12373003" ] }, { "record_id": "GLY_001414_1_271", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "stevftkktk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95881", "tested in", "in 1", "1 b", "b cell", "cell assay.", "stevftkktk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95881", "95881 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "stevftkktk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95881 tested", "95881 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "stevftkktk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95881", "epitope id 95881 tested", "id 95881 tested in", "95881 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_272", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95970", "12373003" ] }, { "record_id": "GLY_001414_1_272", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vlnpwdqvkr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95970", "tested in", "in 1", "1 b", "b cell", "cell assay.", "vlnpwdqvkr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95970", "95970 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "vlnpwdqvkr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95970 tested", "95970 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "vlnpwdqvkr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95970", "epitope id 95970 tested", "id 95970 tested in", "95970 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_273", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95976", "12373003" ] }, { "record_id": "GLY_001414_1_273", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpitptlnre is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95976", "tested in", "in 1", "1 b", "b cell", "cell assay.", "vpitptlnre is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95976", "95976 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "vpitptlnre is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95976 tested", "95976 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "vpitptlnre is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95976", "epitope id 95976 tested", "id 95976 tested in", "95976 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_274", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "95992", "12373003" ] }, { "record_id": "GLY_001414_1_274", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vvrnaneeey is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 95992", "tested in", "in 1", "1 b", "b cell", "cell assay.", "vvrnaneeey is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 95992", "95992 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "vvrnaneeey is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 95992 tested", "95992 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "vvrnaneeey is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 95992", "epitope id 95992 tested", "id 95992 tested in", "95992 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_275", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "96020", "12373003" ] }, { "record_id": "GLY_001414_1_275", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylktvyqhqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96020", "tested in", "in 1", "1 b", "b cell", "cell assay.", "ylktvyqhqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96020", "96020 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "ylktvyqhqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96020 tested", "96020 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "ylktvyqhqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96020", "epitope id 96020 tested", "id 96020 tested in", "96020 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_276", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "96021", "12373003" ] }, { "record_id": "GLY_001414_1_276", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylqylyqgpi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96021", "tested in", "in 1", "1 b", "b cell", "cell assay.", "ylqylyqgpi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96021", "96021 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "ylqylyqgpi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96021 tested", "96021 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "ylqylyqgpi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96021", "epitope id 96021 tested", "id 96021 tested in", "96021 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_277", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "96023", "12373003" ] }, { "record_id": "GLY_001414_1_277", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yqkfpqylqy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96023", "tested in", "in 1", "1 b", "b cell", "cell assay", "assay and", "and 5", "5 mhc", "mhc ligand", "ligand assays.", "yqkfpqylqy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96023", "96023 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay", "cell assay and", "assay and 5", "and 5 mhc", "5 mhc ligand", "mhc ligand assays.", "yqkfpqylqy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96023 tested", "96023 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay", "b cell assay and", "cell assay and 5", "assay and 5 mhc", "and 5 mhc ligand", "5 mhc ligand assays.", "yqkfpqylqy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96023", "epitope id 96023 tested", "id 96023 tested in", "96023 tested in 1", "tested in 1 b cell", "in 1 b cell assay", "1 b cell assay and", "b cell assay and 5", "cell assay and 5 mhc", "assay and 5 mhc ligand", "and 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_278", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "2150188", "36307246" ] }, { "record_id": "GLY_001414_1_278", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nmainpsk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2150188", "tested in", "in 1", "1 b", "b cell", "cell assay.", "nmainpsk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2150188", "2150188 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "nmainpsk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2150188 tested", "2150188 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "nmainpsk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2150188", "epitope id 2150188 tested", "id 2150188 tested in", "2150188 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_279", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "2244620", "37604312" ] }, { "record_id": "GLY_001414_1_279", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eeknrlnflkkisqr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2244620", "tested in", "in 3", "3 t", "t cell", "cell assays.", "eeknrlnflkkisqr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2244620", "2244620 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "eeknrlnflkkisqr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2244620 tested", "2244620 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "eeknrlnflkkisqr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2244620", "epitope id 2244620 tested", "id 2244620 tested in", "2244620 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_280", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "2246077", "37604312" ] }, { "record_id": "GLY_001414_1_280", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "khyqkalneinqfyq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2246077", "tested in", "in 3", "3 t", "t cell", "cell assays.", "khyqkalneinqfyq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2246077", "2246077 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "khyqkalneinqfyq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2246077 tested", "2246077 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "khyqkalneinqfyq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2246077", "epitope id 2246077 tested", "id 2246077 tested in", "2246077 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_281", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "2246090", "37604312" ] }, { "record_id": "GLY_001414_1_281", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kisqryqkfalpqyl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2246090", "tested in", "in 3", "3 t", "t cell", "cell assays.", "kisqryqkfalpqyl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2246090", "2246090 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "kisqryqkfalpqyl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2246090 tested", "2246090 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "kisqryqkfalpqyl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2246090", "epitope id 2246090 tested", "id 2246090 tested in", "2246090 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_282", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "2246188", "37604312" ] }, { "record_id": "GLY_001414_1_282", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktvyqhqkamkpwiq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2246188", "tested in", "in 3", "3 t", "t cell", "cell assays.", "ktvyqhqkamkpwiq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2246188", "2246188 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "ktvyqhqkamkpwiq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2246188 tested", "2246188 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "ktvyqhqkamkpwiq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2246188", "epitope id 2246188 tested", "id 2246188 tested in", "2246188 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_283", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02663", "p02663 1", "2248466", "37604312" ] }, { "record_id": "GLY_001414_1_283", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yqkfalpqylktvyq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2248466", "tested in", "in 3", "3 t", "t cell", "cell assays.", "yqkfalpqylktvyq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2248466", "2248466 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "yqkfalpqylktvyq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2248466 tested", "2248466 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "yqkfalpqylktvyq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2248466", "epitope id 2248466 tested", "id 2248466 tested in", "2248466 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_284", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02666", "p02666 1", "38630", "11678861" ] }, { "record_id": "GLY_001414_1_284", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lpptvmfppq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 38630", "tested in", "in 4", "4 b", "b cell", "cell assays.", "lpptvmfppq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 38630", "38630 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "lpptvmfppq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 38630 tested", "38630 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "lpptvmfppq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 38630", "epitope id 38630 tested", "id 38630 tested in", "38630 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_285", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02666", "p02666 1", "51169", "11678861" ] }, { "record_id": "GLY_001414_1_285", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qkavpypqrd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 51169", "tested in", "in 4", "4 b", "b cell", "cell assays.", "qkavpypqrd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 51169", "51169 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "qkavpypqrd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 51169 tested", "51169 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "qkavpypqrd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 51169", "epitope id 51169 tested", "id 51169 tested in", "51169 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_286", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02666", "p02666 1", "52358", "11678861" ] }, { "record_id": "GLY_001414_1_286", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qskvlpvpqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 52358", "tested in", "in 4", "4 b", "b cell", "cell assays.", "qskvlpvpqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 52358", "52358 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "qskvlpvpqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 52358 tested", "52358 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "qskvlpvpqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 52358", "epitope id 52358 tested", "id 52358 tested in", "52358 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_287", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02666", "p02666 1", "71789", "17517096" ] }, { "record_id": "GLY_001414_1_287", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vvppflqpev is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 71789", "tested in", "in 3", "3 b", "b cell", "cell assays", "assays and", "and 45", "45 mhc", "mhc ligand", "ligand assays.", "vvppflqpev is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 71789", "71789 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays", "cell assays and", "assays and 45", "and 45 mhc", "45 mhc ligand", "mhc ligand assays.", "vvppflqpev is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 71789 tested", "71789 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays", "b cell assays and", "cell assays and 45", "assays and 45 mhc", "and 45 mhc ligand", "45 mhc ligand assays.", "vvppflqpev is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 71789", "epitope id 71789 tested", "id 71789 tested in", "71789 tested in 3", "tested in 3 b cell", "in 3 b cell assays", "3 b cell assays and", "b cell assays and 45", "cell assays and 45 mhc", "assays and 45 mhc ligand", "and 45 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_288", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02666", "p02666 1", "75481", "11678861" ] }, { "record_id": "GLY_001414_1_288", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yqepvlgpvr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 75481", "tested in", "in 4", "4 b", "b cell", "cell assays", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "yqepvlgpvr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 75481", "75481 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "yqepvlgpvr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 75481 tested", "75481 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays", "b cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "yqepvlgpvr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 75481", "epitope id 75481 tested", "id 75481 tested in", "75481 tested in 4", "tested in 4 b cell", "in 4 b cell assays", "4 b cell assays and", "b cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_289", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02666", "p02666 1", "115807", "11529896" ] }, { "record_id": "GLY_001414_1_289", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kempfpkypv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115807", "tested in", "in 2", "2 b", "b cell", "cell assays.", "kempfpkypv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115807", "115807 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "kempfpkypv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115807 tested", "115807 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "kempfpkypv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115807", "epitope id 115807 tested", "id 115807 tested in", "115807 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_290", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02666", "p02666 1", "115823", "11529896" ] }, { "record_id": "GLY_001414_1_290", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "khkempfpky is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115823", "tested in", "in 2", "2 b", "b cell", "cell assays.", "khkempfpky is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115823", "115823 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "khkempfpky is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115823 tested", "115823 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "khkempfpky is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115823", "epitope id 115823 tested", "id 115823 tested in", "115823 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_291", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02666", "p02666 1", "115865", "11529896" ] }, { "record_id": "GLY_001414_1_291", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mpfpkypvep is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115865", "tested in", "in 2", "2 b", "b cell", "cell assays.", "mpfpkypvep is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115865", "115865 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "mpfpkypvep is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115865 tested", "115865 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "mpfpkypvep is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115865", "epitope id 115865 tested", "id 115865 tested in", "115865 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_292", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "8994", "11529896" ] }, { "record_id": "GLY_001414_1_292", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dkteiptint is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 8994", "tested in", "in 4", "4 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "dkteiptint is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 8994", "8994 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "dkteiptint is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 8994 tested", "8994 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "dkteiptint is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 8994", "epitope id 8994 tested", "id 8994 tested in", "8994 tested in 4", "tested in 4 b cell", "in 4 b cell assays", "4 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_293", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "8994", "12170271" ] }, { "record_id": "GLY_001414_1_293", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dkteiptint is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 8994", "tested in", "in 4", "4 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "dkteiptint is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 8994", "8994 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "dkteiptint is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 8994 tested", "8994 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "dkteiptint is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 8994", "epitope id 8994 tested", "id 8994 tested in", "8994 tested in 4", "tested in 4 b cell", "in 4 b cell assays", "4 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_294", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "11210", "18186809" ] }, { "record_id": "GLY_001414_1_294", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eavestvatled is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 11210", "tested in", "in 1", "1 b", "b cell", "cell assay.", "eavestvatled is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 11210", "11210 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "eavestvatled is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 11210 tested", "11210 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "eavestvatled is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 11210", "epitope id 11210 tested", "id 11210 tested in", "11210 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_295", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "15893", "11529896" ] }, { "record_id": "GLY_001414_1_295", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ffsdkiakyi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 15893", "tested in", "in 5", "5 b", "b cell", "cell assays.", "ffsdkiakyi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 15893", "15893 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "ffsdkiakyi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 15893 tested", "15893 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "ffsdkiakyi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 15893", "epitope id 15893 tested", "id 15893 tested in", "15893 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_296", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "15893", "12170271" ] }, { "record_id": "GLY_001414_1_296", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ffsdkiakyi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 15893", "tested in", "in 5", "5 b", "b cell", "cell assays.", "ffsdkiakyi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 15893", "15893 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "ffsdkiakyi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 15893 tested", "15893 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "ffsdkiakyi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 15893", "epitope id 15893 tested", "id 15893 tested in", "15893 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_297", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "15893", "18186809" ] }, { "record_id": "GLY_001414_1_297", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ffsdkiakyi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 15893", "tested in", "in 5", "5 b", "b cell", "cell assays.", "ffsdkiakyi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 15893", "15893 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "ffsdkiakyi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 15893 tested", "15893 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "ffsdkiakyi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 15893", "epitope id 15893 tested", "id 15893 tested in", "15893 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_298", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "16863", "11529896" ] }, { "record_id": "GLY_001414_1_298", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "flpypyyakp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 16863", "tested in", "in 4", "4 b", "b cell", "cell assays.", "flpypyyakp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 16863", "16863 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "flpypyyakp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 16863 tested", "16863 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "flpypyyakp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 16863", "epitope id 16863 tested", "id 16863 tested in", "16863 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_299", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "16863", "12170271" ] }, { "record_id": "GLY_001414_1_299", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "flpypyyakp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 16863", "tested in", "in 4", "4 b", "b cell", "cell assays.", "flpypyyakp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 16863", "16863 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "flpypyyakp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 16863 tested", "16863 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "flpypyyakp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 16863", "epitope id 16863 tested", "id 16863 tested in", "16863 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_300", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "30141", "11529896" ] }, { "record_id": "GLY_001414_1_300", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kderffsdki is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 30141", "tested in", "in 4", "4 b", "b cell", "cell assays.", "kderffsdki is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 30141", "30141 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "kderffsdki is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 30141 tested", "30141 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "kderffsdki is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 30141", "epitope id 30141 tested", "id 30141 tested in", "30141 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_301", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "30141", "12170271" ] }, { "record_id": "GLY_001414_1_301", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kderffsdki is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 30141", "tested in", "in 4", "4 b", "b cell", "cell assays.", "kderffsdki is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 30141", "30141 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "kderffsdki is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 30141 tested", "30141 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "kderffsdki is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 30141", "epitope id 30141 tested", "id 30141 tested in", "30141 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_302", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "54078", "11529896" ] }, { "record_id": "GLY_001414_1_302", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rhphphlsfm is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 54078", "tested in", "in 4", "4 b", "b cell", "cell assays.", "rhphphlsfm is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 54078", "54078 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "rhphphlsfm is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 54078 tested", "54078 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "rhphphlsfm is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 54078", "epitope id 54078 tested", "id 54078 tested in", "54078 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_303", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "54078", "12170271" ] }, { "record_id": "GLY_001414_1_303", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rhphphlsfm is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 54078", "tested in", "in 4", "4 b", "b cell", "cell assays.", "rhphphlsfm is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 54078", "54078 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "rhphphlsfm is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 54078 tested", "54078 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "rhphphlsfm is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 54078", "epitope id 54078 tested", "id 54078 tested in", "54078 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_304", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "54079", "18186809" ] }, { "record_id": "GLY_001414_1_304", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rhphphlsfmai is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 54079", "tested in", "in 1", "1 b", "b cell", "cell assay.", "rhphphlsfmai is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 54079", "54079 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "rhphphlsfmai is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 54079 tested", "54079 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "rhphphlsfmai is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 54079", "epitope id 54079 tested", "id 54079 tested in", "54079 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_305", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "60178", "11529896" ] }, { "record_id": "GLY_001414_1_305", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sppeintvqv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 60178", "tested in", "in 4", "4 b", "b cell", "cell assays.", "sppeintvqv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 60178", "60178 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "sppeintvqv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 60178 tested", "60178 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "sppeintvqv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 60178", "epitope id 60178 tested", "id 60178 tested in", "60178 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_306", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "60178", "12170271" ] }, { "record_id": "GLY_001414_1_306", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sppeintvqv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 60178", "tested in", "in 4", "4 b", "b cell", "cell assays.", "sppeintvqv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 60178", "60178 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "sppeintvqv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 60178 tested", "60178 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "sppeintvqv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 60178", "epitope id 60178 tested", "id 60178 tested in", "60178 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_307", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "68358", "11529896" ] }, { "record_id": "GLY_001414_1_307", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vestvatled is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 68358", "tested in", "in 4", "4 b", "b cell", "cell assays.", "vestvatled is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 68358", "68358 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "vestvatled is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 68358 tested", "68358 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "vestvatled is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 68358", "epitope id 68358 tested", "id 68358 tested in", "68358 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_308", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "68358", "12170271" ] }, { "record_id": "GLY_001414_1_308", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vestvatled is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 68358", "tested in", "in 4", "4 b", "b cell", "cell assays.", "vestvatled is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 68358", "68358 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "vestvatled is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 68358 tested", "68358 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "vestvatled is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 68358", "epitope id 68358 tested", "id 68358 tested in", "68358 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_309", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "69782", "11529896" ] }, { "record_id": "GLY_001414_1_309", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vlsrypsygl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 69782", "tested in", "in 4", "4 b", "b cell", "cell assays.", "vlsrypsygl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 69782", "69782 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "vlsrypsygl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 69782 tested", "69782 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "vlsrypsygl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 69782", "epitope id 69782 tested", "id 69782 tested in", "69782 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_310", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "69782", "12170271" ] }, { "record_id": "GLY_001414_1_310", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vlsrypsygl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 69782", "tested in", "in 4", "4 b", "b cell", "cell assays.", "vlsrypsygl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 69782", "69782 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "vlsrypsygl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 69782 tested", "69782 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "vlsrypsygl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 69782", "epitope id 69782 tested", "id 69782 tested in", "69782 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_311", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "70823", "11529896" ] }, { "record_id": "GLY_001414_1_311", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vrspaqilqw is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 70823", "tested in", "in 4", "4 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "vrspaqilqw is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 70823", "70823 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vrspaqilqw is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 70823 tested", "70823 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "vrspaqilqw is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 70823", "epitope id 70823 tested", "id 70823 tested in", "70823 tested in 4", "tested in 4 b cell", "in 4 b cell assays", "4 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_312", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "70823", "12170271" ] }, { "record_id": "GLY_001414_1_312", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vrspaqilqw is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 70823", "tested in", "in 4", "4 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "vrspaqilqw is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 70823", "70823 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vrspaqilqw is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 70823 tested", "70823 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "vrspaqilqw is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 70823", "epitope id 70823 tested", "id 70823 tested in", "70823 tested in 4", "tested in 4 b cell", "in 4 b cell assays", "4 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_313", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115175", "21211944" ] }, { "record_id": "GLY_001414_1_313", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "akscqaqpttmarhphphls is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115175", "tested in", "in 3", "3 b", "b cell", "cell assays.", "akscqaqpttmarhphphls is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115175", "115175 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "akscqaqpttmarhphphls is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115175 tested", "115175 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "akscqaqpttmarhphphls is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115175", "epitope id 115175 tested", "id 115175 tested in", "115175 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_314", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115195", "21211944" ] }, { "record_id": "GLY_001414_1_314", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "cqaqpttmarhphphlsfma is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115195", "tested in", "in 3", "3 b", "b cell", "cell assays.", "cqaqpttmarhphphlsfma is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115195", "115195 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "cqaqpttmarhphphlsfma is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115195 tested", "115195 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "cqaqpttmarhphphlsfma is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115195", "epitope id 115195 tested", "id 115195 tested in", "115195 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_315", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115292", "21211944" ] }, { "record_id": "GLY_001414_1_315", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ilqwqvlsntvpakscqaqp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115292", "tested in", "in 3", "3 b", "b cell", "cell assays.", "ilqwqvlsntvpakscqaqp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115292", "115292 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "ilqwqvlsntvpakscqaqp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115292 tested", "115292 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "ilqwqvlsntvpakscqaqp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115292", "epitope id 115292 tested", "id 115292 tested in", "115292 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_316", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115409", "21211944" ] }, { "record_id": "GLY_001414_1_316", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "paavrspaqilqwqvlsntv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115409", "tested in", "in 3", "3 b", "b cell", "cell assays.", "paavrspaqilqwqvlsntv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115409", "115409 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "paavrspaqilqwqvlsntv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115409 tested", "115409 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "paavrspaqilqwqvlsntv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115409", "epitope id 115409 tested", "id 115409 tested in", "115409 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_317", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115410", "21211944" ] }, { "record_id": "GLY_001414_1_317", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "paqilqwqvlsntvpakscq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115410", "tested in", "in 3", "3 b", "b cell", "cell assays.", "paqilqwqvlsntvpakscq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115410", "115410 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "paqilqwqvlsntvpakscq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115410 tested", "115410 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "paqilqwqvlsntvpakscq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115410", "epitope id 115410 tested", "id 115410 tested in", "115410 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_318", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115423", "21211944" ] }, { "record_id": "GLY_001414_1_318", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ppkknqdkteiptintiasg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115423", "tested in", "in 3", "3 b", "b cell", "cell assays.", "ppkknqdkteiptintiasg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115423", "115423 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "ppkknqdkteiptintiasg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115423 tested", "115423 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "ppkknqdkteiptintiasg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115423", "epitope id 115423 tested", "id 115423 tested in", "115423 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_319", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115428", "21211944" ] }, { "record_id": "GLY_001414_1_319", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ptstptteavestvatleds is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115428", "tested in", "in 3", "3 b", "b cell", "cell assays.", "ptstptteavestvatleds is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115428", "115428 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "ptstptteavestvatleds is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115428 tested", "115428 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "ptstptteavestvatleds is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115428", "epitope id 115428 tested", "id 115428 tested in", "115428 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_320", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115468", "21211944" ] }, { "record_id": "GLY_001414_1_320", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rhphphlsfmaippkknqdk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115468", "tested in", "in 3", "3 b", "b cell", "cell assays.", "rhphphlsfmaippkknqdk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115468", "115468 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "rhphphlsfmaippkknqdk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115468 tested", "115468 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "rhphphlsfmaippkknqdk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115468", "epitope id 115468 tested", "id 115468 tested in", "115468 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_321", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115485", "21211944" ] }, { "record_id": "GLY_001414_1_321", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sgeptstptteavestvatl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115485", "tested in", "in 3", "3 b", "b cell", "cell assays.", "sgeptstptteavestvatl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115485", "115485 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "sgeptstptteavestvatl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115485 tested", "115485 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "sgeptstptteavestvatl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115485", "epitope id 115485 tested", "id 115485 tested in", "115485 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_322", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115509", "21211944" ] }, { "record_id": "GLY_001414_1_322", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tiasgeptstptteavestv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115509", "tested in", "in 3", "3 b", "b cell", "cell assays.", "tiasgeptstptteavestv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115509", "115509 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "tiasgeptstptteavestv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115509 tested", "115509 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "tiasgeptstptteavestv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115509", "epitope id 115509 tested", "id 115509 tested in", "115509 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_323", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115510", "21211944" ] }, { "record_id": "GLY_001414_1_323", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tintiasgeptstptteave is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115510", "tested in", "in 3", "3 b", "b cell", "cell assays.", "tintiasgeptstptteave is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115510", "115510 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "tintiasgeptstptteave is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115510 tested", "115510 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "tintiasgeptstptteave is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115510", "epitope id 115510 tested", "id 115510 tested in", "115510 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_324", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115548", "21211944" ] }, { "record_id": "GLY_001414_1_324", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vrspaqilqwqvlsntvpak is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115548", "tested in", "in 3", "3 b", "b cell", "cell assays.", "vrspaqilqwqvlsntvpak is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115548", "115548 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "vrspaqilqwqvlsntvpak is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115548 tested", "115548 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "vrspaqilqwqvlsntvpak is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115548", "epitope id 115548 tested", "id 115548 tested in", "115548 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_325", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115564", "21211944" ] }, { "record_id": "GLY_001414_1_325", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yakpaavrspaqilqwqvls is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115564", "tested in", "in 3", "3 b", "b cell", "cell assays.", "yakpaavrspaqilqwqvls is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115564", "115564 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "yakpaavrspaqilqwqvls is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115564 tested", "115564 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "yakpaavrspaqilqwqvls is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115564", "epitope id 115564 tested", "id 115564 tested in", "115564 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_326", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115568", "21211944" ] }, { "record_id": "GLY_001414_1_326", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ypyyakpaavrspaqilqwq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115568", "tested in", "in 3", "3 b", "b cell", "cell assays.", "ypyyakpaavrspaqilqwq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115568", "115568 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "ypyyakpaavrspaqilqwq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115568 tested", "115568 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "ypyyakpaavrspaqilqwq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115568", "epitope id 115568 tested", "id 115568 tested in", "115568 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_327", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115672", "11529896" ] }, { "record_id": "GLY_001414_1_327", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aavrspaqil is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115672", "tested in", "in 2", "2 b", "b cell", "cell assays.", "aavrspaqil is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115672", "115672 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "aavrspaqil is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115672 tested", "115672 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "aavrspaqil is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115672", "epitope id 115672 tested", "id 115672 tested in", "115672 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_328", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115678", "11529896" ] }, { "record_id": "GLY_001414_1_328", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aippkknqdk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115678", "tested in", "in 2", "2 b", "b cell", "cell assays.", "aippkknqdk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115678", "115678 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "aippkknqdk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115678 tested", "115678 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "aippkknqdk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115678", "epitope id 115678 tested", "id 115678 tested in", "115678 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_329", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115680", "11529896" ] }, { "record_id": "GLY_001414_1_329", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "akyipiqyvl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115680", "tested in", "in 2", "2 b", "b cell", "cell assays.", "akyipiqyvl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115680", "115680 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "akyipiqyvl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115680 tested", "115680 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "akyipiqyvl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115680", "epitope id 115680 tested", "id 115680 tested in", "115680 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_330", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115684", "11529896" ] }, { "record_id": "GLY_001414_1_330", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "alinnqflpy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115684", "tested in", "in 2", "2 b", "b cell", "cell assays.", "alinnqflpy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115684", "115684 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "alinnqflpy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115684 tested", "115684 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "alinnqflpy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115684", "epitope id 115684 tested", "id 115684 tested in", "115684 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_331", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115689", "11529896" ] }, { "record_id": "GLY_001414_1_331", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aqilqwqvls is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115689", "tested in", "in 2", "2 b", "b cell", "cell assays.", "aqilqwqvls is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115689", "115689 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "aqilqwqvls is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115689 tested", "115689 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "aqilqwqvls is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115689", "epitope id 115689 tested", "id 115689 tested in", "115689 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_332", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115700", "11529896" ] }, { "record_id": "GLY_001414_1_332", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "cekderffsd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115700", "tested in", "in 2", "2 b", "b cell", "cell assays.", "cekderffsd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115700", "115700 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "cekderffsd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115700 tested", "115700 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "cekderffsd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115700", "epitope id 115700 tested", "id 115700 tested in", "115700 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_333", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115718", "11529896" ] }, { "record_id": "GLY_001414_1_333", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eavestvatl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115718", "tested in", "in 2", "2 b", "b cell", "cell assays.", "eavestvatl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115718", "115718 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "eavestvatl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115718 tested", "115718 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "eavestvatl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115718", "epitope id 115718 tested", "id 115718 tested in", "115718 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_334", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115719", "11529896" ] }, { "record_id": "GLY_001414_1_334", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "edspeviesp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115719", "tested in", "in 2", "2 b", "b cell", "cell assays.", "edspeviesp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115719", "115719 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "edspeviesp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115719 tested", "115719 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "edspeviesp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115719", "epitope id 115719 tested", "id 115719 tested in", "115719 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_335", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115730", "11529896" ] }, { "record_id": "GLY_001414_1_335", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eptstpttea is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115730", "tested in", "in 2", "2 b", "b cell", "cell assays.", "eptstpttea is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115730", "115730 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "eptstpttea is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115730 tested", "115730 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "eptstpttea is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115730", "epitope id 115730 tested", "id 115730 tested in", "115730 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_336", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115733", "11529896" ] }, { "record_id": "GLY_001414_1_336", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "erffsdkiak is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115733", "tested in", "in 2", "2 b", "b cell", "cell assays.", "erffsdkiak is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115733", "115733 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "erffsdkiak is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115733 tested", "115733 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "erffsdkiak is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115733", "epitope id 115733 tested", "id 115733 tested in", "115733 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_337", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115736", "11529896" ] }, { "record_id": "GLY_001414_1_337", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eviesppein is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115736", "tested in", "in 2", "2 b", "b cell", "cell assays.", "eviesppein is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115736", "115736 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "eviesppein is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115736 tested", "115736 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "eviesppein is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115736", "epitope id 115736 tested", "id 115736 tested in", "115736 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_338", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115741", "11529896" ] }, { "record_id": "GLY_001414_1_338", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fmaippkknq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115741", "tested in", "in 2", "2 b", "b cell", "cell assays.", "fmaippkknq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115741", "115741 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "fmaippkknq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115741 tested", "115741 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "fmaippkknq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115741", "epitope id 115741 tested", "id 115741 tested in", "115741 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_339", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115760", "11529896" ] }, { "record_id": "GLY_001414_1_339", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "glnyyqqkpv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115760", "tested in", "in 2", "2 b", "b cell", "cell assays.", "glnyyqqkpv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115760", "115760 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "glnyyqqkpv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115760 tested", "115760 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "glnyyqqkpv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115760", "epitope id 115760 tested", "id 115760 tested in", "115760 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_340", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115787", "11529896" ] }, { "record_id": "GLY_001414_1_340", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "iasgeptstp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115787", "tested in", "in 2", "2 b", "b cell", "cell assays.", "iasgeptstp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115787", "115787 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "iasgeptstp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115787 tested", "115787 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "iasgeptstp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115787", "epitope id 115787 tested", "id 115787 tested in", "115787 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_341", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115788", "11529896" ] }, { "record_id": "GLY_001414_1_341", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "iesppeintv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115788", "tested in", "in 2", "2 b", "b cell", "cell assays.", "iesppeintv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115788", "115788 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "iesppeintv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115788 tested", "115788 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "iesppeintv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115788", "epitope id 115788 tested", "id 115788 tested in", "115788 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_342", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115791", "11529896" ] }, { "record_id": "GLY_001414_1_342", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ilqwqvlsnt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115791", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ilqwqvlsnt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115791", "115791 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ilqwqvlsnt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115791 tested", "115791 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ilqwqvlsnt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115791", "epitope id 115791 tested", "id 115791 tested in", "115791 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_343", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115793", "11529896" ] }, { "record_id": "GLY_001414_1_343", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "innqflpypy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115793", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "innqflpypy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115793", "115793 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "innqflpypy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115793 tested", "115793 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "innqflpypy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115793", "epitope id 115793 tested", "id 115793 tested in", "115793 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_344", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115795", "11529896" ] }, { "record_id": "GLY_001414_1_344", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "iptintiasg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115795", "tested in", "in 2", "2 b", "b cell", "cell assays.", "iptintiasg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115795", "115795 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "iptintiasg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115795 tested", "115795 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "iptintiasg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115795", "epitope id 115795 tested", "id 115795 tested in", "115795 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_345", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115799", "11529896" ] }, { "record_id": "GLY_001414_1_345", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ircekderff is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115799", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ircekderff is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115799", "115799 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ircekderff is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115799 tested", "115799 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ircekderff is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115799", "epitope id 115799 tested", "id 115799 tested in", "115799 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_346", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115824", "11529896" ] }, { "record_id": "GLY_001414_1_346", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kiakyipiqy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115824", "tested in", "in 2", "2 b", "b cell", "cell assays.", "kiakyipiqy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115824", "115824 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "kiakyipiqy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115824 tested", "115824 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "kiakyipiqy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115824", "epitope id 115824 tested", "id 115824 tested in", "115824 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_347", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115827", "11529896" ] }, { "record_id": "GLY_001414_1_347", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kknqdkteip is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115827", "tested in", "in 2", "2 b", "b cell", "cell assays.", "kknqdkteip is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115827", "115827 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "kknqdkteip is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115827 tested", "115827 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "kknqdkteip is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115827", "epitope id 115827 tested", "id 115827 tested in", "115827 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_348", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115828", "11529896" ] }, { "record_id": "GLY_001414_1_348", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kpaavrspaq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115828", "tested in", "in 2", "2 b", "b cell", "cell assays.", "kpaavrspaq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115828", "115828 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "kpaavrspaq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115828 tested", "115828 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "kpaavrspaq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115828", "epitope id 115828 tested", "id 115828 tested in", "115828 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_349", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115853", "11529896" ] }, { "record_id": "GLY_001414_1_349", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lsfmaippkk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115853", "tested in", "in 2", "2 b", "b cell", "cell assays.", "lsfmaippkk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115853", "115853 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "lsfmaippkk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115853 tested", "115853 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "lsfmaippkk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115853", "epitope id 115853 tested", "id 115853 tested in", "115853 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_350", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115863", "11529896" ] }, { "record_id": "GLY_001414_1_350", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "marhphphls is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115863", "tested in", "in 2", "2 b", "b cell", "cell assays.", "marhphphls is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115863", "115863 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "marhphphls is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115863 tested", "115863 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "marhphphls is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115863", "epitope id 115863 tested", "id 115863 tested in", "115863 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_351", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115873", "11529896" ] }, { "record_id": "GLY_001414_1_351", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nqdkteipti is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115873", "tested in", "in 2", "2 b", "b cell", "cell assays.", "nqdkteipti is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115873", "115873 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "nqdkteipti is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115873 tested", "115873 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "nqdkteipti is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115873", "epitope id 115873 tested", "id 115873 tested in", "115873 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_352", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115874", "11529896" ] }, { "record_id": "GLY_001414_1_352", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nqflpypyya is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115874", "tested in", "in 2", "2 b", "b cell", "cell assays.", "nqflpypyya is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115874", "115874 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "nqflpypyya is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115874 tested", "115874 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "nqflpypyya is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115874", "epitope id 115874 tested", "id 115874 tested in", "115874 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_353", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115875", "11529896" ] }, { "record_id": "GLY_001414_1_353", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ntiasgepts is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115875", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ntiasgepts is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115875", "115875 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ntiasgepts is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115875 tested", "115875 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ntiasgepts is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115875", "epitope id 115875 tested", "id 115875 tested in", "115875 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_354", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115879", "11529896" ] }, { "record_id": "GLY_001414_1_354", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nyyqqkpval is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115879", "tested in", "in 2", "2 b", "b cell", "cell assays.", "nyyqqkpval is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115879", "115879 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "nyyqqkpval is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115879 tested", "115879 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "nyyqqkpval is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115879", "epitope id 115879 tested", "id 115879 tested in", "115879 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_355", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115881", "11529896" ] }, { "record_id": "GLY_001414_1_355", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "peintvqvts is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115881", "tested in", "in 2", "2 b", "b cell", "cell assays.", "peintvqvts is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115881", "115881 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "peintvqvts is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115881 tested", "115881 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "peintvqvts is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115881", "epitope id 115881 tested", "id 115881 tested in", "115881 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_356", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115886", "11529896" ] }, { "record_id": "GLY_001414_1_356", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "phlsfmaipp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115886", "tested in", "in 2", "2 b", "b cell", "cell assays.", "phlsfmaipp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115886", "115886 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "phlsfmaipp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115886 tested", "115886 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "phlsfmaipp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115886", "epitope id 115886 tested", "id 115886 tested in", "115886 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_357", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115887", "11529896" ] }, { "record_id": "GLY_001414_1_357", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "phphlsfmai is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115887", "tested in", "in 2", "2 b", "b cell", "cell assays.", "phphlsfmai is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115887", "115887 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "phphlsfmai is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115887 tested", "115887 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "phphlsfmai is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115887", "epitope id 115887 tested", "id 115887 tested in", "115887 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_358", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115890", "11529896" ] }, { "record_id": "GLY_001414_1_358", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "piqyvlsryp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115890", "tested in", "in 2", "2 b", "b cell", "cell assays.", "piqyvlsryp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115890", "115890 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "piqyvlsryp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115890 tested", "115890 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "piqyvlsryp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115890", "epitope id 115890 tested", "id 115890 tested in", "115890 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_359", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115896", "11529896" ] }, { "record_id": "GLY_001414_1_359", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ppkknqdkte is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115896", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ppkknqdkte is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115896", "115896 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ppkknqdkte is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115896 tested", "115896 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ppkknqdkte is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115896", "epitope id 115896 tested", "id 115896 tested in", "115896 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_360", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115905", "11529896" ] }, { "record_id": "GLY_001414_1_360", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pvalinnqfl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115905", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pvalinnqfl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115905", "115905 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pvalinnqfl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115905 tested", "115905 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pvalinnqfl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115905", "epitope id 115905 tested", "id 115905 tested in", "115905 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_361", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115910", "11529896" ] }, { "record_id": "GLY_001414_1_361", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pypyyakpaa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115910", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pypyyakpaa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115910", "115910 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pypyyakpaa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115910 tested", "115910 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pypyyakpaa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115910", "epitope id 115910 tested", "id 115910 tested in", "115910 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_362", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115911", "11529896" ] }, { "record_id": "GLY_001414_1_362", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pyyakpaavr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115911", "tested in", "in 2", "2 b", "b cell", "cell assays.", "pyyakpaavr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115911", "115911 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "pyyakpaavr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115911 tested", "115911 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "pyyakpaavr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115911", "epitope id 115911 tested", "id 115911 tested in", "115911 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_363", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115913", "11529896" ] }, { "record_id": "GLY_001414_1_363", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qaqpttmarh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115913", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qaqpttmarh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115913", "115913 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qaqpttmarh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115913 tested", "115913 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qaqpttmarh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115913", "epitope id 115913 tested", "id 115913 tested in", "115913 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_364", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115915", "11529896" ] }, { "record_id": "GLY_001414_1_364", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qeqnqeqpir is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115915", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qeqnqeqpir is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115915", "115915 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qeqnqeqpir is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115915 tested", "115915 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qeqnqeqpir is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115915", "epitope id 115915 tested", "id 115915 tested in", "115915 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_365", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115916", "11529896" ] }, { "record_id": "GLY_001414_1_365", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qeqpircekd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115916", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qeqpircekd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115916", "115916 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qeqpircekd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115916 tested", "115916 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qeqpircekd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115916", "epitope id 115916 tested", "id 115916 tested in", "115916 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_366", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115917", "11529896" ] }, { "record_id": "GLY_001414_1_366", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qkpvalinnq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115917", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qkpvalinnq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115917", "115917 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qkpvalinnq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115917 tested", "115917 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qkpvalinnq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115917", "epitope id 115917 tested", "id 115917 tested in", "115917 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_367", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115920", "11529896" ] }, { "record_id": "GLY_001414_1_367", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qnqeqpirce is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115920", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qnqeqpirce is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115920", "115920 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qnqeqpirce is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115920 tested", "115920 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qnqeqpirce is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115920", "epitope id 115920 tested", "id 115920 tested in", "115920 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_368", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115922", "11529896" ] }, { "record_id": "GLY_001414_1_368", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qpircekder is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115922", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qpircekder is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115922", "115922 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qpircekder is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115922 tested", "115922 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qpircekder is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115922", "epitope id 115922 tested", "id 115922 tested in", "115922 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_369", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115924", "11529896" ] }, { "record_id": "GLY_001414_1_369", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qpttmarhph is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115924", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qpttmarhph is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115924", "115924 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qpttmarhph is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115924 tested", "115924 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qpttmarhph is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115924", "epitope id 115924 tested", "id 115924 tested in", "115924 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_370", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115932", "11529896" ] }, { "record_id": "GLY_001414_1_370", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qvlsntvpak is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115932", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qvlsntvpak is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115932", "115932 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qvlsntvpak is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115932 tested", "115932 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qvlsntvpak is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115932", "epitope id 115932 tested", "id 115932 tested in", "115932 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_371", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115933", "11529896" ] }, { "record_id": "GLY_001414_1_371", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qwqvlsntvp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115933", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qwqvlsntvp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115933", "115933 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qwqvlsntvp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115933 tested", "115933 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qwqvlsntvp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115933", "epitope id 115933 tested", "id 115933 tested in", "115933 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_372", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115935", "11529896" ] }, { "record_id": "GLY_001414_1_372", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qyvlsrypsy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115935", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qyvlsrypsy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115935", "115935 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qyvlsrypsy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115935 tested", "115935 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qyvlsrypsy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115935", "epitope id 115935 tested", "id 115935 tested in", "115935 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_373", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115955", "11529896" ] }, { "record_id": "GLY_001414_1_373", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sgeptstptt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115955", "tested in", "in 2", "2 b", "b cell", "cell assays.", "sgeptstptt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115955", "115955 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "sgeptstptt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115955 tested", "115955 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "sgeptstptt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115955", "epitope id 115955 tested", "id 115955 tested in", "115955 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_374", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115979", "11529896" ] }, { "record_id": "GLY_001414_1_374", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "spaqilqwqv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115979", "tested in", "in 2", "2 b", "b cell", "cell assays.", "spaqilqwqv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115979", "115979 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "spaqilqwqv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115979 tested", "115979 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "spaqilqwqv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115979", "epitope id 115979 tested", "id 115979 tested in", "115979 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_375", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115980", "11529896" ] }, { "record_id": "GLY_001414_1_375", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "speviesppe is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115980", "tested in", "in 2", "2 b", "b cell", "cell assays.", "speviesppe is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115980", "115980 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "speviesppe is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115980 tested", "115980 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "speviesppe is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115980", "epitope id 115980 tested", "id 115980 tested in", "115980 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_376", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115982", "11529896" ] }, { "record_id": "GLY_001414_1_376", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "srypsyglny is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115982", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "srypsyglny is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115982", "115982 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "srypsyglny is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115982 tested", "115982 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "srypsyglny is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115982", "epitope id 115982 tested", "id 115982 tested in", "115982 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_377", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115985", "11529896" ] }, { "record_id": "GLY_001414_1_377", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "stvatledsp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115985", "tested in", "in 2", "2 b", "b cell", "cell assays.", "stvatledsp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115985", "115985 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "stvatledsp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115985 tested", "115985 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "stvatledsp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115985", "epitope id 115985 tested", "id 115985 tested in", "115985 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_378", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115990", "21211944" ] }, { "record_id": "GLY_001414_1_378", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "syglnyyqqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115990", "tested in", "in 5", "5 b", "b cell", "cell assays.", "syglnyyqqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115990", "115990 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "syglnyyqqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115990 tested", "115990 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "syglnyyqqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115990", "epitope id 115990 tested", "id 115990 tested in", "115990 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_379", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115990", "11529896" ] }, { "record_id": "GLY_001414_1_379", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "syglnyyqqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115990", "tested in", "in 5", "5 b", "b cell", "cell assays.", "syglnyyqqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115990", "115990 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "syglnyyqqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115990 tested", "115990 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "syglnyyqqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115990", "epitope id 115990 tested", "id 115990 tested in", "115990 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_380", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115993", "11529896" ] }, { "record_id": "GLY_001414_1_380", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "teiptintia is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115993", "tested in", "in 2", "2 b", "b cell", "cell assays.", "teiptintia is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115993", "115993 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "teiptintia is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115993 tested", "115993 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "teiptintia is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115993", "epitope id 115993 tested", "id 115993 tested in", "115993 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_381", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115995", "11529896" ] }, { "record_id": "GLY_001414_1_381", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tintiasgep is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115995", "tested in", "in 2", "2 b", "b cell", "cell assays.", "tintiasgep is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115995", "115995 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "tintiasgep is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115995 tested", "115995 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "tintiasgep is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115995", "epitope id 115995 tested", "id 115995 tested in", "115995 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_382", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "115998", "11529896" ] }, { "record_id": "GLY_001414_1_382", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tledspevie is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115998", "tested in", "in 2", "2 b", "b cell", "cell assays.", "tledspevie is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115998", "115998 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "tledspevie is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115998 tested", "115998 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "tledspevie is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115998", "epitope id 115998 tested", "id 115998 tested in", "115998 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_383", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "116000", "11529896" ] }, { "record_id": "GLY_001414_1_383", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tptteavest is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116000", "tested in", "in 2", "2 b", "b cell", "cell assays.", "tptteavest is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116000", "116000 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "tptteavest is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116000 tested", "116000 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "tptteavest is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116000", "epitope id 116000 tested", "id 116000 tested in", "116000 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_384", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "116004", "11529896" ] }, { "record_id": "GLY_001414_1_384", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tstptteave is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116004", "tested in", "in 2", "2 b", "b cell", "cell assays.", "tstptteave is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116004", "116004 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "tstptteave is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116004 tested", "116004 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "tstptteave is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116004", "epitope id 116004 tested", "id 116004 tested in", "116004 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_385", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "116005", "11529896" ] }, { "record_id": "GLY_001414_1_385", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tteavestva is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116005", "tested in", "in 2", "2 b", "b cell", "cell assays.", "tteavestva is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116005", "116005 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "tteavestva is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116005 tested", "116005 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "tteavestva is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116005", "epitope id 116005 tested", "id 116005 tested in", "116005 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_386", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "116008", "11529896" ] }, { "record_id": "GLY_001414_1_386", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ttmarhphph is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116008", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ttmarhphph is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116008", "116008 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ttmarhphph is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116008 tested", "116008 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ttmarhphph is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116008", "epitope id 116008 tested", "id 116008 tested in", "116008 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_387", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "116010", "11529896" ] }, { "record_id": "GLY_001414_1_387", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vatledspev is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116010", "tested in", "in 2", "2 b", "b cell", "cell assays.", "vatledspev is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116010", "116010 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "vatledspev is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116010 tested", "116010 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "vatledspev is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116010", "epitope id 116010 tested", "id 116010 tested in", "116010 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_388", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "116029", "11529896" ] }, { "record_id": "GLY_001414_1_388", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yakpaavrsp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116029", "tested in", "in 2", "2 b", "b cell", "cell assays.", "yakpaavrsp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116029", "116029 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "yakpaavrsp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116029 tested", "116029 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "yakpaavrsp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116029", "epitope id 116029 tested", "id 116029 tested in", "116029 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_389", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "116037", "11529896" ] }, { "record_id": "GLY_001414_1_389", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yipiqyvlsr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116037", "tested in", "in 2", "2 b", "b cell", "cell assays.", "yipiqyvlsr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116037", "116037 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "yipiqyvlsr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116037 tested", "116037 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "yipiqyvlsr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116037", "epitope id 116037 tested", "id 116037 tested in", "116037 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_390", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "116039", "11529896" ] }, { "record_id": "GLY_001414_1_390", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ypsyglnyyq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116039", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ypsyglnyyq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116039", "116039 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ypsyglnyyq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116039 tested", "116039 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ypsyglnyyq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116039", "epitope id 116039 tested", "id 116039 tested in", "116039 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_391", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "116040", "11529896" ] }, { "record_id": "GLY_001414_1_391", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yqqkpvalin is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116040", "tested in", "in 2", "2 b", "b cell", "cell assays.", "yqqkpvalin is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116040", "116040 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "yqqkpvalin is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116040 tested", "116040 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "yqqkpvalin is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116040", "epitope id 116040 tested", "id 116040 tested in", "116040 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_392", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "161638", "22092935" ] }, { "record_id": "GLY_001414_1_392", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hlsfmaippk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 161638", "tested in", "in 1", "1 b", "b cell", "cell assay.", "hlsfmaippk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 161638", "161638 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "hlsfmaippk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 161638 tested", "161638 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "hlsfmaippk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 161638", "epitope id 161638 tested", "id 161638 tested in", "161638 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_393", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "161669", "22092935" ] }, { "record_id": "GLY_001414_1_393", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qdkteiptin is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 161669", "tested in", "in 1", "1 b", "b cell", "cell assay", "assay and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "qdkteiptin is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 161669", "161669 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay", "cell assay and", "assay and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "qdkteiptin is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 161669 tested", "161669 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay", "b cell assay and", "cell assay and 2", "assay and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "qdkteiptin is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 161669", "epitope id 161669 tested", "id 161669 tested in", "161669 tested in 1", "tested in 1 b cell", "in 1 b cell assay", "1 b cell assay and", "b cell assay and 2", "cell assay and 2 mhc", "assay and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_394", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "763580", "37604312" ] }, { "record_id": "GLY_001414_1_394", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "paqilqwqvlsntvp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 763580", "tested in", "in 7", "7 t", "t cell", "cell assays.", "paqilqwqvlsntvp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 763580", "763580 tested", "tested in 7", "in 7 t", "7 t cell", "t cell assays.", "paqilqwqvlsntvp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 763580 tested", "763580 tested in", "tested in 7 t", "in 7 t cell", "7 t cell assays.", "paqilqwqvlsntvp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 763580", "epitope id 763580 tested", "id 763580 tested in", "763580 tested in 7", "tested in 7 t cell", "in 7 t cell assays." ] }, { "record_id": "GLY_001414_1_395", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "2245376", "37604312" ] }, { "record_id": "GLY_001414_1_395", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "flpypyyakpaavrs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2245376", "tested in", "in 3", "3 t", "t cell", "cell assays.", "flpypyyakpaavrs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2245376", "2245376 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "flpypyyakpaavrs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2245376 tested", "2245376 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "flpypyyakpaavrs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2245376", "epitope id 2245376 tested", "id 2245376 tested in", "2245376 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_396", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02668", "p02668 1", "2245825", "37604312" ] }, { "record_id": "GLY_001414_1_396", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hphlsfmaippkknq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2245825", "tested in", "in 3", "3 t", "t cell", "cell assays.", "hphlsfmaippkknq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2245825", "2245825 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "hphlsfmaippkknq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2245825 tested", "2245825 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "hphlsfmaippkknq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2245825", "epitope id 2245825 tested", "id 2245825 tested in", "2245825 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_397", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02672", "p02672 1", "234186", "12648094" ] }, { "record_id": "GLY_001414_1_397", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ppsgdfltegggvr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234186", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ppsgdfltegggvr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234186", "234186 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ppsgdfltegggvr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234186 tested", "234186 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ppsgdfltegggvr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234186", "epitope id 234186 tested", "id 234186 tested in", "234186 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_398", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "111856", "2430996" ] }, { "record_id": "GLY_001414_1_398", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tthygslpqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 111856", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 33", "33 b", "b cell", "cell assays.", "tthygslpqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 111856", "111856 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 33", "and 33 b", "33 b cell", "b cell assays.", "tthygslpqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 111856 tested", "111856 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 33", "assay and 33 b", "and 33 b cell", "33 b cell assays.", "tthygslpqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 111856", "epitope id 111856 tested", "id 111856 tested in", "111856 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 33", "cell assay and 33 b", "assay and 33 b cell", "and 33 b cell assays." ] }, { "record_id": "GLY_001414_1_399", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "111856", "2582288" ] }, { "record_id": "GLY_001414_1_399", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tthygslpqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 111856", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 33", "33 b", "b cell", "cell assays.", "tthygslpqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 111856", "111856 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 33", "and 33 b", "33 b cell", "b cell assays.", "tthygslpqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 111856 tested", "111856 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 33", "assay and 33 b", "and 33 b cell", "33 b cell assays.", "tthygslpqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 111856", "epitope id 111856 tested", "id 111856 tested in", "111856 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 33", "cell assay and 33 b", "assay and 33 b cell", "and 33 b cell assays." ] }, { "record_id": "GLY_001414_1_400", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "113396", "6183342" ] }, { "record_id": "GLY_001414_1_400", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fgsdrgapkrgsgkdghhaartthygslpqkaqghrpqdenpvvhf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 113396", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 5", "5 b", "b cell", "cell assays.", "fgsdrgapkrgsgkdghhaartthygslpqkaqghrpqdenpvvhf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 113396", "113396 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 5", "and 5 b", "5 b cell", "b cell assays.", "fgsdrgapkrgsgkdghhaartthygslpqkaqghrpqdenpvvhf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 113396 tested", "113396 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 5", "assay and 5 b", "and 5 b cell", "5 b cell assays.", "fgsdrgapkrgsgkdghhaartthygslpqkaqghrpqdenpvvhf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 113396", "epitope id 113396 tested", "id 113396 tested in", "113396 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 5", "cell assay and 5 b", "assay and 5 b cell", "and 5 b cell assays." ] }, { "record_id": "GLY_001414_1_401", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "113414", "5033419" ] }, { "record_id": "GLY_001414_1_401", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fswgaegqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 113414", "tested in", "in 4", "4 t", "t cell", "cell assays", "assays and", "and 1", "1 b", "b cell", "cell assay.", "fswgaegqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 113414", "113414 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 b", "1 b cell", "b cell assay.", "fswgaegqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 113414 tested", "113414 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 b", "and 1 b cell", "1 b cell assay.", "fswgaegqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 113414", "epitope id 113414 tested", "id 113414 tested in", "113414 tested in 4", "tested in 4 t cell", "in 4 t cell assays", "4 t cell assays and", "t cell assays and 1", "cell assays and 1 b", "assays and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_402", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "113848", "1281825" ] }, { "record_id": "GLY_001414_1_402", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sgkdghhaa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 113848", "tested in", "in 3", "3 b", "b cell", "cell assays.", "sgkdghhaa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 113848", "113848 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "sgkdghhaa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 113848 tested", "113848 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "sgkdghhaa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 113848", "epitope id 113848 tested", "id 113848 tested in", "113848 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_403", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "114224", "2419434" ] }, { "record_id": "GLY_001414_1_403", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pqdenpvvhf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 114224", "tested in", "in 8", "8 b", "b cell", "cell assays.", "pqdenpvvhf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 114224", "114224 tested", "tested in 8", "in 8 b", "8 b cell", "b cell assays.", "pqdenpvvhf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 114224 tested", "114224 tested in", "tested in 8 b", "in 8 b cell", "8 b cell assays.", "pqdenpvvhf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 114224", "epitope id 114224 tested", "id 114224 tested in", "114224 tested in 8", "tested in 8 b cell", "in 8 b cell assays." ] }, { "record_id": "GLY_001414_1_404", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "114224", "2466871" ] }, { "record_id": "GLY_001414_1_404", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pqdenpvvhf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 114224", "tested in", "in 8", "8 b", "b cell", "cell assays.", "pqdenpvvhf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 114224", "114224 tested", "tested in 8", "in 8 b", "8 b cell", "b cell assays.", "pqdenpvvhf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 114224 tested", "114224 tested in", "tested in 8 b", "in 8 b cell", "8 b cell assays.", "pqdenpvvhf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 114224", "epitope id 114224 tested", "id 114224 tested in", "114224 tested in 8", "tested in 8 b cell", "in 8 b cell assays." ] }, { "record_id": "GLY_001414_1_405", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "114224", "7515900" ] }, { "record_id": "GLY_001414_1_405", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pqdenpvvhf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 114224", "tested in", "in 8", "8 b", "b cell", "cell assays.", "pqdenpvvhf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 114224", "114224 tested", "tested in 8", "in 8 b", "8 b cell", "b cell assays.", "pqdenpvvhf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 114224 tested", "114224 tested in", "tested in 8 b", "in 8 b cell", "8 b cell assays.", "pqdenpvvhf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 114224", "epitope id 114224 tested", "id 114224 tested in", "114224 tested in 8", "tested in 8 b cell", "in 8 b cell assays." ] }, { "record_id": "GLY_001414_1_406", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "114740", "6083471" ] }, { "record_id": "GLY_001414_1_406", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aqghrpqde is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 114740", "tested in", "in 5", "5 b", "b cell", "cell assays.", "aqghrpqde is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 114740", "114740 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "aqghrpqde is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 114740 tested", "114740 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "aqghrpqde is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 114740", "epitope id 114740 tested", "id 114740 tested in", "114740 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_407", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "114740", "6174544" ] }, { "record_id": "GLY_001414_1_407", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aqghrpqde is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 114740", "tested in", "in 5", "5 b", "b cell", "cell assays.", "aqghrpqde is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 114740", "114740 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "aqghrpqde is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 114740 tested", "114740 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "aqghrpqde is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 114740", "epitope id 114740 tested", "id 114740 tested in", "114740 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_408", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "114740", "6209588" ] }, { "record_id": "GLY_001414_1_408", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aqghrpqde is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 114740", "tested in", "in 5", "5 b", "b cell", "cell assays.", "aqghrpqde is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 114740", "114740 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "aqghrpqde is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 114740 tested", "114740 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "aqghrpqde is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 114740", "epitope id 114740 tested", "id 114740 tested in", "114740 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_409", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "115593", "2418380" ] }, { "record_id": "GLY_001414_1_409", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aqghrpqden is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115593", "tested in", "in 4", "4 b", "b cell", "cell assays.", "aqghrpqden is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115593", "115593 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "aqghrpqden is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115593 tested", "115593 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "aqghrpqden is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115593", "epitope id 115593 tested", "id 115593 tested in", "115593 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_410", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "115593", "6209588" ] }, { "record_id": "GLY_001414_1_410", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aqghrpqden is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115593", "tested in", "in 4", "4 b", "b cell", "cell assays.", "aqghrpqden is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115593", "115593 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "aqghrpqden is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115593 tested", "115593 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "aqghrpqden is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115593", "epitope id 115593 tested", "id 115593 tested in", "115593 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_411", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "115610", "2418380" ] }, { "record_id": "GLY_001414_1_411", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gslpqkaqghrpqden is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115610", "tested in", "in 5", "5 b", "b cell", "cell assays.", "gslpqkaqghrpqden is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115610", "115610 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "gslpqkaqghrpqden is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115610 tested", "115610 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "gslpqkaqghrpqden is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115610", "epitope id 115610 tested", "id 115610 tested in", "115610 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_412", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "116169", "2416809" ] }, { "record_id": "GLY_001414_1_412", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tprtpppsqgkg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116169", "tested in", "in 2", "2 b", "b cell", "cell assays.", "tprtpppsqgkg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116169", "116169 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "tprtpppsqgkg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116169 tested", "116169 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "tprtpppsqgkg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116169", "epitope id 116169 tested", "id 116169 tested in", "116169 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_413", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "116468", "6177712" ] }, { "record_id": "GLY_001414_1_413", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rpqdenpvvh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116468", "tested in", "in 2", "2 b", "b cell", "cell assays.", "rpqdenpvvh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116468", "116468 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "rpqdenpvvh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116468 tested", "116468 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "rpqdenpvvh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116468", "epitope id 116468 tested", "id 116468 tested in", "116468 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_414", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "116468", "68996" ] }, { "record_id": "GLY_001414_1_414", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rpqdenpvvh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116468", "tested in", "in 2", "2 b", "b cell", "cell assays.", "rpqdenpvvh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116468", "116468 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "rpqdenpvvh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116468 tested", "116468 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "rpqdenpvvh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116468", "epitope id 116468 tested", "id 116468 tested in", "116468 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_415", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02687", "p02687 1", "136000", "5033419" ] }, { "record_id": "GLY_001414_1_415", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "srfswgaegq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 136000", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 1", "1 b", "b cell", "cell assay.", "srfswgaegq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 136000", "136000 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 b", "1 b cell", "b cell assay.", "srfswgaegq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 136000 tested", "136000 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 b", "and 1 b cell", "1 b cell assay.", "srfswgaegq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 136000", "epitope id 136000 tested", "id 136000 tested in", "136000 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 1", "cell assays and 1 b", "assays and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_416", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02690", "p02690 1", "114114", "1692033" ] }, { "record_id": "GLY_001414_1_416", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eisfklgqef is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 114114", "tested in", "in 14", "14 t", "t cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "eisfklgqef is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 114114", "114114 tested", "tested in 14", "in 14 t", "14 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eisfklgqef is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 114114 tested", "114114 tested in", "tested in 14 t", "in 14 t cell", "14 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "eisfklgqef is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 114114", "epitope id 114114 tested", "id 114114 tested in", "114114 tested in 14", "tested in 14 t cell", "in 14 t cell assays", "14 t cell assays and", "t cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_417", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02690", "p02690 1", "114202", "2463999" ] }, { "record_id": "GLY_001414_1_417", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eisfklgqefee is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 114202", "tested in", "in 5", "5 t", "t cell", "cell assays.", "eisfklgqefee is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 114202", "114202 tested", "tested in 5", "in 5 t", "5 t cell", "t cell assays.", "eisfklgqefee is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 114202 tested", "114202 tested in", "tested in 5 t", "in 5 t cell", "5 t cell assays.", "eisfklgqefee is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 114202", "epitope id 114202 tested", "id 114202 tested in", "114202 tested in 5", "tested in 5 t cell", "in 5 t cell assays." ] }, { "record_id": "GLY_001414_1_418", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02690", "p02690 1", "131102", "12161025" ] }, { "record_id": "GLY_001414_1_418", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "teisfklgqef is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 131102", "tested in", "in 5", "5 t", "t cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "teisfklgqef is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 131102", "131102 tested", "tested in 5", "in 5 t", "5 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "teisfklgqef is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 131102 tested", "131102 tested in", "tested in 5 t", "in 5 t cell", "5 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "teisfklgqef is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 131102", "epitope id 131102 tested", "id 131102 tested in", "131102 tested in 5", "tested in 5 t cell", "in 5 t cell assays", "5 t cell assays and", "t cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_419", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02690", "p02690 1", "131102", "1692033" ] }, { "record_id": "GLY_001414_1_419", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "teisfklgqef is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 131102", "tested in", "in 5", "5 t", "t cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "teisfklgqef is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 131102", "131102 tested", "tested in 5", "in 5 t", "5 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "teisfklgqef is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 131102 tested", "131102 tested in", "tested in 5 t", "in 5 t cell", "5 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "teisfklgqef is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 131102", "epitope id 131102 tested", "id 131102 tested in", "131102 tested in 5", "tested in 5 t cell", "in 5 t cell assays", "5 t cell assays and", "t cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_420", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02690", "p02690 1", "131922", "12161025" ] }, { "record_id": "GLY_001414_1_420", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "isfklgqe is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 131922", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "isfklgqe is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 131922", "131922 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "isfklgqe is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 131922 tested", "131922 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 1", "assay and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "isfklgqe is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 131922", "epitope id 131922 tested", "id 131922 tested in", "131922 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 1", "cell assay and 1 mhc", "assay and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_421", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "122355", "1521467" ] }, { "record_id": "GLY_001414_1_421", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fthqgsdfgpi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122355", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 1", "1 b", "b cell", "cell assay.", "fthqgsdfgpi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122355", "122355 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 b", "1 b cell", "b cell assay.", "fthqgsdfgpi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122355 tested", "122355 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 b", "and 1 b cell", "1 b cell assay.", "fthqgsdfgpi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122355", "epitope id 122355 tested", "id 122355 tested in", "122355 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 1", "cell assays and 1 b", "assays and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_422", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "122642", "1913836" ] }, { "record_id": "GLY_001414_1_422", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vtvqhkklrtplnyi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122642", "tested in", "in 4", "4 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "vtvqhkklrtplnyi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122642", "122642 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "vtvqhkklrtplnyi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122642 tested", "122642 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "vtvqhkklrtplnyi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122642", "epitope id 122642 tested", "id 122642 tested in", "122642 tested in 4", "tested in 4 t cell", "in 4 t cell assays", "4 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_423", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2267335", "2457026" ] }, { "record_id": "GLY_001414_1_423", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "deasttvskte is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2267335", "tested in", "in 4", "4 b", "b cell", "cell assays.", "deasttvskte is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2267335", "2267335 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "deasttvskte is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2267335 tested", "2267335 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "deasttvskte is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2267335", "epitope id 2267335 tested", "id 2267335 tested in", "2267335 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_424", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2267563", "2006550" ] }, { "record_id": "GLY_001414_1_424", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tetsqvapa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2267563", "tested in", "in 14", "14 b", "b cell", "cell assays.", "tetsqvapa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2267563", "2267563 tested", "tested in 14", "in 14 b", "14 b cell", "b cell assays.", "tetsqvapa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2267563 tested", "2267563 tested in", "tested in 14 b", "in 14 b cell", "14 b cell assays.", "tetsqvapa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2267563", "epitope id 2267563 tested", "id 2267563 tested in", "2267563 tested in 14", "tested in 14 b cell", "in 14 b cell assays." ] }, { "record_id": "GLY_001414_1_425", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2267563", "2457026" ] }, { "record_id": "GLY_001414_1_425", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tetsqvapa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2267563", "tested in", "in 14", "14 b", "b cell", "cell assays.", "tetsqvapa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2267563", "2267563 tested", "tested in 14", "in 14 b", "14 b cell", "b cell assays.", "tetsqvapa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2267563 tested", "2267563 tested in", "tested in 14 b", "in 14 b cell", "14 b cell assays.", "tetsqvapa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2267563", "epitope id 2267563 tested", "id 2267563 tested in", "2267563 tested in 14", "tested in 14 b cell", "in 14 b cell assays." ] }, { "record_id": "GLY_001414_1_426", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2267660", "2006550" ] }, { "record_id": "GLY_001414_1_426", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "deasttvskt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2267660", "tested in", "in 13", "13 b", "b cell", "cell assays.", "deasttvskt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2267660", "2267660 tested", "tested in 13", "in 13 b", "13 b cell", "b cell assays.", "deasttvskt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2267660 tested", "2267660 tested in", "tested in 13 b", "in 13 b cell", "13 b cell assays.", "deasttvskt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2267660", "epitope id 2267660 tested", "id 2267660 tested in", "2267660 tested in 13", "tested in 13 b cell", "in 13 b cell assays." ] }, { "record_id": "GLY_001414_1_427", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2267660", "6529569" ] }, { "record_id": "GLY_001414_1_427", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "deasttvskt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2267660", "tested in", "in 13", "13 b", "b cell", "cell assays.", "deasttvskt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2267660", "2267660 tested", "tested in 13", "in 13 b", "13 b cell", "b cell assays.", "deasttvskt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2267660 tested", "2267660 tested in", "tested in 13 b", "in 13 b cell", "13 b cell assays.", "deasttvskt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2267660", "epitope id 2267660 tested", "id 2267660 tested in", "2267660 tested in 13", "tested in 13 b cell", "in 13 b cell assays." ] }, { "record_id": "GLY_001414_1_428", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2267669", "6529569" ] }, { "record_id": "GLY_001414_1_428", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "etsqvapa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2267669", "tested in", "in 7", "7 b", "b cell", "cell assays.", "etsqvapa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2267669", "2267669 tested", "tested in 7", "in 7 b", "7 b cell", "b cell assays.", "etsqvapa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2267669 tested", "2267669 tested in", "tested in 7 b", "in 7 b cell", "7 b cell assays.", "etsqvapa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2267669", "epitope id 2267669 tested", "id 2267669 tested in", "2267669 tested in 7", "tested in 7 b cell", "in 7 b cell assays." ] }, { "record_id": "GLY_001414_1_429", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2267760", "6529569" ] }, { "record_id": "GLY_001414_1_429", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ttvskte is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2267760", "tested in", "in 4", "4 b", "b cell", "cell assays.", "ttvskte is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2267760", "2267760 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "ttvskte is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2267760 tested", "2267760 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "ttvskte is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2267760", "epitope id 2267760 tested", "id 2267760 tested in", "2267760 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_430", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2268469", "2006550" ] }, { "record_id": "GLY_001414_1_430", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "egpnfyvpfs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2268469", "tested in", "in 2", "2 b", "b cell", "cell assays.", "egpnfyvpfs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2268469", "2268469 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "egpnfyvpfs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2268469 tested", "2268469 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "egpnfyvpfs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2268469", "epitope id 2268469 tested", "id 2268469 tested in", "2268469 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_431", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2268484", "2006550" ] }, { "record_id": "GLY_001414_1_431", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fyvpfsnk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2268484", "tested in", "in 1", "1 b", "b cell", "cell assay.", "fyvpfsnk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2268484", "2268484 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "fyvpfsnk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2268484 tested", "2268484 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "fyvpfsnk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2268484", "epitope id 2268484 tested", "id 2268484 tested in", "2268484 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_432", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2268485", "2006550" ] }, { "record_id": "GLY_001414_1_432", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fyvpfsnktg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2268485", "tested in", "in 1", "1 b", "b cell", "cell assay.", "fyvpfsnktg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2268485", "2268485 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "fyvpfsnktg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2268485 tested", "2268485 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "fyvpfsnktg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2268485", "epitope id 2268485 tested", "id 2268485 tested in", "2268485 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_433", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2268486", "2006550" ] }, { "record_id": "GLY_001414_1_433", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fyvpfsnktgvv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2268486", "tested in", "in 1", "1 b", "b cell", "cell assay.", "fyvpfsnktgvv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2268486", "2268486 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "fyvpfsnktgvv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2268486 tested", "2268486 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "fyvpfsnktgvv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2268486", "epitope id 2268486 tested", "id 2268486 tested in", "2268486 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_434", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2268543", "2006550" ] }, { "record_id": "GLY_001414_1_434", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nfyvpfs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2268543", "tested in", "in 4", "4 b", "b cell", "cell assays.", "nfyvpfs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2268543", "2268543 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "nfyvpfs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2268543 tested", "2268543 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "nfyvpfs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2268543", "epitope id 2268543 tested", "id 2268543 tested in", "2268543 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_435", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2268549", "2006550" ] }, { "record_id": "GLY_001414_1_435", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pnfyvpfsnktg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2268549", "tested in", "in 4", "4 b", "b cell", "cell assays.", "pnfyvpfsnktg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2268549", "2268549 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "pnfyvpfsnktg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2268549 tested", "2268549 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "pnfyvpfsnktg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2268549", "epitope id 2268549 tested", "id 2268549 tested in", "2268549 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_436", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2268597", "2006550" ] }, { "record_id": "GLY_001414_1_436", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ttvsktet is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2268597", "tested in", "in 6", "6 b", "b cell", "cell assays.", "ttvsktet is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2268597", "2268597 tested", "tested in 6", "in 6 b", "6 b cell", "b cell assays.", "ttvsktet is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2268597 tested", "2268597 tested in", "tested in 6 b", "in 6 b cell", "6 b cell assays.", "ttvsktet is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2268597", "epitope id 2268597 tested", "id 2268597 tested in", "2268597 tested in 6", "tested in 6 b cell", "in 6 b cell assays." ] }, { "record_id": "GLY_001414_1_437", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02699", "p02699 1", "2268598", "2006550" ] }, { "record_id": "GLY_001414_1_437", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ttvsktetsqv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2268598", "tested in", "in 4", "4 b", "b cell", "cell assays.", "ttvsktetsqv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2268598", "2268598 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "ttvsktetsqv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2268598 tested", "2268598 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "ttvsktetsqv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2268598", "epitope id 2268598 tested", "id 2268598 tested in", "2268598 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_438", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "3985", "11729348" ] }, { "record_id": "GLY_001414_1_438", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aqkkiiaekt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 3985", "tested in", "in 6", "6 b", "b cell", "cell assays.", "aqkkiiaekt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 3985", "3985 tested", "tested in 6", "in 6 b", "6 b cell", "b cell assays.", "aqkkiiaekt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 3985 tested", "3985 tested in", "tested in 6 b", "in 6 b cell", "6 b cell assays.", "aqkkiiaekt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 3985", "epitope id 3985 tested", "id 3985 tested in", "3985 tested in 6", "tested in 6 b cell", "in 6 b cell assays." ] }, { "record_id": "GLY_001414_1_439", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "3985", "12170271" ] }, { "record_id": "GLY_001414_1_439", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aqkkiiaekt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 3985", "tested in", "in 6", "6 b", "b cell", "cell assays.", "aqkkiiaekt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 3985", "3985 tested", "tested in 6", "in 6 b", "6 b cell", "b cell assays.", "aqkkiiaekt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 3985 tested", "3985 tested in", "tested in 6 b", "in 6 b cell", "6 b cell assays.", "aqkkiiaekt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 3985", "epitope id 3985 tested", "id 3985 tested in", "3985 tested in 6", "tested in 6 b cell", "in 6 b cell assays." ] }, { "record_id": "GLY_001414_1_440", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "14638", "11729348" ] }, { "record_id": "GLY_001414_1_440", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "evddealekf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 14638", "tested in", "in 5", "5 b", "b cell", "cell assays.", "evddealekf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 14638", "14638 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "evddealekf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 14638 tested", "14638 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "evddealekf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 14638", "epitope id 14638 tested", "id 14638 tested in", "14638 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_441", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "14638", "12170271" ] }, { "record_id": "GLY_001414_1_441", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "evddealekf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 14638", "tested in", "in 5", "5 b", "b cell", "cell assays.", "evddealekf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 14638", "14638 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "evddealekf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 14638 tested", "14638 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "evddealekf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 14638", "epitope id 14638 tested", "id 14638 tested in", "14638 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_442", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "25535", "10457108" ] }, { "record_id": "GLY_001414_1_442", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "idalnenk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 25535", "tested in", "in 3", "3 b", "b cell", "cell assays", "assays and", "and 4", "4 mhc", "mhc ligand", "ligand assays.", "idalnenk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 25535", "25535 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays", "cell assays and", "assays and 4", "and 4 mhc", "4 mhc ligand", "mhc ligand assays.", "idalnenk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 25535 tested", "25535 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays", "b cell assays and", "cell assays and 4", "assays and 4 mhc", "and 4 mhc ligand", "4 mhc ligand assays.", "idalnenk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 25535", "epitope id 25535 tested", "id 25535 tested in", "25535 tested in 3", "tested in 3 b cell", "in 3 b cell assays", "3 b cell assays and", "b cell assays and 4", "cell assays and 4 mhc", "assays and 4 mhc ligand", "and 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_443", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "29861", "12170271" ] }, { "record_id": "GLY_001414_1_443", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kalkalpmhi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 29861", "tested in", "in 3", "3 b", "b cell", "cell assays.", "kalkalpmhi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 29861", "29861 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "kalkalpmhi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 29861 tested", "29861 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "kalkalpmhi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 29861", "epitope id 29861 tested", "id 29861 tested in", "29861 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_444", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "32907", "11729348" ] }, { "record_id": "GLY_001414_1_444", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kptpegdlei is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 32907", "tested in", "in 5", "5 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "kptpegdlei is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 32907", "32907 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "kptpegdlei is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 32907 tested", "32907 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "kptpegdlei is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 32907", "epitope id 32907 tested", "id 32907 tested in", "32907 tested in 5", "tested in 5 b cell", "in 5 b cell assays", "5 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_445", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "32907", "12170271" ] }, { "record_id": "GLY_001414_1_445", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kptpegdlei is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 32907", "tested in", "in 5", "5 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "kptpegdlei is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 32907", "32907 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "kptpegdlei is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 32907 tested", "32907 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "kptpegdlei is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 32907", "epitope id 32907 tested", "id 32907 tested in", "32907 tested in 5", "tested in 5 b cell", "in 5 b cell assays", "5 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_446", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "33732", "11729348" ] }, { "record_id": "GLY_001414_1_446", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktkipavfki is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 33732", "tested in", "in 6", "6 b", "b cell", "cell assays.", "ktkipavfki is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 33732", "33732 tested", "tested in 6", "in 6 b", "6 b cell", "b cell assays.", "ktkipavfki is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 33732 tested", "33732 tested in", "tested in 6 b", "in 6 b cell", "6 b cell assays.", "ktkipavfki is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 33732", "epitope id 33732 tested", "id 33732 tested in", "33732 tested in 6", "tested in 6 b cell", "in 6 b cell assays." ] }, { "record_id": "GLY_001414_1_447", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "33732", "12170271" ] }, { "record_id": "GLY_001414_1_447", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktkipavfki is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 33732", "tested in", "in 6", "6 b", "b cell", "cell assays.", "ktkipavfki is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 33732", "33732 tested", "tested in 6", "in 6 b", "6 b cell", "b cell assays.", "ktkipavfki is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 33732 tested", "33732 tested in", "tested in 6 b", "in 6 b cell", "6 b cell assays.", "ktkipavfki is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 33732", "epitope id 33732 tested", "id 33732 tested in", "33732 tested in 6", "tested in 6 b cell", "in 6 b cell assays." ] }, { "record_id": "GLY_001414_1_448", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "36760", "10457108" ] }, { "record_id": "GLY_001414_1_448", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "livtqtmk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 36760", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "livtqtmk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 36760", "36760 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "livtqtmk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 36760 tested", "36760 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "livtqtmk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 36760", "epitope id 36760 tested", "id 36760 tested in", "36760 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_449", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "36760", "16220005" ] }, { "record_id": "GLY_001414_1_449", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "livtqtmk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 36760", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "livtqtmk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 36760", "36760 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "livtqtmk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 36760 tested", "36760 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "livtqtmk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 36760", "epitope id 36760 tested", "id 36760 tested in", "36760 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_450", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "39349", "12133623" ] }, { "record_id": "GLY_001414_1_450", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lsfnptqleeqchi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 39349", "tested in", "in 8", "8 b", "b cell", "cell assays.", "lsfnptqleeqchi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 39349", "39349 tested", "tested in 8", "in 8 b", "8 b cell", "b cell assays.", "lsfnptqleeqchi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 39349 tested", "39349 tested in", "tested in 8 b", "in 8 b cell", "8 b cell assays.", "lsfnptqleeqchi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 39349", "epitope id 39349 tested", "id 39349 tested in", "39349 tested in 8", "tested in 8 b cell", "in 8 b cell assays." ] }, { "record_id": "GLY_001414_1_451", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "56145", "1720415" ] }, { "record_id": "GLY_001414_1_451", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rtpevddeale is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 56145", "tested in", "in 1", "1 b", "b cell", "cell assay.", "rtpevddeale is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 56145", "56145 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "rtpevddeale is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 56145 tested", "56145 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "rtpevddeale is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 56145", "epitope id 56145 tested", "id 56145 tested in", "56145 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_452", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "65565", "36307246" ] }, { "record_id": "GLY_001414_1_452", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpevddealek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 65565", "tested in", "in 9", "9 b", "b cell", "cell assays", "assays and", "and 12", "12 mhc", "mhc ligand", "ligand assays.", "tpevddealek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 65565", "65565 tested", "tested in 9", "in 9 b", "9 b cell", "b cell assays", "cell assays and", "assays and 12", "and 12 mhc", "12 mhc ligand", "mhc ligand assays.", "tpevddealek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 65565 tested", "65565 tested in", "tested in 9 b", "in 9 b cell", "9 b cell assays", "b cell assays and", "cell assays and 12", "assays and 12 mhc", "and 12 mhc ligand", "12 mhc ligand assays.", "tpevddealek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 65565", "epitope id 65565 tested", "id 65565 tested in", "65565 tested in 9", "tested in 9 b cell", "in 9 b cell assays", "9 b cell assays and", "b cell assays and 12", "cell assays and 12 mhc", "assays and 12 mhc ligand", "and 12 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_453", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "65565", "10457108" ] }, { "record_id": "GLY_001414_1_453", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpevddealek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 65565", "tested in", "in 9", "9 b", "b cell", "cell assays", "assays and", "and 12", "12 mhc", "mhc ligand", "ligand assays.", "tpevddealek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 65565", "65565 tested", "tested in 9", "in 9 b", "9 b cell", "b cell assays", "cell assays and", "assays and 12", "and 12 mhc", "12 mhc ligand", "mhc ligand assays.", "tpevddealek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 65565 tested", "65565 tested in", "tested in 9 b", "in 9 b cell", "9 b cell assays", "b cell assays and", "cell assays and 12", "assays and 12 mhc", "and 12 mhc ligand", "12 mhc ligand assays.", "tpevddealek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 65565", "epitope id 65565 tested", "id 65565 tested in", "65565 tested in 9", "tested in 9 b cell", "in 9 b cell assays", "9 b cell assays and", "b cell assays and 12", "cell assays and 12 mhc", "assays and 12 mhc ligand", "and 12 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_454", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "65565", "10640911" ] }, { "record_id": "GLY_001414_1_454", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpevddealek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 65565", "tested in", "in 9", "9 b", "b cell", "cell assays", "assays and", "and 12", "12 mhc", "mhc ligand", "ligand assays.", "tpevddealek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 65565", "65565 tested", "tested in 9", "in 9 b", "9 b cell", "b cell assays", "cell assays and", "assays and 12", "and 12 mhc", "12 mhc ligand", "mhc ligand assays.", "tpevddealek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 65565 tested", "65565 tested in", "tested in 9 b", "in 9 b cell", "9 b cell assays", "b cell assays and", "cell assays and 12", "assays and 12 mhc", "and 12 mhc ligand", "12 mhc ligand assays.", "tpevddealek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 65565", "epitope id 65565 tested", "id 65565 tested in", "65565 tested in 9", "tested in 9 b cell", "in 9 b cell assays", "9 b cell assays and", "b cell assays and 12", "cell assays and 12 mhc", "assays and 12 mhc ligand", "and 12 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_455", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "65565", "12133623" ] }, { "record_id": "GLY_001414_1_455", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpevddealek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 65565", "tested in", "in 9", "9 b", "b cell", "cell assays", "assays and", "and 12", "12 mhc", "mhc ligand", "ligand assays.", "tpevddealek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 65565", "65565 tested", "tested in 9", "in 9 b", "9 b cell", "b cell assays", "cell assays and", "assays and 12", "and 12 mhc", "12 mhc ligand", "mhc ligand assays.", "tpevddealek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 65565 tested", "65565 tested in", "tested in 9 b", "in 9 b cell", "9 b cell assays", "b cell assays and", "cell assays and 12", "assays and 12 mhc", "and 12 mhc ligand", "12 mhc ligand assays.", "tpevddealek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 65565", "epitope id 65565 tested", "id 65565 tested in", "65565 tested in 9", "tested in 9 b cell", "in 9 b cell assays", "9 b cell assays and", "b cell assays and 12", "cell assays and 12 mhc", "assays and 12 mhc ligand", "and 12 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_456", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "65565", "2477067" ] }, { "record_id": "GLY_001414_1_456", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpevddealek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 65565", "tested in", "in 9", "9 b", "b cell", "cell assays", "assays and", "and 12", "12 mhc", "mhc ligand", "ligand assays.", "tpevddealek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 65565", "65565 tested", "tested in 9", "in 9 b", "9 b cell", "b cell assays", "cell assays and", "assays and 12", "and 12 mhc", "12 mhc ligand", "mhc ligand assays.", "tpevddealek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 65565 tested", "65565 tested in", "tested in 9 b", "in 9 b cell", "9 b cell assays", "b cell assays and", "cell assays and 12", "assays and 12 mhc", "and 12 mhc ligand", "12 mhc ligand assays.", "tpevddealek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 65565", "epitope id 65565 tested", "id 65565 tested in", "65565 tested in 9", "tested in 9 b cell", "in 9 b cell assays", "9 b cell assays and", "b cell assays and 12", "cell assays and 12 mhc", "assays and 12 mhc ligand", "and 12 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_457", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "65565", "7693669" ] }, { "record_id": "GLY_001414_1_457", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpevddealek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 65565", "tested in", "in 9", "9 b", "b cell", "cell assays", "assays and", "and 12", "12 mhc", "mhc ligand", "ligand assays.", "tpevddealek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 65565", "65565 tested", "tested in 9", "in 9 b", "9 b cell", "b cell assays", "cell assays and", "assays and 12", "and 12 mhc", "12 mhc ligand", "mhc ligand assays.", "tpevddealek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 65565 tested", "65565 tested in", "tested in 9 b", "in 9 b cell", "9 b cell assays", "b cell assays and", "cell assays and 12", "assays and 12 mhc", "and 12 mhc ligand", "12 mhc ligand assays.", "tpevddealek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 65565", "epitope id 65565 tested", "id 65565 tested in", "65565 tested in 9", "tested in 9 b cell", "in 9 b cell assays", "9 b cell assays and", "b cell assays and 12", "cell assays and 12 mhc", "assays and 12 mhc ligand", "and 12 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_458", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "69827", "36307246" ] }, { "record_id": "GLY_001414_1_458", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vlvldtdyk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 69827", "tested in", "in 3", "3 b", "b cell", "cell assays", "assays and", "and 4", "4 mhc", "mhc ligand", "ligand assays.", "vlvldtdyk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 69827", "69827 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays", "cell assays and", "assays and 4", "and 4 mhc", "4 mhc ligand", "mhc ligand assays.", "vlvldtdyk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 69827 tested", "69827 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays", "b cell assays and", "cell assays and 4", "assays and 4 mhc", "and 4 mhc ligand", "4 mhc ligand assays.", "vlvldtdyk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 69827", "epitope id 69827 tested", "id 69827 tested in", "69827 tested in 3", "tested in 3 b cell", "in 3 b cell assays", "3 b cell assays and", "b cell assays and 4", "cell assays and 4 mhc", "assays and 4 mhc ligand", "and 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_459", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "69827", "10457108" ] }, { "record_id": "GLY_001414_1_459", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vlvldtdyk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 69827", "tested in", "in 3", "3 b", "b cell", "cell assays", "assays and", "and 4", "4 mhc", "mhc ligand", "ligand assays.", "vlvldtdyk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 69827", "69827 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays", "cell assays and", "assays and 4", "and 4 mhc", "4 mhc ligand", "mhc ligand assays.", "vlvldtdyk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 69827 tested", "69827 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays", "b cell assays and", "cell assays and 4", "assays and 4 mhc", "and 4 mhc ligand", "4 mhc ligand assays.", "vlvldtdyk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 69827", "epitope id 69827 tested", "id 69827 tested in", "69827 tested in 3", "tested in 3 b cell", "in 3 b cell assays", "3 b cell assays and", "b cell assays and 4", "cell assays and 4 mhc", "assays and 4 mhc ligand", "and 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_460", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "72177", "11729348" ] }, { "record_id": "GLY_001414_1_460", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vyveelkptp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 72177", "tested in", "in 4", "4 b", "b cell", "cell assays.", "vyveelkptp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 72177", "72177 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "vyveelkptp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 72177 tested", "72177 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "vyveelkptp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 72177", "epitope id 72177 tested", "id 72177 tested in", "72177 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_461", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "72178", "12133623" ] }, { "record_id": "GLY_001414_1_461", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vyveelkptpegdleillqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 72178", "tested in", "in 16", "16 b", "b cell", "cell assays", "assays and", "and 9", "9 mhc", "mhc ligand", "ligand assays.", "vyveelkptpegdleillqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 72178", "72178 tested", "tested in 16", "in 16 b", "16 b cell", "b cell assays", "cell assays and", "assays and 9", "and 9 mhc", "9 mhc ligand", "mhc ligand assays.", "vyveelkptpegdleillqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 72178 tested", "72178 tested in", "tested in 16 b", "in 16 b cell", "16 b cell assays", "b cell assays and", "cell assays and 9", "assays and 9 mhc", "and 9 mhc ligand", "9 mhc ligand assays.", "vyveelkptpegdleillqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 72178", "epitope id 72178 tested", "id 72178 tested in", "72178 tested in 16", "tested in 16 b cell", "in 16 b cell assays", "16 b cell assays and", "b cell assays and 9", "cell assays and 9 mhc", "assays and 9 mhc ligand", "and 9 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_462", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "74777", "18331418" ] }, { "record_id": "GLY_001414_1_462", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yllfcmensae is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 74777", "tested in", "in 12", "12 t", "t cell", "cell assays.", "yllfcmensae is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 74777", "74777 tested", "tested in 12", "in 12 t", "12 t cell", "t cell assays.", "yllfcmensae is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 74777 tested", "74777 tested in", "tested in 12 t", "in 12 t cell", "12 t cell assays.", "yllfcmensae is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 74777", "epitope id 74777 tested", "id 74777 tested in", "74777 tested in 12", "tested in 12 t cell", "in 12 t cell assays." ] }, { "record_id": "GLY_001414_1_463", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "89851", "37604312" ] }, { "record_id": "GLY_001414_1_463", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vagtwyslamaasdi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 89851", "tested in", "in 13", "13 t", "t cell", "cell assays", "1 b", "b cell", "cell assay", "assay and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "vagtwyslamaasdi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 89851", "89851 tested", "tested in 13", "in 13 t", "13 t cell", "t cell assays", "assays 1", "1 b cell", "b cell assay", "cell assay and", "assay and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vagtwyslamaasdi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 89851 tested", "89851 tested in", "tested in 13 t", "in 13 t cell", "13 t cell assays", "cell assays 1", "assays 1 b", "1 b cell assay", "b cell assay and", "cell assay and 1", "assay and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "vagtwyslamaasdi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 89851", "epitope id 89851 tested", "id 89851 tested in", "89851 tested in 13", "tested in 13 t cell", "in 13 t cell assays", "t cell assays 1", "cell assays 1 b", "assays 1 b cell", "1 b cell assay and", "b cell assay and 1", "cell assay and 1 mhc", "assay and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_464", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "96002", "36307246" ] }, { "record_id": "GLY_001414_1_464", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wengecaqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96002", "tested in", "in 2", "2 b", "b cell", "cell assays.", "wengecaqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96002", "96002 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "wengecaqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96002 tested", "96002 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "wengecaqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96002", "epitope id 96002 tested", "id 96002 tested in", "96002 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_465", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "96002", "9313138" ] }, { "record_id": "GLY_001414_1_465", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wengecaqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96002", "tested in", "in 2", "2 b", "b cell", "cell assays.", "wengecaqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96002", "96002 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "wengecaqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96002 tested", "96002 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "wengecaqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96002", "epitope id 96002 tested", "id 96002 tested in", "96002 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_466", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "96124", "37604312" ] }, { "record_id": "GLY_001414_1_466", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "avfkidalnenkvlv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96124", "tested in", "in 9", "9 t", "t cell", "cell assays.", "avfkidalnenkvlv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96124", "96124 tested", "tested in 9", "in 9 t", "9 t cell", "t cell assays.", "avfkidalnenkvlv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96124 tested", "96124 tested in", "tested in 9 t", "in 9 t cell", "9 t cell assays.", "avfkidalnenkvlv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96124", "epitope id 96124 tested", "id 96124 tested in", "96124 tested in 9", "tested in 9 t cell", "in 9 t cell assays." ] }, { "record_id": "GLY_001414_1_467", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "96452", "37604312" ] }, { "record_id": "GLY_001414_1_467", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kfdkalkalpmhirl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96452", "tested in", "in 9", "9 t", "t cell", "cell assays.", "kfdkalkalpmhirl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96452", "96452 tested", "tested in 9", "in 9 t", "9 t cell", "t cell assays.", "kfdkalkalpmhirl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96452 tested", "96452 tested in", "tested in 9 t", "in 9 t cell", "9 t cell assays.", "kfdkalkalpmhirl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96452", "epitope id 96452 tested", "id 96452 tested in", "96452 tested in 9", "tested in 9 t cell", "in 9 t cell assays." ] }, { "record_id": "GLY_001414_1_468", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "96462", "37604312" ] }, { "record_id": "GLY_001414_1_468", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kiiaektkipavfki is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96462", "tested in", "in 9", "9 t", "t cell", "cell assays.", "kiiaektkipavfki is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96462", "96462 tested", "tested in 9", "in 9 t", "9 t cell", "t cell assays.", "kiiaektkipavfki is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96462 tested", "96462 tested in", "tested in 9 t", "in 9 t cell", "9 t cell assays.", "kiiaektkipavfki is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96462", "epitope id 96462 tested", "id 96462 tested in", "96462 tested in 9", "tested in 9 t cell", "in 9 t cell assays." ] }, { "record_id": "GLY_001414_1_469", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "96564", "37604312" ] }, { "record_id": "GLY_001414_1_469", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lkalpmhirlsfnpt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96564", "tested in", "in 9", "9 t", "t cell", "cell assays.", "lkalpmhirlsfnpt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96564", "96564 tested", "tested in 9", "in 9 t", "9 t cell", "t cell assays.", "lkalpmhirlsfnpt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96564 tested", "96564 tested in", "tested in 9 t", "in 9 t cell", "9 t cell assays.", "lkalpmhirlsfnpt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96564", "epitope id 96564 tested", "id 96564 tested in", "96564 tested in 9", "tested in 9 t cell", "in 9 t cell assays." ] }, { "record_id": "GLY_001414_1_470", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "96642", "37604312" ] }, { "record_id": "GLY_001414_1_470", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mhirlsfnptqleeq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 96642", "tested in", "in 9", "9 t", "t cell", "cell assays.", "mhirlsfnptqleeq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 96642", "96642 tested", "tested in 9", "in 9 t", "9 t cell", "t cell assays.", "mhirlsfnptqleeq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 96642 tested", "96642 tested in", "tested in 9 t", "in 9 t cell", "9 t cell assays.", "mhirlsfnptqleeq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 96642", "epitope id 96642 tested", "id 96642 tested in", "96642 tested in 9", "tested in 9 t cell", "in 9 t cell assays." ] }, { "record_id": "GLY_001414_1_471", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "97126", "37604312" ] }, { "record_id": "GLY_001414_1_471", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yslamaasdisllda is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 97126", "tested in", "in 9", "9 t", "t cell", "cell assays.", "yslamaasdisllda is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 97126", "97126 tested", "tested in 9", "in 9 t", "9 t cell", "t cell assays.", "yslamaasdisllda is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 97126 tested", "97126 tested in", "tested in 9 t", "in 9 t cell", "9 t cell assays.", "yslamaasdisllda is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 97126", "epitope id 97126 tested", "id 97126 tested in", "97126 tested in 9", "tested in 9 t cell", "in 9 t cell assays." ] }, { "record_id": "GLY_001414_1_472", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98677", "11729348" ] }, { "record_id": "GLY_001414_1_472", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aasdisllda is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98677", "tested in", "in 3", "3 b", "b cell", "cell assays.", "aasdisllda is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98677", "98677 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "aasdisllda is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98677 tested", "98677 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "aasdisllda is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98677", "epitope id 98677 tested", "id 98677 tested in", "98677 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_473", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98681", "11729348" ] }, { "record_id": "GLY_001414_1_473", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aektkipavf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98681", "tested in", "in 4", "4 b", "b cell", "cell assays.", "aektkipavf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98681", "98681 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "aektkipavf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98681 tested", "98681 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "aektkipavf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98681", "epitope id 98681 tested", "id 98681 tested in", "98681 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_474", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98682", "11729348" ] }, { "record_id": "GLY_001414_1_474", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aepeqslacq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98682", "tested in", "in 3", "3 b", "b cell", "cell assays.", "aepeqslacq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98682", "98682 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "aepeqslacq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98682 tested", "98682 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "aepeqslacq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98682", "epitope id 98682 tested", "id 98682 tested in", "98682 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_475", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98691", "11729348" ] }, { "record_id": "GLY_001414_1_475", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "alkalpmhir is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98691", "tested in", "in 4", "4 b", "b cell", "cell assays.", "alkalpmhir is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98691", "98691 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "alkalpmhir is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98691 tested", "98691 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "alkalpmhir is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98691", "epitope id 98691 tested", "id 98691 tested in", "98691 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_476", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98696", "11729348" ] }, { "record_id": "GLY_001414_1_476", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "amaasdisll is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98696", "tested in", "in 3", "3 b", "b cell", "cell assays.", "amaasdisll is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98696", "98696 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "amaasdisll is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98696 tested", "98696 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "amaasdisll is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98696", "epitope id 98696 tested", "id 98696 tested in", "98696 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_477", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98700", "11729348" ] }, { "record_id": "GLY_001414_1_477", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aplrvyveel is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98700", "tested in", "in 4", "4 b", "b cell", "cell assays.", "aplrvyveel is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98700", "98700 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "aplrvyveel is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98700 tested", "98700 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "aplrvyveel is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98700", "epitope id 98700 tested", "id 98700 tested in", "98700 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_478", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98710", "11729348" ] }, { "record_id": "GLY_001414_1_478", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "clvrtpevdd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98710", "tested in", "in 3", "3 b", "b cell", "cell assays.", "clvrtpevdd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98710", "98710 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "clvrtpevdd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98710 tested", "98710 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "clvrtpevdd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98710", "epitope id 98710 tested", "id 98710 tested in", "98710 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_479", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98713", "11729348" ] }, { "record_id": "GLY_001414_1_479", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "cqclvrtpev is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98713", "tested in", "in 3", "3 b", "b cell", "cell assays.", "cqclvrtpev is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98713", "98713 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "cqclvrtpev is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98713 tested", "98713 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "cqclvrtpev is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98713", "epitope id 98713 tested", "id 98713 tested in", "98713 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_480", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98723", "11729348" ] }, { "record_id": "GLY_001414_1_480", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dalnenkvlv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98723", "tested in", "in 4", "4 b", "b cell", "cell assays.", "dalnenkvlv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98723", "98723 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "dalnenkvlv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98723 tested", "98723 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "dalnenkvlv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98723", "epitope id 98723 tested", "id 98723 tested in", "98723 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_481", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98724", "11729348" ] }, { "record_id": "GLY_001414_1_481", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "daqsaplrvy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98724", "tested in", "in 3", "3 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "daqsaplrvy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98724", "98724 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "daqsaplrvy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98724 tested", "98724 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "daqsaplrvy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98724", "epitope id 98724 tested", "id 98724 tested in", "98724 tested in 3", "tested in 3 b cell", "in 3 b cell assays", "3 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_482", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98725", "11729348" ] }, { "record_id": "GLY_001414_1_482", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ddealekfdk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98725", "tested in", "in 4", "4 b", "b cell", "cell assays.", "ddealekfdk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98725", "98725 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "ddealekfdk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98725 tested", "98725 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "ddealekfdk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98725", "epitope id 98725 tested", "id 98725 tested in", "98725 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_483", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98729", "11729348" ] }, { "record_id": "GLY_001414_1_483", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "diqkvagtwy is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98729", "tested in", "in 3", "3 b", "b cell", "cell assays.", "diqkvagtwy is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98729", "98729 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "diqkvagtwy is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98729 tested", "98729 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "diqkvagtwy is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98729", "epitope id 98729 tested", "id 98729 tested in", "98729 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_484", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98733", "11729348" ] }, { "record_id": "GLY_001414_1_484", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dkalkalpmh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98733", "tested in", "in 3", "3 b", "b cell", "cell assays.", "dkalkalpmh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98733", "98733 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "dkalkalpmh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98733 tested", "98733 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "dkalkalpmh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98733", "epitope id 98733 tested", "id 98733 tested in", "98733 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_485", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98734", "11729348" ] }, { "record_id": "GLY_001414_1_485", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dleillqkwe is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98734", "tested in", "in 4", "4 b", "b cell", "cell assays.", "dleillqkwe is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98734", "98734 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "dleillqkwe is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98734 tested", "98734 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "dleillqkwe is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98734", "epitope id 98734 tested", "id 98734 tested in", "98734 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_486", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98740", "11729348" ] }, { "record_id": "GLY_001414_1_486", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ealekfdkal is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98740", "tested in", "in 4", "4 b", "b cell", "cell assays.", "ealekfdkal is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98740", "98740 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "ealekfdkal is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98740 tested", "98740 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "ealekfdkal is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98740", "epitope id 98740 tested", "id 98740 tested in", "98740 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_487", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98752", "11729348" ] }, { "record_id": "GLY_001414_1_487", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "egdleillqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98752", "tested in", "in 4", "4 b", "b cell", "cell assays.", "egdleillqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98752", "98752 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "egdleillqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98752 tested", "98752 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "egdleillqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98752", "epitope id 98752 tested", "id 98752 tested in", "98752 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_488", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98760", "11729348" ] }, { "record_id": "GLY_001414_1_488", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "elkptpegdl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98760", "tested in", "in 3", "3 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "elkptpegdl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98760", "98760 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "elkptpegdl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98760 tested", "98760 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "elkptpegdl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98760", "epitope id 98760 tested", "id 98760 tested in", "98760 tested in 3", "tested in 3 b cell", "in 3 b cell assays", "3 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_489", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98763", "11729348" ] }, { "record_id": "GLY_001414_1_489", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "enkvlvldtd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98763", "tested in", "in 3", "3 b", "b cell", "cell assays.", "enkvlvldtd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98763", "98763 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "enkvlvldtd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98763 tested", "98763 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "enkvlvldtd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98763", "epitope id 98763 tested", "id 98763 tested in", "98763 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_490", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98772", "11729348" ] }, { "record_id": "GLY_001414_1_490", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fcmensaepe is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98772", "tested in", "in 3", "3 b", "b cell", "cell assays.", "fcmensaepe is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98772", "98772 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "fcmensaepe is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98772 tested", "98772 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "fcmensaepe is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98772", "epitope id 98772 tested", "id 98772 tested in", "98772 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_491", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98777", "11729348" ] }, { "record_id": "GLY_001414_1_491", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fnptqleeqc is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98777", "tested in", "in 3", "3 b", "b cell", "cell assays.", "fnptqleeqc is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98777", "98777 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "fnptqleeqc is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98777 tested", "98777 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "fnptqleeqc is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98777", "epitope id 98777 tested", "id 98777 tested in", "98777 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_492", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98803", "11729348" ] }, { "record_id": "GLY_001414_1_492", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gldiqkvagt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98803", "tested in", "in 3", "3 b", "b cell", "cell assays.", "gldiqkvagt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98803", "98803 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "gldiqkvagt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98803 tested", "98803 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "gldiqkvagt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98803", "epitope id 98803 tested", "id 98803 tested in", "98803 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_493", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98824", "11729348" ] }, { "record_id": "GLY_001414_1_493", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "iiaektkipa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98824", "tested in", "in 4", "4 b", "b cell", "cell assays.", "iiaektkipa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98824", "98824 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "iiaektkipa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98824 tested", "98824 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "iiaektkipa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98824", "epitope id 98824 tested", "id 98824 tested in", "98824 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_494", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98834", "11729348" ] }, { "record_id": "GLY_001414_1_494", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "irlsfnptql is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98834", "tested in", "in 4", "4 b", "b cell", "cell assays.", "irlsfnptql is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98834", "98834 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "irlsfnptql is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98834 tested", "98834 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "irlsfnptql is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98834", "epitope id 98834 tested", "id 98834 tested in", "98834 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_495", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98836", "11729348" ] }, { "record_id": "GLY_001414_1_495", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "islldaqsap is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98836", "tested in", "in 3", "3 b", "b cell", "cell assays.", "islldaqsap is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98836", "98836 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "islldaqsap is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98836 tested", "98836 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "islldaqsap is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98836", "epitope id 98836 tested", "id 98836 tested in", "98836 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_496", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98840", "11729348" ] }, { "record_id": "GLY_001414_1_496", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kalpmhirls is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98840", "tested in", "in 4", "4 b", "b cell", "cell assays.", "kalpmhirls is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98840", "98840 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "kalpmhirls is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98840 tested", "98840 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "kalpmhirls is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98840", "epitope id 98840 tested", "id 98840 tested in", "98840 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_497", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98845", "11729348" ] }, { "record_id": "GLY_001414_1_497", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kfdkalkalp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98845", "tested in", "in 4", "4 b", "b cell", "cell assays.", "kfdkalkalp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98845", "98845 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "kfdkalkalp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98845 tested", "98845 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "kfdkalkalp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98845", "epitope id 98845 tested", "id 98845 tested in", "98845 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_498", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98847", "11729348" ] }, { "record_id": "GLY_001414_1_498", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kidalnenkv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98847", "tested in", "in 3", "3 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "kidalnenkv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98847", "98847 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "kidalnenkv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98847 tested", "98847 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "kidalnenkv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98847", "epitope id 98847 tested", "id 98847 tested in", "98847 tested in 3", "tested in 3 b cell", "in 3 b cell assays", "3 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_499", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98849", "11729348" ] }, { "record_id": "GLY_001414_1_499", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kipavfkida is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98849", "tested in", "in 4", "4 b", "b cell", "cell assays.", "kipavfkida is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98849", "98849 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "kipavfkida is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98849 tested", "98849 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "kipavfkida is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98849", "epitope id 98849 tested", "id 98849 tested in", "98849 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_500", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98851", "11729348" ] }, { "record_id": "GLY_001414_1_500", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kkiiaektki is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98851", "tested in", "in 4", "4 b", "b cell", "cell assays.", "kkiiaektki is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98851", "98851 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "kkiiaektki is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98851 tested", "98851 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "kkiiaektki is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98851", "epitope id 98851 tested", "id 98851 tested in", "98851 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_501", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98858", "11729348" ] }, { "record_id": "GLY_001414_1_501", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lacqclvrtp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98858", "tested in", "in 4", "4 b", "b cell", "cell assays.", "lacqclvrtp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98858", "98858 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "lacqclvrtp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98858 tested", "98858 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "lacqclvrtp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98858", "epitope id 98858 tested", "id 98858 tested in", "98858 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_502", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98869", "11729348" ] }, { "record_id": "GLY_001414_1_502", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lekfdkalka is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98869", "tested in", "in 4", "4 b", "b cell", "cell assays.", "lekfdkalka is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98869", "98869 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "lekfdkalka is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98869 tested", "98869 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "lekfdkalka is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98869", "epitope id 98869 tested", "id 98869 tested in", "98869 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_503", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98881", "11729348" ] }, { "record_id": "GLY_001414_1_503", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lldaqsaplr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98881", "tested in", "in 3", "3 b", "b cell", "cell assays.", "lldaqsaplr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98881", "98881 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "lldaqsaplr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98881 tested", "98881 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "lldaqsaplr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98881", "epitope id 98881 tested", "id 98881 tested in", "98881 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_504", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98883", "11729348" ] }, { "record_id": "GLY_001414_1_504", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lnenkvlvld is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98883", "tested in", "in 4", "4 b", "b cell", "cell assays.", "lnenkvlvld is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98883", "98883 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "lnenkvlvld is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98883 tested", "98883 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "lnenkvlvld is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98883", "epitope id 98883 tested", "id 98883 tested in", "98883 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_505", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98885", "11729348" ] }, { "record_id": "GLY_001414_1_505", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lpmhirlsfn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98885", "tested in", "in 4", "4 b", "b cell", "cell assays.", "lpmhirlsfn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98885", "98885 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "lpmhirlsfn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98885 tested", "98885 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "lpmhirlsfn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98885", "epitope id 98885 tested", "id 98885 tested in", "98885 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_506", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98892", "11729348" ] }, { "record_id": "GLY_001414_1_506", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lrvyveelkp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98892", "tested in", "in 3", "3 b", "b cell", "cell assays.", "lrvyveelkp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98892", "98892 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "lrvyveelkp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98892 tested", "98892 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "lrvyveelkp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98892", "epitope id 98892 tested", "id 98892 tested in", "98892 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_507", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98893", "11729348" ] }, { "record_id": "GLY_001414_1_507", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lsfnptqlee is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98893", "tested in", "in 3", "3 b", "b cell", "cell assays.", "lsfnptqlee is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98893", "98893 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "lsfnptqlee is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98893 tested", "98893 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "lsfnptqlee is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98893", "epitope id 98893 tested", "id 98893 tested in", "98893 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_508", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98896", "11729348" ] }, { "record_id": "GLY_001414_1_508", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lvldtdykky is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98896", "tested in", "in 3", "3 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "lvldtdykky is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98896", "98896 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lvldtdykky is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98896 tested", "98896 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "lvldtdykky is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98896", "epitope id 98896 tested", "id 98896 tested in", "98896 tested in 3", "tested in 3 b cell", "in 3 b cell assays", "3 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_509", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98902", "11729348" ] }, { "record_id": "GLY_001414_1_509", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mensaepeqs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98902", "tested in", "in 3", "3 b", "b cell", "cell assays.", "mensaepeqs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98902", "98902 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "mensaepeqs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98902 tested", "98902 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "mensaepeqs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98902", "epitope id 98902 tested", "id 98902 tested in", "98902 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_510", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98903", "11729348" ] }, { "record_id": "GLY_001414_1_510", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mhirlsfnpt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98903", "tested in", "in 4", "4 b", "b cell", "cell assays.", "mhirlsfnpt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98903", "98903 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "mhirlsfnpt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98903 tested", "98903 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "mhirlsfnpt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98903", "epitope id 98903 tested", "id 98903 tested in", "98903 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_511", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98904", "11729348" ] }, { "record_id": "GLY_001414_1_511", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mkgldiqkva is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98904", "tested in", "in 4", "4 b", "b cell", "cell assays.", "mkgldiqkva is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98904", "98904 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "mkgldiqkva is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98904 tested", "98904 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "mkgldiqkva is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98904", "epitope id 98904 tested", "id 98904 tested in", "98904 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_512", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98919", "11729348" ] }, { "record_id": "GLY_001414_1_512", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nsaepeqsla is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98919", "tested in", "in 3", "3 b", "b cell", "cell assays.", "nsaepeqsla is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98919", "98919 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "nsaepeqsla is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98919 tested", "98919 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "nsaepeqsla is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98919", "epitope id 98919 tested", "id 98919 tested in", "98919 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_513", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98923", "11729348" ] }, { "record_id": "GLY_001414_1_513", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pavfkidaln is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98923", "tested in", "in 4", "4 b", "b cell", "cell assays.", "pavfkidaln is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98923", "98923 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "pavfkidaln is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98923 tested", "98923 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "pavfkidaln is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98923", "epitope id 98923 tested", "id 98923 tested in", "98923 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_514", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98928", "11729348" ] }, { "record_id": "GLY_001414_1_514", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "peqslacqcl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98928", "tested in", "in 3", "3 b", "b cell", "cell assays.", "peqslacqcl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98928", "98928 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "peqslacqcl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98928 tested", "98928 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "peqslacqcl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98928", "epitope id 98928 tested", "id 98928 tested in", "98928 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_515", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98972", "11729348" ] }, { "record_id": "GLY_001414_1_515", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qsaplrvyve is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98972", "tested in", "in 4", "4 b", "b cell", "cell assays.", "qsaplrvyve is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98972", "98972 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "qsaplrvyve is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98972 tested", "98972 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "qsaplrvyve is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98972", "epitope id 98972 tested", "id 98972 tested in", "98972 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_516", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98973", "11729348" ] }, { "record_id": "GLY_001414_1_516", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qslacqclvr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98973", "tested in", "in 4", "4 b", "b cell", "cell assays.", "qslacqclvr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98973", "98973 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "qslacqclvr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98973 tested", "98973 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "qslacqclvr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98973", "epitope id 98973 tested", "id 98973 tested in", "98973 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_517", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98974", "11729348" ] }, { "record_id": "GLY_001414_1_517", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qtmkgldiqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98974", "tested in", "in 4", "4 b", "b cell", "cell assays.", "qtmkgldiqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98974", "98974 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "qtmkgldiqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98974 tested", "98974 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "qtmkgldiqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98974", "epitope id 98974 tested", "id 98974 tested in", "98974 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_518", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "98997", "11729348" ] }, { "record_id": "GLY_001414_1_518", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sdislldaqs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 98997", "tested in", "in 3", "3 b", "b cell", "cell assays.", "sdislldaqs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 98997", "98997 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "sdislldaqs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 98997 tested", "98997 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "sdislldaqs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 98997", "epitope id 98997 tested", "id 98997 tested in", "98997 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_519", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "99005", "11729348" ] }, { "record_id": "GLY_001414_1_519", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "slamaasdis is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 99005", "tested in", "in 3", "3 b", "b cell", "cell assays.", "slamaasdis is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 99005", "99005 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "slamaasdis is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 99005 tested", "99005 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "slamaasdis is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 99005", "epitope id 99005 tested", "id 99005 tested in", "99005 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_520", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "99028", "11729348" ] }, { "record_id": "GLY_001414_1_520", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpegdleill is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 99028", "tested in", "in 3", "3 b", "b cell", "cell assays.", "tpegdleill is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 99028", "99028 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "tpegdleill is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 99028 tested", "99028 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "tpegdleill is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 99028", "epitope id 99028 tested", "id 99028 tested in", "99028 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_521", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "99036", "11729348" ] }, { "record_id": "GLY_001414_1_521", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "veelkptpeg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 99036", "tested in", "in 3", "3 b", "b cell", "cell assays.", "veelkptpeg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 99036", "99036 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "veelkptpeg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 99036 tested", "99036 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "veelkptpeg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 99036", "epitope id 99036 tested", "id 99036 tested in", "99036 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_522", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "99037", "11729348" ] }, { "record_id": "GLY_001414_1_522", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vfkidalnen is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 99037", "tested in", "in 3", "3 b", "b cell", "cell assays.", "vfkidalnen is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 99037", "99037 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "vfkidalnen is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 99037 tested", "99037 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "vfkidalnen is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 99037", "epitope id 99037 tested", "id 99037 tested in", "99037 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_523", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "99049", "11729348" ] }, { "record_id": "GLY_001414_1_523", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vrtpevddea is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 99049", "tested in", "in 3", "3 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "vrtpevddea is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 99049", "99049 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "vrtpevddea is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 99049 tested", "99049 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "vrtpevddea is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 99049", "epitope id 99049 tested", "id 99049 tested in", "99049 tested in 3", "tested in 3 b cell", "in 3 b cell assays", "3 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_524", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "99052", "11729348" ] }, { "record_id": "GLY_001414_1_524", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vtqtmkgldi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 99052", "tested in", "in 4", "4 b", "b cell", "cell assays.", "vtqtmkgldi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 99052", "99052 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "vtqtmkgldi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 99052 tested", "99052 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "vtqtmkgldi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 99052", "epitope id 99052 tested", "id 99052 tested in", "99052 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_525", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "99061", "11729348" ] }, { "record_id": "GLY_001414_1_525", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wyslamaasd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 99061", "tested in", "in 3", "3 b", "b cell", "cell assays.", "wyslamaasd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 99061", "99061 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "wyslamaasd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 99061 tested", "99061 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "wyslamaasd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 99061", "epitope id 99061 tested", "id 99061 tested in", "99061 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_526", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115220", "11729348" ] }, { "record_id": "GLY_001414_1_526", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eillqkweng is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115220", "tested in", "in 3", "3 b", "b cell", "cell assays.", "eillqkweng is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115220", "115220 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "eillqkweng is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115220 tested", "115220 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "eillqkweng is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115220", "epitope id 115220 tested", "id 115220 tested in", "115220 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_527", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115275", "11729348" ] }, { "record_id": "GLY_001414_1_527", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gtwyslamaa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115275", "tested in", "in 2", "2 b", "b cell", "cell assays.", "gtwyslamaa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115275", "115275 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "gtwyslamaa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115275 tested", "115275 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "gtwyslamaa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115275", "epitope id 115275 tested", "id 115275 tested in", "115275 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_528", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115335", "11729348" ] }, { "record_id": "GLY_001414_1_528", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kyllfcmens is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115335", "tested in", "in 2", "2 b", "b cell", "cell assays.", "kyllfcmens is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115335", "115335 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "kyllfcmens is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115335 tested", "115335 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "kyllfcmens is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115335", "epitope id 115335 tested", "id 115335 tested in", "115335 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_529", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115342", "11729348" ] }, { "record_id": "GLY_001414_1_529", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ldtdykkyll is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115342", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "ldtdykkyll is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115342", "115342 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ldtdykkyll is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115342 tested", "115342 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "ldtdykkyll is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115342", "epitope id 115342 tested", "id 115342 tested in", "115342 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_530", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115347", "11729348" ] }, { "record_id": "GLY_001414_1_530", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "livtqtmkgl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115347", "tested in", "in 3", "3 b", "b cell", "cell assays.", "livtqtmkgl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115347", "115347 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "livtqtmkgl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115347 tested", "115347 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "livtqtmkgl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115347", "epitope id 115347 tested", "id 115347 tested in", "115347 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_531", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115354", "11729348" ] }, { "record_id": "GLY_001414_1_531", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "llfcmensae is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115354", "tested in", "in 2", "2 b", "b cell", "cell assays.", "llfcmensae is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115354", "115354 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "llfcmensae is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115354 tested", "115354 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "llfcmensae is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115354", "epitope id 115354 tested", "id 115354 tested in", "115354 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_532", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115357", "11729348" ] }, { "record_id": "GLY_001414_1_532", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "llqkwengec is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115357", "tested in", "in 2", "2 b", "b cell", "cell assays.", "llqkwengec is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115357", "115357 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "llqkwengec is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115357 tested", "115357 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "llqkwengec is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115357", "epitope id 115357 tested", "id 115357 tested in", "115357 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_533", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115427", "11729348" ] }, { "record_id": "GLY_001414_1_533", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ptqleeqchi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115427", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ptqleeqchi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115427", "115427 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ptqleeqchi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115427 tested", "115427 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ptqleeqchi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115427", "epitope id 115427 tested", "id 115427 tested in", "115427 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_534", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115442", "11729348" ] }, { "record_id": "GLY_001414_1_534", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qkvagtwysl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115442", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qkvagtwysl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115442", "115442 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qkvagtwysl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115442 tested", "115442 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qkvagtwysl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115442", "epitope id 115442 tested", "id 115442 tested in", "115442 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_535", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115444", "11729348" ] }, { "record_id": "GLY_001414_1_535", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qkwengecaq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115444", "tested in", "in 2", "2 b", "b cell", "cell assays.", "qkwengecaq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115444", "115444 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "qkwengecaq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115444 tested", "115444 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "qkwengecaq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115444", "epitope id 115444 tested", "id 115444 tested in", "115444 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_536", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115519", "11729348" ] }, { "record_id": "GLY_001414_1_536", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpevddeale is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115519", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "tpevddeale is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115519", "115519 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "tpevddeale is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115519 tested", "115519 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "tpevddeale is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115519", "epitope id 115519 tested", "id 115519 tested in", "115519 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_537", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115530", "11729348" ] }, { "record_id": "GLY_001414_1_537", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vagtwyslam is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115530", "tested in", "in 2", "2 b", "b cell", "cell assays.", "vagtwyslam is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115530", "115530 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "vagtwyslam is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115530 tested", "115530 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "vagtwyslam is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115530", "epitope id 115530 tested", "id 115530 tested in", "115530 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_538", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "115566", "11729348" ] }, { "record_id": "GLY_001414_1_538", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ykkyllfcme is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 115566", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ykkyllfcme is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 115566", "115566 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ykkyllfcme is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 115566 tested", "115566 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ykkyllfcme is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 115566", "epitope id 115566 tested", "id 115566 tested in", "115566 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_539", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "146244", "9671121" ] }, { "record_id": "GLY_001414_1_539", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fkidalnenkv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 146244", "tested in", "in 1", "1 b", "b cell", "cell assay", "assay and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "fkidalnenkv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 146244", "146244 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay", "cell assay and", "assay and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "fkidalnenkv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 146244 tested", "146244 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay", "b cell assay and", "cell assay and 2", "assay and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "fkidalnenkv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 146244", "epitope id 146244 tested", "id 146244 tested in", "146244 tested in 1", "tested in 1 b cell", "in 1 b cell assay", "1 b cell assay and", "b cell assay and 2", "cell assay and 2 mhc", "assay and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_540", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "2150136", "36307246" ] }, { "record_id": "GLY_001414_1_540", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "alpmhir is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2150136", "tested in", "in 1", "1 b", "b cell", "cell assay.", "alpmhir is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2150136", "2150136 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "alpmhir is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2150136 tested", "2150136 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "alpmhir is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2150136", "epitope id 2150136 tested", "id 2150136 tested in", "2150136 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_541", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02754", "p02754 1", "2243964", "37604312" ] }, { "record_id": "GLY_001414_1_541", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "alivtqtmkgldiqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2243964", "tested in", "in 6", "6 t", "t cell", "cell assays.", "alivtqtmkgldiqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2243964", "2243964 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays.", "alivtqtmkgldiqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2243964 tested", "2243964 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays.", "alivtqtmkgldiqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2243964", "epitope id 2243964 tested", "id 2243964 tested in", "2243964 tested in 6", "tested in 6 t cell", "in 6 t cell assays." ] }, { "record_id": "GLY_001414_1_542", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "14159", "12054661" ] }, { "record_id": "GLY_001414_1_542", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eshagceks is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 14159", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 1", "1 b", "b cell", "cell assay.", "eshagceks is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 14159", "14159 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 1", "and 1 b", "1 b cell", "b cell assay.", "eshagceks is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 14159 tested", "14159 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 1", "assay and 1 b", "and 1 b cell", "1 b cell assay.", "eshagceks is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 14159", "epitope id 14159 tested", "id 14159 tested in", "14159 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 1", "cell assay and 1 b", "assay and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_543", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "24445", "12054661" ] }, { "record_id": "GLY_001414_1_543", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hpeyavsvll is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 24445", "tested in", "in 4", "4 t", "t cell", "cell assays", "2 b", "b cell", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "hpeyavsvll is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 24445", "24445 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays", "assays 2", "2 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "hpeyavsvll is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 24445 tested", "24445 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays", "cell assays 2", "assays 2 b", "2 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "hpeyavsvll is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 24445", "epitope id 24445 tested", "id 24445 tested in", "24445 tested in 4", "tested in 4 t cell", "in 4 t cell assays", "t cell assays 2", "cell assays 2 b", "assays 2 b cell", "2 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_544", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "39480", "12054661" ] }, { "record_id": "GLY_001414_1_544", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lslilnrlc is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 39480", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 1", "1 b", "b cell", "cell assay.", "lslilnrlc is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 39480", "39480 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 1", "and 1 b", "1 b cell", "b cell assay.", "lslilnrlc is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 39480 tested", "39480 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 1", "assay and 1 b", "and 1 b cell", "1 b cell assay.", "lslilnrlc is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 39480", "epitope id 39480 tested", "id 39480 tested in", "39480 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 1", "cell assay and 1 b", "assay and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_545", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "48026", "12054661" ] }, { "record_id": "GLY_001414_1_545", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pkafdeklft is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 48026", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 1", "1 b", "b cell", "cell assay.", "pkafdeklft is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 48026", "48026 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 1", "and 1 b", "1 b cell", "b cell assay.", "pkafdeklft is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 48026 tested", "48026 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 1", "assay and 1 b", "and 1 b cell", "1 b cell assay.", "pkafdeklft is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 48026", "epitope id 48026 tested", "id 48026 tested in", "48026 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 1", "cell assay and 1 b", "assay and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_546", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "64998", "12054661" ] }, { "record_id": "GLY_001414_1_546", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tlpdtekqi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 64998", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 1", "1 b", "b cell", "cell assay.", "tlpdtekqi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 64998", "64998 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 1", "and 1 b", "1 b cell", "b cell assay.", "tlpdtekqi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 64998 tested", "64998 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 1", "assay and 1 b", "and 1 b cell", "1 b cell assay.", "tlpdtekqi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 64998", "epitope id 64998 tested", "id 64998 tested in", "64998 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 1", "cell assay and 1 b", "assay and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_547", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "69942", "12054661" ] }, { "record_id": "GLY_001414_1_547", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vmenfvaf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 69942", "tested in", "in 4", "4 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "vmenfvaf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 69942", "69942 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "vmenfvaf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 69942 tested", "69942 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "vmenfvaf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 69942", "epitope id 69942 tested", "id 69942 tested in", "69942 tested in 4", "tested in 4 t cell", "in 4 t cell assays", "4 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_548", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "104488", "11034420" ] }, { "record_id": "GLY_001414_1_548", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fkadekkfwgkylye is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 104488", "tested in", "in 14", "14 t", "t cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "fkadekkfwgkylye is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 104488", "104488 tested", "tested in 14", "in 14 t", "14 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "fkadekkfwgkylye is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 104488 tested", "104488 tested in", "tested in 14 t", "in 14 t cell", "14 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "fkadekkfwgkylye is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 104488", "epitope id 104488 tested", "id 104488 tested in", "104488 tested in 14", "tested in 14 t cell", "in 14 t cell assays", "14 t cell assays and", "t cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_549", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "107118", "10586096" ] }, { "record_id": "GLY_001414_1_549", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fkadekkfwgkyl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 107118", "tested in", "in 3", "3 t", "t cell", "cell assays.", "fkadekkfwgkyl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 107118", "107118 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "fkadekkfwgkyl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 107118 tested", "107118 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "fkadekkfwgkyl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 107118", "epitope id 107118 tested", "id 107118 tested in", "107118 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_550", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "107118", "12645954" ] }, { "record_id": "GLY_001414_1_550", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fkadekkfwgkyl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 107118", "tested in", "in 3", "3 t", "t cell", "cell assays.", "fkadekkfwgkyl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 107118", "107118 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "fkadekkfwgkyl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 107118 tested", "107118 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "fkadekkfwgkyl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 107118", "epitope id 107118 tested", "id 107118 tested in", "107118 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_551", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "131399", "10233671" ] }, { "record_id": "GLY_001414_1_551", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dthkseiahrfkdlge is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 131399", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dthkseiahrfkdlge is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 131399", "131399 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dthkseiahrfkdlge is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 131399 tested", "131399 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dthkseiahrfkdlge is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 131399", "epitope id 131399 tested", "id 131399 tested in", "131399 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_552", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "146269", "20934997" ] }, { "record_id": "GLY_001414_1_552", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "geehfkglvl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 146269", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "geehfkglvl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 146269", "146269 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "geehfkglvl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 146269 tested", "146269 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "geehfkglvl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 146269", "epitope id 146269 tested", "id 146269 tested in", "146269 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_553", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "234295", "12648094" ] }, { "record_id": "GLY_001414_1_553", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tptlvevsrslgkvg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234295", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "tptlvevsrslgkvg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234295", "234295 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "tptlvevsrslgkvg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234295 tested", "234295 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "tptlvevsrslgkvg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234295", "epitope id 234295 tested", "id 234295 tested in", "234295 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_554", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "234296", "12648094" ] }, { "record_id": "GLY_001414_1_554", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tptlvevsrslgkvgtr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234296", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "tptlvevsrslgkvgtr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234296", "234296 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "tptlvevsrslgkvgtr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234296 tested", "234296 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "tptlvevsrslgkvgtr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234296", "epitope id 234296 tested", "id 234296 tested in", "234296 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_555", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "234565", "15565337" ] }, { "record_id": "GLY_001414_1_555", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dekkfwgkylyeiar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234565", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dekkfwgkylyeiar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234565", "234565 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dekkfwgkylyeiar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234565 tested", "234565 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dekkfwgkylyeiar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234565", "epitope id 234565 tested", "id 234565 tested in", "234565 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_556", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "235209", "15565337" ] }, { "record_id": "GLY_001414_1_556", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lgeygfqnalivr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 235209", "tested in", "in 22", "22 mhc", "mhc ligand", "ligand assays.", "lgeygfqnalivr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 235209", "235209 tested", "tested in 22", "in 22 mhc", "22 mhc ligand", "mhc ligand assays.", "lgeygfqnalivr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 235209 tested", "235209 tested in", "tested in 22 mhc", "in 22 mhc ligand", "22 mhc ligand assays.", "lgeygfqnalivr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 235209", "epitope id 235209 tested", "id 235209 tested in", "235209 tested in 22", "tested in 22 mhc ligand", "in 22 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_557", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "235209", "30573663" ] }, { "record_id": "GLY_001414_1_557", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lgeygfqnalivr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 235209", "tested in", "in 22", "22 mhc", "mhc ligand", "ligand assays.", "lgeygfqnalivr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 235209", "235209 tested", "tested in 22", "in 22 mhc", "22 mhc ligand", "mhc ligand assays.", "lgeygfqnalivr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 235209 tested", "235209 tested in", "tested in 22 mhc", "in 22 mhc ligand", "22 mhc ligand assays.", "lgeygfqnalivr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 235209", "epitope id 235209 tested", "id 235209 tested in", "235209 tested in 22", "tested in 22 mhc ligand", "in 22 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_558", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "237799", "11801660" ] }, { "record_id": "GLY_001414_1_558", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kpllekshciaevekd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 237799", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "kpllekshciaevekd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 237799", "237799 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "kpllekshciaevekd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 237799 tested", "237799 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "kpllekshciaevekd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 237799", "epitope id 237799 tested", "id 237799 tested in", "237799 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_559", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "300219", "1656276" ] }, { "record_id": "GLY_001414_1_559", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gkylyeiarrhpyf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 300219", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "gkylyeiarrhpyf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 300219", "300219 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gkylyeiarrhpyf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 300219 tested", "300219 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "gkylyeiarrhpyf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 300219", "epitope id 300219 tested", "id 300219 tested in", "300219 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_560", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "489922", "26495903" ] }, { "record_id": "GLY_001414_1_560", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kvpqvstptlvevsr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 489922", "tested in", "in 57", "57 mhc", "mhc ligand", "ligand assays.", "kvpqvstptlvevsr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 489922", "489922 tested", "tested in 57", "in 57 mhc", "57 mhc ligand", "mhc ligand assays.", "kvpqvstptlvevsr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 489922 tested", "489922 tested in", "tested in 57 mhc", "in 57 mhc ligand", "57 mhc ligand assays.", "kvpqvstptlvevsr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 489922", "epitope id 489922 tested", "id 489922 tested in", "489922 tested in 57", "tested in 57 mhc ligand", "in 57 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_561", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "497800", "26495903" ] }, { "record_id": "GLY_001414_1_561", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "daflgsflyeysr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497800", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "daflgsflyeysr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497800", "497800 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "daflgsflyeysr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497800 tested", "497800 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "daflgsflyeysr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497800", "epitope id 497800 tested", "id 497800 tested in", "497800 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_562", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "497806", "26495903" ] }, { "record_id": "GLY_001414_1_562", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "daipenlppltadfaedk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497806", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "daipenlppltadfaedk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497806", "497806 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "daipenlppltadfaedk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497806 tested", "497806 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "daipenlppltadfaedk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497806", "epitope id 497806 tested", "id 497806 tested in", "497806 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_563", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "498625", "26495903" ] }, { "record_id": "GLY_001414_1_563", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eltefaktcvadeshag is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498625", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "eltefaktcvadeshag is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498625", "498625 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eltefaktcvadeshag is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498625 tested", "498625 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "eltefaktcvadeshag is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498625", "epitope id 498625 tested", "id 498625 tested in", "498625 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_564", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "498982", "26495903" ] }, { "record_id": "GLY_001414_1_564", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fsaltpdetyvpk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498982", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "fsaltpdetyvpk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498982", "498982 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "fsaltpdetyvpk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498982 tested", "498982 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "fsaltpdetyvpk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498982", "epitope id 498982 tested", "id 498982 tested in", "498982 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_565", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "498993", "26495903" ] }, { "record_id": "GLY_001414_1_565", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fyapellyyank is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498993", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "fyapellyyank is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498993", "498993 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "fyapellyyank is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498993 tested", "498993 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "fyapellyyank is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498993", "epitope id 498993 tested", "id 498993 tested in", "498993 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_566", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "499619", "26495903" ] }, { "record_id": "GLY_001414_1_566", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hkpkateeqlktvme is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499619", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "hkpkateeqlktvme is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499619", "499619 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "hkpkateeqlktvme is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499619 tested", "499619 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "hkpkateeqlktvme is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499619", "epitope id 499619 tested", "id 499619 tested in", "499619 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_567", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "499632", "26495903" ] }, { "record_id": "GLY_001414_1_567", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hlvdepqnlik is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499632", "tested in", "in 22", "22 mhc", "mhc ligand", "ligand assays.", "hlvdepqnlik is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499632", "499632 tested", "tested in 22", "in 22 mhc", "22 mhc ligand", "mhc ligand assays.", "hlvdepqnlik is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499632 tested", "499632 tested in", "tested in 22 mhc", "in 22 mhc ligand", "22 mhc ligand assays.", "hlvdepqnlik is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499632", "epitope id 499632 tested", "id 499632 tested in", "499632 tested in 22", "tested in 22 mhc ligand", "in 22 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_568", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "499663", "26495903" ] }, { "record_id": "GLY_001414_1_568", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hpeyavsvllr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499663", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "hpeyavsvllr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499663", "499663 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "hpeyavsvllr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499663 tested", "499663 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "hpeyavsvllr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499663", "epitope id 499663 tested", "id 499663 tested in", "499663 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_569", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "499944", "26495903" ] }, { "record_id": "GLY_001414_1_569", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "iqkfgeralkawsvar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499944", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "iqkfgeralkawsvar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499944", "499944 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "iqkfgeralkawsvar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499944 tested", "499944 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "iqkfgeralkawsvar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499944", "epitope id 499944 tested", "id 499944 tested in", "499944 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_570", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "500598", "26495903" ] }, { "record_id": "GLY_001414_1_570", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kvpqvstptlvevsrs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500598", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kvpqvstptlvevsrs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500598", "500598 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kvpqvstptlvevsrs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500598 tested", "500598 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kvpqvstptlvevsrs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500598", "epitope id 500598 tested", "id 500598 tested in", "500598 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_571", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "500599", "26495903" ] }, { "record_id": "GLY_001414_1_571", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kvpqvstptlvevsrslg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500599", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kvpqvstptlvevsrslg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500599", "500599 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kvpqvstptlvevsrslg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500599 tested", "500599 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kvpqvstptlvevsrslg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500599", "epitope id 500599 tested", "id 500599 tested in", "500599 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_572", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "501065", "26495903" ] }, { "record_id": "GLY_001414_1_572", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ltefaktcvadeshag is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501065", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ltefaktcvadeshag is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501065", "501065 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ltefaktcvadeshag is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501065 tested", "501065 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ltefaktcvadeshag is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501065", "epitope id 501065 tested", "id 501065 tested in", "501065 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_573", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "501102", "26495903" ] }, { "record_id": "GLY_001414_1_573", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lvneltefak is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501102", "tested in", "in 19", "19 mhc", "mhc ligand", "ligand assays.", "lvneltefak is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501102", "501102 tested", "tested in 19", "in 19 mhc", "19 mhc ligand", "mhc ligand assays.", "lvneltefak is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501102 tested", "501102 tested in", "tested in 19 mhc", "in 19 mhc ligand", "19 mhc ligand assays.", "lvneltefak is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501102", "epitope id 501102 tested", "id 501102 tested in", "501102 tested in 19", "tested in 19 mhc ligand", "in 19 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_574", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "501714", "26495903" ] }, { "record_id": "GLY_001414_1_574", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qtalvellk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501714", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "qtalvellk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501714", "501714 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "qtalvellk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501714 tested", "501714 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "qtalvellk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501714", "epitope id 501714 tested", "id 501714 tested in", "501714 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_575", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "501826", "26495903" ] }, { "record_id": "GLY_001414_1_575", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rhpeyavsvllr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501826", "tested in", "in 12", "12 mhc", "mhc ligand", "ligand assays.", "rhpeyavsvllr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501826", "501826 tested", "tested in 12", "in 12 mhc", "12 mhc ligand", "mhc ligand assays.", "rhpeyavsvllr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501826 tested", "501826 tested in", "tested in 12 mhc", "in 12 mhc ligand", "12 mhc ligand assays.", "rhpeyavsvllr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501826", "epitope id 501826 tested", "id 501826 tested in", "501826 tested in 12", "tested in 12 mhc ligand", "in 12 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_576", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "501866", "26495903" ] }, { "record_id": "GLY_001414_1_576", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rkvpqvstptlvevsr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501866", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "rkvpqvstptlvevsr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501866", "501866 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "rkvpqvstptlvevsr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501866 tested", "501866 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "rkvpqvstptlvevsr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501866", "epitope id 501866 tested", "id 501866 tested in", "501866 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_577", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "501867", "26495903" ] }, { "record_id": "GLY_001414_1_577", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rkvpqvstptlvevsrs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501867", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rkvpqvstptlvevsrs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501867", "501867 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rkvpqvstptlvevsrs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501867 tested", "501867 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rkvpqvstptlvevsrs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501867", "epitope id 501867 tested", "id 501867 tested in", "501867 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_578", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "501868", "26495903" ] }, { "record_id": "GLY_001414_1_578", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rkvpqvstptlvevsrslg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501868", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rkvpqvstptlvevsrslg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501868", "501868 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rkvpqvstptlvevsrslg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501868 tested", "501868 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rkvpqvstptlvevsrslg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501868", "epitope id 501868 tested", "id 501868 tested in", "501868 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_579", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "503215", "26495903" ] }, { "record_id": "GLY_001414_1_579", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tvmenfvafvdk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503215", "tested in", "in 7", "7 mhc", "mhc ligand", "ligand assays.", "tvmenfvafvdk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503215", "503215 tested", "tested in 7", "in 7 mhc", "7 mhc ligand", "mhc ligand assays.", "tvmenfvafvdk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503215 tested", "503215 tested in", "tested in 7 mhc", "in 7 mhc ligand", "7 mhc ligand assays.", "tvmenfvafvdk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503215", "epitope id 503215 tested", "id 503215 tested in", "503215 tested in 7", "tested in 7 mhc ligand", "in 7 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_580", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "503244", "26495903" ] }, { "record_id": "GLY_001414_1_580", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vadeshagcekslh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503244", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vadeshagcekslh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503244", "503244 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vadeshagcekslh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503244 tested", "503244 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vadeshagcekslh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503244", "epitope id 503244 tested", "id 503244 tested in", "503244 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_581", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "503245", "26495903" ] }, { "record_id": "GLY_001414_1_581", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vadeshagcekslht is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503245", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vadeshagcekslht is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503245", "503245 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vadeshagcekslht is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503245 tested", "503245 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vadeshagcekslht is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503245", "epitope id 503245 tested", "id 503245 tested in", "503245 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_582", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "503246", "26495903" ] }, { "record_id": "GLY_001414_1_582", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vadeshagcekslhtl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503246", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vadeshagcekslhtl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503246", "503246 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vadeshagcekslhtl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503246 tested", "503246 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vadeshagcekslhtl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503246", "epitope id 503246 tested", "id 503246 tested in", "503246 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_583", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "503548", "26495903" ] }, { "record_id": "GLY_001414_1_583", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpqvstptlvevsr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503548", "tested in", "in 32", "32 mhc", "mhc ligand", "ligand assays.", "vpqvstptlvevsr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503548", "503548 tested", "tested in 32", "in 32 mhc", "32 mhc ligand", "mhc ligand assays.", "vpqvstptlvevsr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503548 tested", "503548 tested in", "tested in 32 mhc", "in 32 mhc ligand", "32 mhc ligand assays.", "vpqvstptlvevsr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503548", "epitope id 503548 tested", "id 503548 tested in", "503548 tested in 32", "tested in 32 mhc ligand", "in 32 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_584", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "503549", "26495903" ] }, { "record_id": "GLY_001414_1_584", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpqvstptlvevsrs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503549", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "vpqvstptlvevsrs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503549", "503549 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "vpqvstptlvevsrs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503549 tested", "503549 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "vpqvstptlvevsrs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503549", "epitope id 503549 tested", "id 503549 tested in", "503549 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_585", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "503550", "26495903" ] }, { "record_id": "GLY_001414_1_585", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpqvstptlvevsrsl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503550", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vpqvstptlvevsrsl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503550", "503550 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vpqvstptlvevsrsl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503550 tested", "503550 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vpqvstptlvevsrsl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503550", "epitope id 503550 tested", "id 503550 tested in", "503550 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_586", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "503551", "26495903" ] }, { "record_id": "GLY_001414_1_586", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpqvstptlvevsrslg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503551", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "vpqvstptlvevsrslg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503551", "503551 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "vpqvstptlvevsrslg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503551 tested", "503551 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "vpqvstptlvevsrslg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503551", "epitope id 503551 tested", "id 503551 tested in", "503551 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_587", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "843404", "30573663" ] }, { "record_id": "GLY_001414_1_587", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eklgeygfqnalivr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 843404", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "eklgeygfqnalivr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 843404", "843404 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "eklgeygfqnalivr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 843404 tested", "843404 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "eklgeygfqnalivr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 843404", "epitope id 843404 tested", "id 843404 tested in", "843404 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_588", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "844005", "30573663" ] }, { "record_id": "GLY_001414_1_588", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fwgkylyeiarrhp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 844005", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "fwgkylyeiarrhp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 844005", "844005 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "fwgkylyeiarrhp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 844005 tested", "844005 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "fwgkylyeiarrhp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 844005", "epitope id 844005 tested", "id 844005 tested in", "844005 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_589", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "846031", "30573663" ] }, { "record_id": "GLY_001414_1_589", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "klgeygfqnalivr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 846031", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "klgeygfqnalivr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 846031", "846031 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "klgeygfqnalivr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 846031 tested", "846031 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "klgeygfqnalivr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 846031", "epitope id 846031 tested", "id 846031 tested in", "846031 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_590", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "846704", "30573663" ] }, { "record_id": "GLY_001414_1_590", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lgeygfqnalivryt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 846704", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "lgeygfqnalivryt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 846704", "846704 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "lgeygfqnalivryt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 846704 tested", "846704 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "lgeygfqnalivryt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 846704", "epitope id 846704 tested", "id 846704 tested in", "846704 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_591", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "1608980", "37604312" ] }, { "record_id": "GLY_001414_1_591", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ivrytrkvpqvstpt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1608980", "tested in", "in 3", "3 t", "t cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "ivrytrkvpqvstpt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1608980", "1608980 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ivrytrkvpqvstpt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1608980 tested", "1608980 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "ivrytrkvpqvstpt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1608980", "epitope id 1608980 tested", "id 1608980 tested in", "1608980 tested in 3", "tested in 3 t cell", "in 3 t cell assays", "3 t cell assays and", "t cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_592", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "1609842", "37604312" ] }, { "record_id": "GLY_001414_1_592", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kfwgkylyeiarrhp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1609842", "tested in", "in 5", "5 t", "t cell", "cell assays", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "kfwgkylyeiarrhp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1609842", "1609842 tested", "tested in 5", "in 5 t", "5 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "kfwgkylyeiarrhp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1609842 tested", "1609842 tested in", "tested in 5 t", "in 5 t cell", "5 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "kfwgkylyeiarrhp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1609842", "epitope id 1609842 tested", "id 1609842 tested in", "1609842 tested in 5", "tested in 5 t cell", "in 5 t cell assays", "5 t cell assays and", "t cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_593", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "1872763", "30573663" ] }, { "record_id": "GLY_001414_1_593", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lgeygfqnalivry is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872763", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lgeygfqnalivry is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872763", "1872763 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lgeygfqnalivry is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872763 tested", "1872763 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lgeygfqnalivry is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872763", "epitope id 1872763 tested", "id 1872763 tested in", "1872763 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_594", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "2244197", "37604312" ] }, { "record_id": "GLY_001414_1_594", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ctedylslilnrlcv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2244197", "tested in", "in 3", "3 t", "t cell", "cell assays.", "ctedylslilnrlcv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2244197", "2244197 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "ctedylslilnrlcv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2244197 tested", "2244197 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "ctedylslilnrlcv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2244197", "epitope id 2244197 tested", "id 2244197 tested in", "2244197 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_595", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "2244414", "37604312" ] }, { "record_id": "GLY_001414_1_595", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dtekqikkqtalvel is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2244414", "tested in", "in 3", "3 t", "t cell", "cell assays.", "dtekqikkqtalvel is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2244414", "2244414 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "dtekqikkqtalvel is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2244414 tested", "2244414 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "dtekqikkqtalvel is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2244414", "epitope id 2244414 tested", "id 2244414 tested in", "2244414 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_596", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "2244889", "37604312" ] }, { "record_id": "GLY_001414_1_596", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eralkawsvarlsqk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2244889", "tested in", "in 3", "3 t", "t cell", "cell assays.", "eralkawsvarlsqk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2244889", "2244889 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "eralkawsvarlsqk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2244889 tested", "2244889 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "eralkawsvarlsqk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2244889", "epitope id 2244889 tested", "id 2244889 tested in", "2244889 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_597", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "2245410", "37604312" ] }, { "record_id": "GLY_001414_1_597", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fqnalivrytrkvpq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2245410", "tested in", "in 3", "3 t", "t cell", "cell assays.", "fqnalivrytrkvpq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2245410", "2245410 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "fqnalivrytrkvpq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2245410 tested", "2245410 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "fqnalivrytrkvpq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2245410", "epitope id 2245410 tested", "id 2245410 tested in", "2245410 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_598", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "2246470", "37604312" ] }, { "record_id": "GLY_001414_1_598", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lslilnrlcvlhekt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2246470", "tested in", "in 3", "3 t", "t cell", "cell assays.", "lslilnrlcvlhekt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2246470", "2246470 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "lslilnrlcvlhekt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2246470 tested", "2246470 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "lslilnrlcvlhekt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2246470", "epitope id 2246470 tested", "id 2246470 tested in", "2246470 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_599", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p02769", "p02769 1", "2247128", "37604312" ] }, { "record_id": "GLY_001414_1_599", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qlktvmenfvafvdk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2247128", "tested in", "in 3", "3 t", "t cell", "cell assays.", "qlktvmenfvafvdk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2247128", "2247128 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "qlktvmenfvafvdk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2247128 tested", "2247128 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "qlktvmenfvafvdk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2247128", "epitope id 2247128 tested", "id 2247128 tested in", "2247128 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_600", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "107155", "2450106" ] }, { "record_id": "GLY_001414_1_600", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gkwlghpdk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 107155", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 3", "3 b", "b cell", "cell assays.", "gkwlghpdk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 107155", "107155 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 3", "and 3 b", "3 b cell", "b cell assays.", "gkwlghpdk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 107155 tested", "107155 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 3", "assay and 3 b", "and 3 b cell", "3 b cell assays.", "gkwlghpdk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 107155", "epitope id 107155 tested", "id 107155 tested in", "107155 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 3", "cell assay and 3 b", "assay and 3 b cell", "and 3 b cell assays." ] }, { "record_id": "GLY_001414_1_601", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112245", "7540658" ] }, { "record_id": "GLY_001414_1_601", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ntwttcqsiaapsk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112245", "tested in", "in 35", "35 t", "t cell", "cell assays", "1 b", "b cell", "cell assay", "assay and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "ntwttcqsiaapsk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112245", "112245 tested", "tested in 35", "in 35 t", "35 t cell", "t cell assays", "assays 1", "1 b cell", "b cell assay", "cell assay and", "assay and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ntwttcqsiaapsk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112245 tested", "112245 tested in", "tested in 35 t", "in 35 t cell", "35 t cell assays", "cell assays 1", "assays 1 b", "1 b cell assay", "b cell assay and", "cell assay and 1", "assay and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "ntwttcqsiaapsk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112245", "epitope id 112245 tested", "id 112245 tested in", "112245 tested in 35", "tested in 35 t cell", "in 35 t cell assays", "t cell assays 1", "cell assays 1 b", "assays 1 b cell", "1 b cell assay and", "b cell assay and 1", "cell assay and 1 mhc", "assay and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_602", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112245", "9130268" ] }, { "record_id": "GLY_001414_1_602", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ntwttcqsiaapsk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112245", "tested in", "in 35", "35 t", "t cell", "cell assays", "1 b", "b cell", "cell assay", "assay and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "ntwttcqsiaapsk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112245", "112245 tested", "tested in 35", "in 35 t", "35 t cell", "t cell assays", "assays 1", "1 b cell", "b cell assay", "cell assay and", "assay and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ntwttcqsiaapsk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112245 tested", "112245 tested in", "tested in 35 t", "in 35 t cell", "35 t cell assays", "cell assays 1", "assays 1 b", "1 b cell assay", "b cell assay and", "cell assay and 1", "assay and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "ntwttcqsiaapsk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112245", "epitope id 112245 tested", "id 112245 tested in", "112245 tested in 35", "tested in 35 t cell", "in 35 t cell assays", "t cell assays 1", "cell assays 1 b", "assays 1 b cell", "1 b cell assay and", "b cell assay and 1", "cell assay and 1 mhc", "assay and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_603", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112461", "1692031" ] }, { "record_id": "GLY_001414_1_603", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "avlklmgrgtkf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112461", "tested in", "in 2", "2 b", "b cell", "cell assays.", "avlklmgrgtkf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112461", "112461 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "avlklmgrgtkf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112461 tested", "112461 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "avlklmgrgtkf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112461", "epitope id 112461 tested", "id 112461 tested in", "112461 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_604", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112507", "1692031" ] }, { "record_id": "GLY_001414_1_604", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "favlklmgrgtk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112507", "tested in", "in 2", "2 b", "b cell", "cell assays.", "favlklmgrgtk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112507", "112507 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "favlklmgrgtk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112507 tested", "112507 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "favlklmgrgtk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112507", "epitope id 112507 tested", "id 112507 tested in", "112507 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_605", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112584", "1717653" ] }, { "record_id": "GLY_001414_1_605", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lpwnafpgk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112584", "tested in", "in 12", "12 b", "b cell", "cell assays.", "lpwnafpgk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112584", "112584 tested", "tested in 12", "in 12 b", "12 b cell", "b cell assays.", "lpwnafpgk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112584 tested", "112584 tested in", "tested in 12 b", "in 12 b cell", "12 b cell assays.", "lpwnafpgk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112584", "epitope id 112584 tested", "id 112584 tested in", "112584 tested in 12", "tested in 12 b cell", "in 12 b cell assays." ] }, { "record_id": "GLY_001414_1_606", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112584", "2450106" ] }, { "record_id": "GLY_001414_1_606", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lpwnafpgk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112584", "tested in", "in 12", "12 b", "b cell", "cell assays.", "lpwnafpgk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112584", "112584 tested", "tested in 12", "in 12 b", "12 b cell", "b cell assays.", "lpwnafpgk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112584 tested", "112584 tested in", "tested in 12 b", "in 12 b cell", "12 b cell assays.", "lpwnafpgk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112584", "epitope id 112584 tested", "id 112584 tested in", "112584 tested in 12", "tested in 12 b cell", "in 12 b cell assays." ] }, { "record_id": "GLY_001414_1_607", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112608", "1692031" ] }, { "record_id": "GLY_001414_1_607", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nfavlklmgrgt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112608", "tested in", "in 2", "2 b", "b cell", "cell assays.", "nfavlklmgrgt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112608", "112608 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "nfavlklmgrgt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112608 tested", "112608 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "nfavlklmgrgt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112608", "epitope id 112608 tested", "id 112608 tested in", "112608 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_608", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112662", "2450106" ] }, { "record_id": "GLY_001414_1_608", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sicktaefqmtf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112662", "tested in", "in 5", "5 b", "b cell", "cell assays.", "sicktaefqmtf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112662", "112662 tested", "tested in 5", "in 5 b", "5 b cell", "b cell assays.", "sicktaefqmtf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112662 tested", "112662 tested in", "tested in 5 b", "in 5 b cell", "5 b cell assays.", "sicktaefqmtf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112662", "epitope id 112662 tested", "id 112662 tested in", "112662 tested in 5", "tested in 5 b cell", "in 5 b cell assays." ] }, { "record_id": "GLY_001414_1_609", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112672", "2450106" ] }, { "record_id": "GLY_001414_1_609", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "taefqmtfhlfi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112672", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 5", "5 b", "b cell", "cell assays.", "taefqmtfhlfi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112672", "112672 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 5", "and 5 b", "5 b cell", "b cell assays.", "taefqmtfhlfi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112672 tested", "112672 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 5", "assay and 5 b", "and 5 b cell", "5 b cell assays.", "taefqmtfhlfi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112672", "epitope id 112672 tested", "id 112672 tested in", "112672 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 5", "cell assay and 5 b", "assay and 5 b cell", "and 5 b cell assays." ] }, { "record_id": "GLY_001414_1_610", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "112732", "1692031" ] }, { "record_id": "GLY_001414_1_610", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ynfavlklmgrg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 112732", "tested in", "in 2", "2 b", "b cell", "cell assays.", "ynfavlklmgrg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 112732", "112732 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "ynfavlklmgrg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 112732 tested", "112732 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "ynfavlklmgrg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 112732", "epitope id 112732 tested", "id 112732 tested in", "112732 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_611", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "116971", "2450106" ] }, { "record_id": "GLY_001414_1_611", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "favlklmgrgtkf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116971", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 15", "15 b", "b cell", "cell assays.", "favlklmgrgtkf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116971", "116971 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 15", "and 15 b", "15 b cell", "b cell assays.", "favlklmgrgtkf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116971 tested", "116971 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 15", "assay and 15 b", "and 15 b cell", "15 b cell assays.", "favlklmgrgtkf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116971", "epitope id 116971 tested", "id 116971 tested in", "116971 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 15", "cell assay and 15 b", "assay and 15 b cell", "and 15 b cell assays." ] }, { "record_id": "GLY_001414_1_612", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "117173", "2450106" ] }, { "record_id": "GLY_001414_1_612", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tyfsknyqdyey is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 117173", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 3", "3 b", "b cell", "cell assays.", "tyfsknyqdyey is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 117173", "117173 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 3", "and 3 b", "3 b cell", "b cell assays.", "tyfsknyqdyey is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 117173 tested", "117173 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 3", "assay and 3 b", "and 3 b cell", "3 b cell assays.", "tyfsknyqdyey is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 117173", "epitope id 117173 tested", "id 117173 tested in", "117173 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 3", "cell assay and 3 b", "assay and 3 b cell", "and 3 b cell assays." ] }, { "record_id": "GLY_001414_1_613", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "134021", "2450106" ] }, { "record_id": "GLY_001414_1_613", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "cqsiaapskts is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 134021", "tested in", "in 2", "2 b", "b cell", "cell assays.", "cqsiaapskts is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 134021", "134021 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "cqsiaapskts is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 134021 tested", "134021 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "cqsiaapskts is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 134021", "epitope id 134021 tested", "id 134021 tested in", "134021 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_614", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "134065", "2450106" ] }, { "record_id": "GLY_001414_1_614", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "glleccarc is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 134065", "tested in", "in 2", "2 b", "b cell", "cell assays.", "glleccarc is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 134065", "134065 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "glleccarc is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 134065 tested", "134065 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "glleccarc is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 134065", "epitope id 134065 tested", "id 134065 tested in", "134065 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_615", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "134087", "2450106" ] }, { "record_id": "GLY_001414_1_615", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "igtlcadar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 134087", "tested in", "in 2", "2 b", "b cell", "cell assays.", "igtlcadar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 134087", "134087 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "igtlcadar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 134087 tested", "134087 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "igtlcadar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 134087", "epitope id 134087 tested", "id 134087 tested in", "134087 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_616", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "134221", "2450106" ] }, { "record_id": "GLY_001414_1_616", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqifgdykt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 134221", "tested in", "in 3", "3 b", "b cell", "cell assays.", "rqifgdykt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 134221", "134221 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "rqifgdykt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 134221 tested", "134221 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "rqifgdykt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 134221", "epitope id 134221 tested", "id 134221 tested in", "134221 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_617", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04116", "p04116 1", "134242", "2450106" ] }, { "record_id": "GLY_001414_1_617", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tsasigtlc is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 134242", "tested in", "in 2", "2 b", "b cell", "cell assays.", "tsasigtlc is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 134242", "134242 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "tsasigtlc is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 134242 tested", "134242 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "tsasigtlc is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 134242", "epitope id 134242 tested", "id 134242 tested in", "134242 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_618", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p04972", "p04972 1", "122806", "11754897" ] }, { "record_id": "GLY_001414_1_618", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "itvicpweafnhl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122806", "tested in", "in 2", "2 t", "t cell", "cell assays", "assays and", "and 1", "1 b", "b cell", "cell assay.", "itvicpweafnhl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122806", "122806 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 b", "1 b cell", "b cell assay.", "itvicpweafnhl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122806 tested", "122806 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 b", "and 1 b cell", "1 b cell assay.", "itvicpweafnhl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122806", "epitope id 122806 tested", "id 122806 tested in", "122806 tested in 2", "tested in 2 t cell", "in 2 t cell assays", "2 t cell assays and", "t cell assays and 1", "cell assays and 1 b", "assays and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_619", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p06394", "p06394 1", "498949", "26495903" ] }, { "record_id": "GLY_001414_1_619", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fnekskel is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498949", "tested in", "in 64", "64 mhc", "mhc ligand", "ligand assays.", "fnekskel is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498949", "498949 tested", "tested in 64", "in 64 mhc", "64 mhc ligand", "mhc ligand assays.", "fnekskel is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498949 tested", "498949 tested in", "tested in 64 mhc", "in 64 mhc ligand", "64 mhc ligand assays.", "fnekskel is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498949", "epitope id 498949 tested", "id 498949 tested in", "498949 tested in 64", "tested in 64 mhc ligand", "in 64 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_620", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p06624", "p06624 1", "122906", "2415383" ] }, { "record_id": "GLY_001414_1_620", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "srpsesng is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122906", "tested in", "in 3", "3 b", "b cell", "cell assays.", "srpsesng is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122906", "122906 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "srpsesng is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122906 tested", "122906 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "srpsesng is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122906", "epitope id 122906 tested", "id 122906 tested in", "122906 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_621", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p06624", "p06624 1", "122913", "2415383" ] }, { "record_id": "GLY_001414_1_621", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tgepvelk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122913", "tested in", "in 3", "3 b", "b cell", "cell assays.", "tgepvelk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122913", "122913 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "tgepvelk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122913 tested", "122913 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "tgepvelk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122913", "epitope id 122913 tested", "id 122913 tested in", "122913 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_622", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p07224", "p07224 1", "503336", "26495903" ] }, { "record_id": "GLY_001414_1_622", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "veeleqsisvkiake is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503336", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "veeleqsisvkiake is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503336", "503336 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "veeleqsisvkiake is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503336 tested", "503336 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "veeleqsisvkiake is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503336", "epitope id 503336 tested", "id 503336 tested in", "503336 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_623", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p07224", "p07224 1", "503337", "26495903" ] }, { "record_id": "GLY_001414_1_623", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "veeleqsisvkiakea is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503337", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "veeleqsisvkiakea is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503337", "503337 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "veeleqsisvkiakea is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503337 tested", "503337 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "veeleqsisvkiakea is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503337", "epitope id 503337 tested", "id 503337 tested in", "503337 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_624", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p07224", "p07224 1", "503791", "26495903" ] }, { "record_id": "GLY_001414_1_624", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ydsegvilyaessdh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503791", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ydsegvilyaessdh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503791", "503791 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ydsegvilyaessdh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503791 tested", "503791 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ydsegvilyaessdh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503791", "epitope id 503791 tested", "id 503791 tested in", "503791 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_625", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "114222", "15969447" ] }, { "record_id": "GLY_001414_1_625", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nnrerrgialdg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 114222", "tested in", "in 9", "9 t", "t cell", "cell assays.", "nnrerrgialdg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 114222", "114222 tested", "tested in 9", "in 9 t", "9 t cell", "t cell assays.", "nnrerrgialdg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 114222 tested", "114222 tested in", "tested in 9 t", "in 9 t cell", "9 t cell assays.", "nnrerrgialdg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 114222", "epitope id 114222 tested", "id 114222 tested in", "114222 tested in 9", "tested in 9 t cell", "in 9 t cell assays." ] }, { "record_id": "GLY_001414_1_626", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "117160", "1696531" ] }, { "record_id": "GLY_001414_1_626", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pfrlmhpqped is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 117160", "tested in", "in 3", "3 t", "t cell", "cell assays.", "pfrlmhpqped is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 117160", "117160 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "pfrlmhpqped is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 117160 tested", "117160 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "pfrlmhpqped is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 117160", "epitope id 117160 tested", "id 117160 tested in", "117160 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_627", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "117160", "1701801" ] }, { "record_id": "GLY_001414_1_627", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pfrlmhpqped is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 117160", "tested in", "in 3", "3 t", "t cell", "cell assays.", "pfrlmhpqped is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 117160", "117160 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "pfrlmhpqped is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 117160 tested", "117160 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "pfrlmhpqped is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 117160", "epitope id 117160 tested", "id 117160 tested in", "117160 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_628", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "117162", "1343765" ] }, { "record_id": "GLY_001414_1_628", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pfrlmhpqpedpd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 117162", "tested in", "in 16", "16 t", "t cell", "cell assays.", "pfrlmhpqpedpd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 117162", "117162 tested", "tested in 16", "in 16 t", "16 t cell", "t cell assays.", "pfrlmhpqpedpd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 117162 tested", "117162 tested in", "tested in 16 t", "in 16 t cell", "16 t cell assays.", "pfrlmhpqpedpd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 117162", "epitope id 117162 tested", "id 117162 tested in", "117162 tested in 16", "tested in 16 t cell", "in 16 t cell assays." ] }, { "record_id": "GLY_001414_1_629", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "117162", "1701801" ] }, { "record_id": "GLY_001414_1_629", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pfrlmhpqpedpd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 117162", "tested in", "in 16", "16 t", "t cell", "cell assays.", "pfrlmhpqpedpd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 117162", "117162 tested", "tested in 16", "in 16 t", "16 t cell", "t cell assays.", "pfrlmhpqpedpd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 117162 tested", "117162 tested in", "tested in 16 t", "in 16 t cell", "16 t cell assays.", "pfrlmhpqpedpd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 117162", "epitope id 117162 tested", "id 117162 tested in", "117162 tested in 16", "tested in 16 t cell", "in 16 t cell assays." ] }, { "record_id": "GLY_001414_1_630", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "117162", "2344622" ] }, { "record_id": "GLY_001414_1_630", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pfrlmhpqpedpd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 117162", "tested in", "in 16", "16 t", "t cell", "cell assays.", "pfrlmhpqpedpd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 117162", "117162 tested", "tested in 16", "in 16 t", "16 t cell", "t cell assays.", "pfrlmhpqpedpd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 117162 tested", "117162 tested in", "tested in 16 t", "in 16 t cell", "16 t cell assays.", "pfrlmhpqpedpd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 117162", "epitope id 117162 tested", "id 117162 tested in", "117162 tested in 16", "tested in 16 t cell", "in 16 t cell assays." ] }, { "record_id": "GLY_001414_1_631", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "122269", "1723632" ] }, { "record_id": "GLY_001414_1_631", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "arqnlkdage is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122269", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 4", "4 b", "b cell", "cell assays.", "arqnlkdage is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122269", "122269 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 4", "and 4 b", "4 b cell", "b cell assays.", "arqnlkdage is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122269 tested", "122269 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 4", "assay and 4 b", "and 4 b cell", "4 b cell assays.", "arqnlkdage is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122269", "epitope id 122269 tested", "id 122269 tested in", "122269 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 4", "cell assay and 4 b", "assay and 4 b cell", "and 4 b cell assays." ] }, { "record_id": "GLY_001414_1_632", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "122269", "2468451" ] }, { "record_id": "GLY_001414_1_632", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "arqnlkdage is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122269", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 4", "4 b", "b cell", "cell assays.", "arqnlkdage is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122269", "122269 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 4", "and 4 b", "4 b cell", "b cell assays.", "arqnlkdage is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122269 tested", "122269 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 4", "assay and 4 b", "and 4 b cell", "4 b cell assays.", "arqnlkdage is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122269", "epitope id 122269 tested", "id 122269 tested in", "122269 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 4", "cell assay and 4 b", "assay and 4 b cell", "and 4 b cell assays." ] }, { "record_id": "GLY_001414_1_633", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "122569", "2478582" ] }, { "record_id": "GLY_001414_1_633", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sfqdenfvfeef is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122569", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 6", "6 b", "b cell", "cell assays.", "sfqdenfvfeef is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122569", "122569 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 6", "and 6 b", "6 b cell", "b cell assays.", "sfqdenfvfeef is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122569 tested", "122569 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 6", "assay and 6 b", "and 6 b cell", "6 b cell assays.", "sfqdenfvfeef is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122569", "epitope id 122569 tested", "id 122569 tested in", "122569 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 6", "cell assay and 6 b", "assay and 6 b cell", "and 6 b cell assays." ] }, { "record_id": "GLY_001414_1_634", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "122759", "7693817" ] }, { "record_id": "GLY_001414_1_634", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "evatevpfrlm is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122759", "tested in", "in 2", "2 t", "t cell", "cell assays.", "evatevpfrlm is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122759", "122759 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "evatevpfrlm is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122759 tested", "122759 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "evatevpfrlm is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122759", "epitope id 122759 tested", "id 122759 tested in", "122759 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_635", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "122877", "2444731" ] }, { "record_id": "GLY_001414_1_635", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pvtvavtnst is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122877", "tested in", "in 1", "1 b", "b cell", "cell assay.", "pvtvavtnst is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122877", "122877 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "pvtvavtnst is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122877 tested", "122877 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "pvtvavtnst is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122877", "epitope id 122877 tested", "id 122877 tested in", "122877 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_636", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "122931", "7693817" ] }, { "record_id": "GLY_001414_1_636", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vatevpfrl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122931", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 1", "1 b", "b cell", "cell assay.", "vatevpfrl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122931", "122931 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 1", "and 1 b", "1 b cell", "b cell assay.", "vatevpfrl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122931 tested", "122931 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 1", "assay and 1 b", "and 1 b cell", "1 b cell assay.", "vatevpfrl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122931", "epitope id 122931 tested", "id 122931 tested in", "122931 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 1", "cell assay and 1 b", "assay and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_637", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "123155", "8495487" ] }, { "record_id": "GLY_001414_1_637", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "evatevp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123155", "tested in", "in 1", "1 t", "t cell", "cell assay.", "evatevp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123155", "123155 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay.", "evatevp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123155 tested", "123155 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay.", "evatevp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123155", "epitope id 123155 tested", "id 123155 tested in", "123155 tested in 1", "tested in 1 t cell", "in 1 t cell assay." ] }, { "record_id": "GLY_001414_1_638", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "123288", "8495487" ] }, { "record_id": "GLY_001414_1_638", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hedtnla is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123288", "tested in", "in 1", "1 t", "t cell", "cell assay.", "hedtnla is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123288", "123288 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay.", "hedtnla is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123288 tested", "123288 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay.", "hedtnla is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123288", "epitope id 123288 tested", "id 123288 tested in", "123288 tested in 1", "tested in 1 t cell", "in 1 t cell assay." ] }, { "record_id": "GLY_001414_1_639", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "124008", "1379981" ] }, { "record_id": "GLY_001414_1_639", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dgvvlvd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 124008", "tested in", "in 11", "11 b", "b cell", "cell assays.", "dgvvlvd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 124008", "124008 tested", "tested in 11", "in 11 b", "11 b cell", "b cell assays.", "dgvvlvd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 124008 tested", "124008 tested in", "tested in 11 b", "in 11 b cell", "11 b cell assays.", "dgvvlvd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 124008", "epitope id 124008 tested", "id 124008 tested in", "124008 tested in 11", "tested in 11 b cell", "in 11 b cell assays." ] }, { "record_id": "GLY_001414_1_640", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "124008", "1723632" ] }, { "record_id": "GLY_001414_1_640", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dgvvlvd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 124008", "tested in", "in 11", "11 b", "b cell", "cell assays.", "dgvvlvd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 124008", "124008 tested", "tested in 11", "in 11 b", "11 b cell", "b cell assays.", "dgvvlvd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 124008 tested", "124008 tested in", "tested in 11 b", "in 11 b cell", "11 b cell assays.", "dgvvlvd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 124008", "epitope id 124008 tested", "id 124008 tested in", "124008 tested in 11", "tested in 11 b cell", "in 11 b cell assays." ] }, { "record_id": "GLY_001414_1_641", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "124008", "2478582" ] }, { "record_id": "GLY_001414_1_641", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dgvvlvd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 124008", "tested in", "in 11", "11 b", "b cell", "cell assays.", "dgvvlvd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 124008", "124008 tested", "tested in 11", "in 11 b", "11 b cell", "b cell assays.", "dgvvlvd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 124008 tested", "124008 tested in", "tested in 11 b", "in 11 b cell", "11 b cell assays.", "dgvvlvd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 124008", "epitope id 124008 tested", "id 124008 tested in", "124008 tested in 11", "tested in 11 b cell", "in 11 b cell assays." ] }, { "record_id": "GLY_001414_1_642", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "124017", "1696531" ] }, { "record_id": "GLY_001414_1_642", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dktvmgilvsyq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 124017", "tested in", "in 4", "4 t", "t cell", "cell assays.", "dktvmgilvsyq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 124017", "124017 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays.", "dktvmgilvsyq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 124017 tested", "124017 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays.", "dktvmgilvsyq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 124017", "epitope id 124017 tested", "id 124017 tested in", "124017 tested in 4", "tested in 4 t cell", "in 4 t cell assays." ] }, { "record_id": "GLY_001414_1_643", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "124017", "1712808" ] }, { "record_id": "GLY_001414_1_643", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dktvmgilvsyq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 124017", "tested in", "in 4", "4 t", "t cell", "cell assays.", "dktvmgilvsyq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 124017", "124017 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays.", "dktvmgilvsyq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 124017 tested", "124017 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays.", "dktvmgilvsyq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 124017", "epitope id 124017 tested", "id 124017 tested in", "124017 tested in 4", "tested in 4 t cell", "in 4 t cell assays." ] }, { "record_id": "GLY_001414_1_644", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "124017", "2790968" ] }, { "record_id": "GLY_001414_1_644", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dktvmgilvsyq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 124017", "tested in", "in 4", "4 t", "t cell", "cell assays.", "dktvmgilvsyq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 124017", "124017 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays.", "dktvmgilvsyq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 124017 tested", "124017 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays.", "dktvmgilvsyq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 124017", "epitope id 124017 tested", "id 124017 tested in", "124017 tested in 4", "tested in 4 t cell", "in 4 t cell assays." ] }, { "record_id": "GLY_001414_1_645", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "125189", "2468451" ] }, { "record_id": "GLY_001414_1_645", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pedpdtakesf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 125189", "tested in", "in 4", "4 b", "b cell", "cell assays.", "pedpdtakesf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 125189", "125189 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "pedpdtakesf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 125189 tested", "125189 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "pedpdtakesf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 125189", "epitope id 125189 tested", "id 125189 tested in", "125189 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_646", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "125230", "2468451" ] }, { "record_id": "GLY_001414_1_646", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rerrgial is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 125230", "tested in", "in 3", "3 b", "b cell", "cell assays.", "rerrgial is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 125230", "125230 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "rerrgial is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 125230 tested", "125230 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "rerrgial is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 125230", "epitope id 125230 tested", "id 125230 tested in", "125230 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_647", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "126069", "1723632" ] }, { "record_id": "GLY_001414_1_647", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fvfeefarqnlk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 126069", "tested in", "in 1", "1 b", "b cell", "cell assay.", "fvfeefarqnlk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 126069", "126069 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "fvfeefarqnlk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 126069 tested", "126069 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "fvfeefarqnlk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 126069", "epitope id 126069 tested", "id 126069 tested in", "126069 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_648", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "126761", "1723632" ] }, { "record_id": "GLY_001414_1_648", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nlasstiike is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 126761", "tested in", "in 2", "2 b", "b cell", "cell assays.", "nlasstiike is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 126761", "126761 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "nlasstiike is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 126761 tested", "126761 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "nlasstiike is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 126761", "epitope id 126761 tested", "id 126761 tested in", "126761 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_649", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "126761", "1692780" ] }, { "record_id": "GLY_001414_1_649", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nlasstiike is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 126761", "tested in", "in 2", "2 b", "b cell", "cell assays.", "nlasstiike is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 126761", "126761 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "nlasstiike is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 126761 tested", "126761 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "nlasstiike is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 126761", "epitope id 126761 tested", "id 126761 tested in", "126761 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_650", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "126921", "1723632" ] }, { "record_id": "GLY_001414_1_650", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rerrgiald is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 126921", "tested in", "in 1", "1 b", "b cell", "cell assay.", "rerrgiald is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 126921", "126921 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "rerrgiald is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 126921 tested", "126921 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "rerrgiald is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 126921", "epitope id 126921 tested", "id 126921 tested in", "126921 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_651", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "127196", "1723632" ] }, { "record_id": "GLY_001414_1_651", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tevpfrlm is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 127196", "tested in", "in 1", "1 b", "b cell", "cell assay.", "tevpfrlm is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 127196", "127196 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "tevpfrlm is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 127196 tested", "127196 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "tevpfrlm is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 127196", "epitope id 127196 tested", "id 127196 tested in", "127196 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_652", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "127197", "1723632" ] }, { "record_id": "GLY_001414_1_652", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tevpfrlmhpqpedpdtakesfq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 127197", "tested in", "in 1", "1 b", "b cell", "cell assay.", "tevpfrlmhpqpedpdtakesfq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 127197", "127197 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "tevpfrlmhpqpedpdtakesfq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 127197 tested", "127197 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "tevpfrlmhpqpedpdtakesfq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 127197", "epitope id 127197 tested", "id 127197 tested in", "127197 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_653", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "129208", "1692780" ] }, { "record_id": "GLY_001414_1_653", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lasstiike is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 129208", "tested in", "in 2", "2 b", "b cell", "cell assays.", "lasstiike is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 129208", "129208 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "lasstiike is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 129208 tested", "129208 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "lasstiike is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 129208", "epitope id 129208 tested", "id 129208 tested in", "129208 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_654", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "129661", "1692780" ] }, { "record_id": "GLY_001414_1_654", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pvdgvvlvd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 129661", "tested in", "in 2", "2 b", "b cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "pvdgvvlvd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 129661", "129661 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "pvdgvvlvd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 129661 tested", "129661 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "pvdgvvlvd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 129661", "epitope id 129661 tested", "id 129661 tested in", "129661 tested in 2", "tested in 2 b cell", "in 2 b cell assays", "2 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_655", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "130019", "2478582" ] }, { "record_id": "GLY_001414_1_655", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "stiikegi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 130019", "tested in", "in 6", "6 b", "b cell", "cell assays.", "stiikegi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 130019", "130019 tested", "tested in 6", "in 6 b", "6 b cell", "b cell assays.", "stiikegi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 130019 tested", "130019 tested in", "tested in 6 b", "in 6 b cell", "6 b cell assays.", "stiikegi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 130019", "epitope id 130019 tested", "id 130019 tested in", "130019 tested in 6", "tested in 6 b cell", "in 6 b cell assays." ] }, { "record_id": "GLY_001414_1_656", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08168", "p08168 1", "130063", "2478582" ] }, { "record_id": "GLY_001414_1_656", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tevpfrl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 130063", "tested in", "in 6", "6 b", "b cell", "cell assays.", "tevpfrl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 130063", "130063 tested", "tested in 6", "in 6 b", "6 b cell", "b cell assays.", "tevpfrl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 130063 tested", "130063 tested in", "tested in 6 b", "in 6 b cell", "6 b cell assays.", "tevpfrl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 130063", "epitope id 130063 tested", "id 130063 tested in", "130063 tested in 6", "tested in 6 b cell", "in 6 b cell assays." ] }, { "record_id": "GLY_001414_1_657", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p08239", "p08239 1", "840829", "8654559" ] }, { "record_id": "GLY_001414_1_657", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "erskaieknl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 840829", "tested in", "in 3", "3 b", "b cell", "cell assays.", "erskaieknl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 840829", "840829 tested", "tested in 3", "in 3 b", "3 b cell", "b cell assays.", "erskaieknl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 840829 tested", "840829 tested in", "tested in 3 b", "in 3 b cell", "3 b cell assays.", "erskaieknl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 840829", "epitope id 840829 tested", "id 840829 tested in", "840829 tested in 3", "tested in 3 b cell", "in 3 b cell assays." ] }, { "record_id": "GLY_001414_1_658", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p0cb32", "p0cb32 1", "147341", "30573663" ] }, { "record_id": "GLY_001414_1_658", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpsyvaftdterlig is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 147341", "tested in", "in 7", "7 t", "t cell", "cell assays", "assays and", "and 87", "87 mhc", "mhc ligand", "ligand assays.", "tpsyvaftdterlig is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 147341", "147341 tested", "tested in 7", "in 7 t", "7 t cell", "t cell assays", "cell assays and", "assays and 87", "and 87 mhc", "87 mhc ligand", "mhc ligand assays.", "tpsyvaftdterlig is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 147341 tested", "147341 tested in", "tested in 7 t", "in 7 t cell", "7 t cell assays", "t cell assays and", "cell assays and 87", "assays and 87 mhc", "and 87 mhc ligand", "87 mhc ligand assays.", "tpsyvaftdterlig is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 147341", "epitope id 147341 tested", "id 147341 tested in", "147341 tested in 7", "tested in 7 t cell", "in 7 t cell assays", "7 t cell assays and", "t cell assays and 87", "cell assays and 87 mhc", "assays and 87 mhc ligand", "and 87 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_659", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10123", "p10123 1", "2268045", "1715867" ] }, { "record_id": "GLY_001414_1_659", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qlerlttkdhg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2268045", "tested in", "in 1", "1 b", "b cell", "cell assay.", "qlerlttkdhg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2268045", "2268045 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "qlerlttkdhg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2268045 tested", "2268045 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "qlerlttkdhg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2268045", "epitope id 2268045 tested", "id 2268045 tested in", "2268045 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_660", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10279", "p10279 1", "10868", "17270205" ] }, { "record_id": "GLY_001414_1_660", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dyedryyre is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 10868", "tested in", "in 39", "39 b", "b cell", "cell assays.", "dyedryyre is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 10868", "10868 tested", "tested in 39", "in 39 b", "39 b cell", "b cell assays.", "dyedryyre is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 10868 tested", "10868 tested in", "tested in 39 b", "in 39 b cell", "39 b cell assays.", "dyedryyre is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 10868", "epitope id 10868 tested", "id 10868 tested in", "10868 tested in 39", "tested in 39 b cell", "in 39 b cell assays." ] }, { "record_id": "GLY_001414_1_661", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10279", "p10279 1", "10868", "17896076" ] }, { "record_id": "GLY_001414_1_661", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dyedryyre is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 10868", "tested in", "in 39", "39 b", "b cell", "cell assays.", "dyedryyre is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 10868", "10868 tested", "tested in 39", "in 39 b", "39 b cell", "b cell assays.", "dyedryyre is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 10868 tested", "10868 tested in", "tested in 39 b", "in 39 b cell", "39 b cell assays.", "dyedryyre is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 10868", "epitope id 10868 tested", "id 10868 tested in", "10868 tested in 39", "tested in 39 b cell", "in 39 b cell assays." ] }, { "record_id": "GLY_001414_1_662", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10279", "p10279 1", "10868", "9363892" ] }, { "record_id": "GLY_001414_1_662", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dyedryyre is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 10868", "tested in", "in 39", "39 b", "b cell", "cell assays.", "dyedryyre is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 10868", "10868 tested", "tested in 39", "in 39 b", "39 b cell", "b cell assays.", "dyedryyre is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 10868 tested", "10868 tested in", "tested in 39 b", "in 39 b cell", "39 b cell assays.", "dyedryyre is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 10868", "epitope id 10868 tested", "id 10868 tested in", "10868 tested in 39", "tested in 39 b cell", "in 39 b cell assays." ] }, { "record_id": "GLY_001414_1_663", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10279", "p10279 1", "52825", "14687883" ] }, { "record_id": "GLY_001414_1_663", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qvyyrpvdq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 52825", "tested in", "in 4", "4 b", "b cell", "cell assays.", "qvyyrpvdq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 52825", "52825 tested", "tested in 4", "in 4 b", "4 b cell", "b cell assays.", "qvyyrpvdq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 52825 tested", "52825 tested in", "tested in 4 b", "in 4 b cell", "4 b cell assays.", "qvyyrpvdq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 52825", "epitope id 52825 tested", "id 52825 tested in", "52825 tested in 4", "tested in 4 b cell", "in 4 b cell assays." ] }, { "record_id": "GLY_001414_1_664", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10279", "p10279 1", "64031", "16962610" ] }, { "record_id": "GLY_001414_1_664", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "thgqwnkpsk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 64031", "tested in", "in 14", "14 b", "b cell", "cell assays", "assays and", "and has", "has 3d", "3d structure", "structure s", "thgqwnkpsk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 64031", "64031 tested", "tested in 14", "in 14 b", "14 b cell", "b cell assays", "cell assays and", "assays and has", "and has 3d", "has 3d structure", "3d structure s", "s 2hh0.", "thgqwnkpsk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 64031 tested", "64031 tested in", "tested in 14 b", "in 14 b cell", "14 b cell assays", "b cell assays and", "cell assays and has", "assays and has 3d", "and has 3d structure", "has 3d structure s", "structure s 2hh0.", "thgqwnkpsk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 64031", "epitope id 64031 tested", "id 64031 tested in", "64031 tested in 14", "tested in 14 b cell", "in 14 b cell assays", "14 b cell assays and", "b cell assays and has", "cell assays and has 3d", "assays and has 3d structure", "and has 3d structure s", "3d structure s 2hh0." ] }, { "record_id": "GLY_001414_1_665", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10279", "p10279 1", "175625", "23098297" ] }, { "record_id": "GLY_001414_1_665", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nqvyyrpvdqys is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 175625", "tested in", "in 12", "12 b", "b cell", "cell assays.", "nqvyyrpvdqys is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 175625", "175625 tested", "tested in 12", "in 12 b", "12 b cell", "b cell assays.", "nqvyyrpvdqys is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 175625 tested", "175625 tested in", "tested in 12 b", "in 12 b cell", "12 b cell assays.", "nqvyyrpvdqys is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 175625", "epitope id 175625 tested", "id 175625 tested in", "175625 tested in 12", "tested in 12 b cell", "in 12 b cell assays." ] }, { "record_id": "GLY_001414_1_666", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10522", "p10522 1", "116731", "8808799" ] }, { "record_id": "GLY_001414_1_666", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "glgesrk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 116731", "tested in", "in 8", "8 b", "b cell", "cell assays.", "glgesrk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 116731", "116731 tested", "tested in 8", "in 8 b", "8 b cell", "b cell assays.", "glgesrk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 116731 tested", "116731 tested in", "tested in 8 b", "in 8 b cell", "8 b cell assays.", "glgesrk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 116731", "epitope id 116731 tested", "id 116731 tested in", "116731 tested in 8", "tested in 8 b cell", "in 8 b cell assays." ] }, { "record_id": "GLY_001414_1_667", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10575", "p10575 1", "531374", "30573663" ] }, { "record_id": "GLY_001414_1_667", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dylqqltgartvp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 531374", "tested in", "in 10", "10 mhc", "mhc ligand", "ligand assays.", "dylqqltgartvp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 531374", "531374 tested", "tested in 10", "in 10 mhc", "10 mhc ligand", "mhc ligand assays.", "dylqqltgartvp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 531374 tested", "531374 tested in", "tested in 10 mhc", "in 10 mhc ligand", "10 mhc ligand assays.", "dylqqltgartvp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 531374", "epitope id 531374 tested", "id 531374 tested in", "531374 tested in 10", "tested in 10 mhc ligand", "in 10 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_668", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10575", "p10575 1", "531375", "30573663" ] }, { "record_id": "GLY_001414_1_668", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dylqqltgartvpr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 531375", "tested in", "in 16", "16 mhc", "mhc ligand", "ligand assays.", "dylqqltgartvpr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 531375", "531375 tested", "tested in 16", "in 16 mhc", "16 mhc ligand", "mhc ligand assays.", "dylqqltgartvpr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 531375 tested", "531375 tested in", "tested in 16 mhc", "in 16 mhc ligand", "16 mhc ligand assays.", "dylqqltgartvpr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 531375", "epitope id 531375 tested", "id 531375 tested in", "531375 tested in 16", "tested in 16 mhc ligand", "in 16 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_669", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10575", "p10575 1", "532290", "30573663" ] }, { "record_id": "GLY_001414_1_669", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "iqdylqqltgartvp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 532290", "tested in", "in 16", "16 mhc", "mhc ligand", "ligand assays.", "iqdylqqltgartvp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 532290", "532290 tested", "tested in 16", "in 16 mhc", "16 mhc ligand", "mhc ligand assays.", "iqdylqqltgartvp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 532290 tested", "532290 tested in", "tested in 16 mhc", "in 16 mhc ligand", "16 mhc ligand assays.", "iqdylqqltgartvp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 532290", "epitope id 532290 tested", "id 532290 tested in", "532290 tested in 16", "tested in 16 mhc ligand", "in 16 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_670", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p10575", "p10575 1", "533336", "30573663" ] }, { "record_id": "GLY_001414_1_670", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qdylqqltgartvpr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 533336", "tested in", "in 13", "13 mhc", "mhc ligand", "ligand assays.", "qdylqqltgartvpr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 533336", "533336 tested", "tested in 13", "in 13 mhc", "13 mhc ligand", "mhc ligand assays.", "qdylqqltgartvpr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 533336 tested", "533336 tested in", "tested in 13 mhc", "in 13 mhc ligand", "13 mhc ligand assays.", "qdylqqltgartvpr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 533336", "epitope id 533336 tested", "id 533336 tested in", "533336 tested in 13", "tested in 13 mhc ligand", "in 13 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_671", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p11179", "p11179 1", "136066", "1282029" ] }, { "record_id": "GLY_001414_1_671", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ietdktsvqv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 136066", "tested in", "in 7", "7 b", "b cell", "cell assays.", "ietdktsvqv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 136066", "136066 tested", "tested in 7", "in 7 b", "7 b cell", "b cell assays.", "ietdktsvqv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 136066 tested", "136066 tested in", "tested in 7 b", "in 7 b cell", "7 b cell assays.", "ietdktsvqv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 136066", "epitope id 136066 tested", "id 136066 tested in", "136066 tested in 7", "tested in 7 b cell", "in 7 b cell assays." ] }, { "record_id": "GLY_001414_1_672", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "121318", "7514128" ] }, { "record_id": "GLY_001414_1_672", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gecwlgggvvpda is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 121318", "tested in", "in 13", "13 t", "t cell", "cell assays", "2 b", "b cell", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "gecwlgggvvpda is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 121318", "121318 tested", "tested in 13", "in 13 t", "13 t cell", "t cell assays", "assays 2", "2 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "gecwlgggvvpda is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 121318 tested", "121318 tested in", "tested in 13 t", "in 13 t cell", "13 t cell assays", "cell assays 2", "assays 2 b", "2 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "gecwlgggvvpda is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 121318", "epitope id 121318 tested", "id 121318 tested in", "121318 tested in 13", "tested in 13 t cell", "in 13 t cell assays", "t cell assays 2", "cell assays 2 b", "assays 2 b cell", "2 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_673", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "121318", "8050169" ] }, { "record_id": "GLY_001414_1_673", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gecwlgggvvpda is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 121318", "tested in", "in 13", "13 t", "t cell", "cell assays", "2 b", "b cell", "assays and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "gecwlgggvvpda is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 121318", "121318 tested", "tested in 13", "in 13 t", "13 t cell", "t cell assays", "assays 2", "2 b cell", "b cell assays", "cell assays and", "assays and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "gecwlgggvvpda is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 121318 tested", "121318 tested in", "tested in 13 t", "in 13 t cell", "13 t cell assays", "cell assays 2", "assays 2 b", "2 b cell assays", "b cell assays and", "cell assays and 2", "assays and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "gecwlgggvvpda is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 121318", "epitope id 121318 tested", "id 121318 tested in", "121318 tested in 13", "tested in 13 t cell", "in 13 t cell assays", "t cell assays 2", "cell assays 2 b", "assays 2 b cell", "2 b cell assays and", "b cell assays and 2", "cell assays and 2 mhc", "assays and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_674", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122072", "14568955" ] }, { "record_id": "GLY_001414_1_674", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "adgsswegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122072", "tested in", "in 55", "55 t", "t cell", "cell assays.", "adgsswegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122072", "122072 tested", "tested in 55", "in 55 t", "55 t cell", "t cell assays.", "adgsswegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122072 tested", "122072 tested in", "tested in 55 t", "in 55 t cell", "55 t cell assays.", "adgsswegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122072", "epitope id 122072 tested", "id 122072 tested in", "122072 tested in 55", "tested in 55 t cell", "in 55 t cell assays." ] }, { "record_id": "GLY_001414_1_675", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122072", "14607971" ] }, { "record_id": "GLY_001414_1_675", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "adgsswegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122072", "tested in", "in 55", "55 t", "t cell", "cell assays.", "adgsswegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122072", "122072 tested", "tested in 55", "in 55 t", "55 t cell", "t cell assays.", "adgsswegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122072 tested", "122072 tested in", "tested in 55 t", "in 55 t cell", "55 t cell assays.", "adgsswegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122072", "epitope id 122072 tested", "id 122072 tested in", "122072 tested in 55", "tested in 55 t cell", "in 55 t cell assays." ] }, { "record_id": "GLY_001414_1_676", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122072", "19234216" ] }, { "record_id": "GLY_001414_1_676", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "adgsswegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122072", "tested in", "in 55", "55 t", "t cell", "cell assays.", "adgsswegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122072", "122072 tested", "tested in 55", "in 55 t", "55 t cell", "t cell assays.", "adgsswegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122072 tested", "122072 tested in", "tested in 55 t", "in 55 t cell", "55 t cell assays.", "adgsswegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122072", "epitope id 122072 tested", "id 122072 tested in", "122072 tested in 55", "tested in 55 t cell", "in 55 t cell assays." ] }, { "record_id": "GLY_001414_1_677", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122072", "8242769" ] }, { "record_id": "GLY_001414_1_677", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "adgsswegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122072", "tested in", "in 55", "55 t", "t cell", "cell assays.", "adgsswegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122072", "122072 tested", "tested in 55", "in 55 t", "55 t cell", "t cell assays.", "adgsswegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122072 tested", "122072 tested in", "tested in 55 t", "in 55 t cell", "55 t cell assays.", "adgsswegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122072", "epitope id 122072 tested", "id 122072 tested in", "122072 tested in 55", "tested in 55 t cell", "in 55 t cell assays." ] }, { "record_id": "GLY_001414_1_678", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122251", "2477180" ] }, { "record_id": "GLY_001414_1_678", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aaltraqemlqht is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122251", "tested in", "in 7", "7 t", "t cell", "cell assays", "assays and", "and 1", "1 b", "b cell", "cell assay.", "aaltraqemlqht is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122251", "122251 tested", "tested in 7", "in 7 t", "7 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 b", "1 b cell", "b cell assay.", "aaltraqemlqht is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122251 tested", "122251 tested in", "tested in 7 t", "in 7 t cell", "7 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 b", "and 1 b cell", "1 b cell assay.", "aaltraqemlqht is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122251", "epitope id 122251 tested", "id 122251 tested in", "122251 tested in 7", "tested in 7 t cell", "in 7 t cell assays", "7 t cell assays and", "t cell assays and 1", "cell assays and 1 b", "assays and 1 b cell", "and 1 b cell assay." ] }, { "record_id": "GLY_001414_1_679", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122577", "11359436" ] }, { "record_id": "GLY_001414_1_679", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "shrtataaeela is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122577", "tested in", "in 19", "19 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "shrtataaeela is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122577", "122577 tested", "tested in 19", "in 19 t", "19 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "shrtataaeela is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122577 tested", "122577 tested in", "tested in 19 t", "in 19 t cell", "19 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "shrtataaeela is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122577", "epitope id 122577 tested", "id 122577 tested in", "122577 tested in 19", "tested in 19 t cell", "in 19 t cell assays", "19 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_680", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122577", "9603463" ] }, { "record_id": "GLY_001414_1_680", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "shrtataaeela is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122577", "tested in", "in 19", "19 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "shrtataaeela is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122577", "122577 tested", "tested in 19", "in 19 t", "19 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "shrtataaeela is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122577 tested", "122577 tested in", "tested in 19 t", "in 19 t cell", "19 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "shrtataaeela is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122577", "epitope id 122577 tested", "id 122577 tested in", "122577 tested in 19", "tested in 19 t cell", "in 19 t cell assays", "19 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_681", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122585", "1690082" ] }, { "record_id": "GLY_001414_1_681", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sqtwegsgvlpcv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122585", "tested in", "in 14", "14 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "sqtwegsgvlpcv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122585", "122585 tested", "tested in 14", "in 14 t", "14 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "sqtwegsgvlpcv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122585 tested", "122585 tested in", "tested in 14 t", "in 14 t cell", "14 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "sqtwegsgvlpcv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122585", "epitope id 122585 tested", "id 122585 tested in", "122585 tested in 14", "tested in 14 t cell", "in 14 t cell assays", "14 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_682", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122585", "1694880" ] }, { "record_id": "GLY_001414_1_682", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sqtwegsgvlpcv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122585", "tested in", "in 14", "14 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "sqtwegsgvlpcv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122585", "122585 tested", "tested in 14", "in 14 t", "14 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "sqtwegsgvlpcv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122585 tested", "122585 tested in", "tested in 14 t", "in 14 t cell", "14 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "sqtwegsgvlpcv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122585", "epitope id 122585 tested", "id 122585 tested in", "122585 tested in 14", "tested in 14 t cell", "in 14 t cell assays", "14 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_683", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122585", "8050169" ] }, { "record_id": "GLY_001414_1_683", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sqtwegsgvlpcv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122585", "tested in", "in 14", "14 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "sqtwegsgvlpcv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122585", "122585 tested", "tested in 14", "in 14 t", "14 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "sqtwegsgvlpcv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122585 tested", "122585 tested in", "tested in 14 t", "in 14 t cell", "14 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "sqtwegsgvlpcv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122585", "epitope id 122585 tested", "id 122585 tested in", "122585 tested in 14", "tested in 14 t cell", "in 14 t cell assays", "14 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_684", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122784", "1371240" ] }, { "record_id": "GLY_001414_1_684", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122784", "tested in", "in 4", "4 t", "t cell", "cell assays.", "gvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122784", "122784 tested", "tested in 4", "in 4 t", "4 t cell", "t cell assays.", "gvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122784 tested", "122784 tested in", "tested in 4 t", "in 4 t cell", "4 t cell assays.", "gvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122784", "epitope id 122784 tested", "id 122784 tested in", "122784 tested in 4", "tested in 4 t cell", "in 4 t cell assays." ] }, { "record_id": "GLY_001414_1_685", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122909", "7516403" ] }, { "record_id": "GLY_001414_1_685", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "swegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122909", "tested in", "in 21", "21 t", "t cell", "cell assays", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "swegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122909", "122909 tested", "tested in 21", "in 21 t", "21 t cell", "t cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "swegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122909 tested", "122909 tested in", "tested in 21 t", "in 21 t cell", "21 t cell assays", "t cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "swegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122909", "epitope id 122909 tested", "id 122909 tested in", "122909 tested in 21", "tested in 21 t cell", "in 21 t cell assays", "21 t cell assays and", "t cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_686", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122909", "14568955" ] }, { "record_id": "GLY_001414_1_686", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "swegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122909", "tested in", "in 21", "21 t", "t cell", "cell assays", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "swegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122909", "122909 tested", "tested in 21", "in 21 t", "21 t cell", "t cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "swegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122909 tested", "122909 tested in", "tested in 21 t", "in 21 t cell", "21 t cell assays", "t cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "swegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122909", "epitope id 122909 tested", "id 122909 tested in", "122909 tested in 21", "tested in 21 t cell", "in 21 t cell assays", "21 t cell assays and", "t cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_687", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122909", "1707928" ] }, { "record_id": "GLY_001414_1_687", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "swegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122909", "tested in", "in 21", "21 t", "t cell", "cell assays", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "swegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122909", "122909 tested", "tested in 21", "in 21 t", "21 t cell", "t cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "swegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122909 tested", "122909 tested in", "tested in 21 t", "in 21 t cell", "21 t cell assays", "t cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "swegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122909", "epitope id 122909 tested", "id 122909 tested in", "122909 tested in 21", "tested in 21 t cell", "in 21 t cell assays", "21 t cell assays and", "t cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_688", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122909", "2471769" ] }, { "record_id": "GLY_001414_1_688", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "swegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122909", "tested in", "in 21", "21 t", "t cell", "cell assays", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "swegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122909", "122909 tested", "tested in 21", "in 21 t", "21 t cell", "t cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "swegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122909 tested", "122909 tested in", "tested in 21 t", "in 21 t cell", "21 t cell assays", "t cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "swegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122909", "epitope id 122909 tested", "id 122909 tested in", "122909 tested in 21", "tested in 21 t cell", "in 21 t cell assays", "21 t cell assays and", "t cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_689", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122909", "9126974" ] }, { "record_id": "GLY_001414_1_689", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "swegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122909", "tested in", "in 21", "21 t", "t cell", "cell assays", "assays and", "and 3", "3 mhc", "mhc ligand", "ligand assays.", "swegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122909", "122909 tested", "tested in 21", "in 21 t", "21 t cell", "t cell assays", "cell assays and", "assays and 3", "and 3 mhc", "3 mhc ligand", "mhc ligand assays.", "swegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122909 tested", "122909 tested in", "tested in 21 t", "in 21 t cell", "21 t cell assays", "t cell assays and", "cell assays and 3", "assays and 3 mhc", "and 3 mhc ligand", "3 mhc ligand assays.", "swegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122909", "epitope id 122909 tested", "id 122909 tested in", "122909 tested in 21", "tested in 21 t cell", "in 21 t cell assays", "21 t cell assays and", "t cell assays and 3", "cell assays and 3 mhc", "assays and 3 mhc ligand", "and 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_690", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122944", "8050169" ] }, { "record_id": "GLY_001414_1_690", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122944", "tested in", "in 6", "6 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "wegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122944", "122944 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "wegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122944 tested", "122944 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "wegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122944", "epitope id 122944 tested", "id 122944 tested in", "122944 tested in 6", "tested in 6 t cell", "in 6 t cell assays", "6 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_691", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "122944", "1371240" ] }, { "record_id": "GLY_001414_1_691", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 122944", "tested in", "in 6", "6 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "wegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 122944", "122944 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "wegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 122944 tested", "122944 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "wegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 122944", "epitope id 122944 tested", "id 122944 tested in", "122944 tested in 6", "tested in 6 t cell", "in 6 t cell assays", "6 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_692", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "123216", "1690082" ] }, { "record_id": "GLY_001414_1_692", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "geawdlagvepdi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123216", "tested in", "in 10", "10 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "geawdlagvepdi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123216", "123216 tested", "tested in 10", "in 10 t", "10 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "geawdlagvepdi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123216 tested", "123216 tested in", "tested in 10 t", "in 10 t cell", "10 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "geawdlagvepdi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123216", "epitope id 123216 tested", "id 123216 tested in", "123216 tested in 10", "tested in 10 t cell", "in 10 t cell assays", "10 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_693", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "123216", "1694880" ] }, { "record_id": "GLY_001414_1_693", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "geawdlagvepdi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123216", "tested in", "in 10", "10 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "geawdlagvepdi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123216", "123216 tested", "tested in 10", "in 10 t", "10 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "geawdlagvepdi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123216 tested", "123216 tested in", "tested in 10 t", "in 10 t cell", "10 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "geawdlagvepdi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123216", "epitope id 123216 tested", "id 123216 tested in", "123216 tested in 10", "tested in 10 t cell", "in 10 t cell assays", "10 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_694", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "123216", "8050169" ] }, { "record_id": "GLY_001414_1_694", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "geawdlagvepdi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123216", "tested in", "in 10", "10 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "geawdlagvepdi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123216", "123216 tested", "tested in 10", "in 10 t", "10 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "geawdlagvepdi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123216 tested", "123216 tested in", "tested in 10 t", "in 10 t cell", "10 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "geawdlagvepdi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123216", "epitope id 123216 tested", "id 123216 tested in", "123216 tested in 10", "tested in 10 t cell", "in 10 t cell assays", "10 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_695", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "123268", "8050169" ] }, { "record_id": "GLY_001414_1_695", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gsswegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123268", "tested in", "in 15", "15 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "gsswegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123268", "123268 tested", "tested in 15", "in 15 t", "15 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "gsswegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123268 tested", "123268 tested in", "tested in 15 t", "in 15 t cell", "15 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "gsswegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123268", "epitope id 123268 tested", "id 123268 tested in", "123268 tested in 15", "tested in 15 t cell", "in 15 t cell assays", "15 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_696", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "123268", "1690082" ] }, { "record_id": "GLY_001414_1_696", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gsswegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123268", "tested in", "in 15", "15 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "gsswegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123268", "123268 tested", "tested in 15", "in 15 t", "15 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "gsswegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123268 tested", "123268 tested in", "tested in 15 t", "in 15 t cell", "15 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "gsswegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123268", "epitope id 123268 tested", "id 123268 tested in", "123268 tested in 15", "tested in 15 t cell", "in 15 t cell assays", "15 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_697", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "123268", "1694880" ] }, { "record_id": "GLY_001414_1_697", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gsswegvgvvpdv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123268", "tested in", "in 15", "15 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "gsswegvgvvpdv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123268", "123268 tested", "tested in 15", "in 15 t", "15 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "gsswegvgvvpdv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123268 tested", "123268 tested in", "tested in 15 t", "in 15 t cell", "15 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "gsswegvgvvpdv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123268", "epitope id 123268 tested", "id 123268 tested in", "123268 tested in 15", "tested in 15 t cell", "in 15 t cell assays", "15 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_698", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "123841", "8050169" ] }, { "record_id": "GLY_001414_1_698", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wegvgvvpdvavp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123841", "tested in", "in 12", "12 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "wegvgvvpdvavp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123841", "123841 tested", "tested in 12", "in 12 t", "12 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "wegvgvvpdvavp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123841 tested", "123841 tested in", "tested in 12 t", "in 12 t cell", "12 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "wegvgvvpdvavp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123841", "epitope id 123841 tested", "id 123841 tested in", "123841 tested in 12", "tested in 12 t cell", "in 12 t cell assays", "12 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_699", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "123841", "9603463" ] }, { "record_id": "GLY_001414_1_699", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wegvgvvpdvavp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123841", "tested in", "in 12", "12 t", "t cell", "cell assays", "assays and", "and 2", "2 b", "b cell", "cell assays.", "wegvgvvpdvavp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123841", "123841 tested", "tested in 12", "in 12 t", "12 t cell", "t cell assays", "cell assays and", "assays and 2", "and 2 b", "2 b cell", "b cell assays.", "wegvgvvpdvavp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123841 tested", "123841 tested in", "tested in 12 t", "in 12 t cell", "12 t cell assays", "t cell assays and", "cell assays and 2", "assays and 2 b", "and 2 b cell", "2 b cell assays.", "wegvgvvpdvavp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123841", "epitope id 123841 tested", "id 123841 tested in", "123841 tested in 12", "tested in 12 t cell", "in 12 t cell assays", "12 t cell assays and", "t cell assays and 2", "cell assays and 2 b", "assays and 2 b cell", "and 2 b cell assays." ] }, { "record_id": "GLY_001414_1_700", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "124236", "1709661" ] }, { "record_id": "GLY_001414_1_700", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gsswegvgvvpd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 124236", "tested in", "in 2", "2 t", "t cell", "cell assays.", "gsswegvgvvpd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 124236", "124236 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "gsswegvgvvpd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 124236 tested", "124236 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "gsswegvgvvpd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 124236", "epitope id 124236 tested", "id 124236 tested in", "124236 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_701", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12661", "p12661 1", "125588", "7516403" ] }, { "record_id": "GLY_001414_1_701", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "twegsgvlpcv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 125588", "tested in", "in 5", "5 t", "t cell", "cell assays", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "twegsgvlpcv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 125588", "125588 tested", "tested in 5", "in 5 t", "5 t cell", "t cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "twegsgvlpcv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 125588 tested", "125588 tested in", "tested in 5 t", "in 5 t cell", "5 t cell assays", "t cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "twegsgvlpcv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 125588", "epitope id 125588 tested", "id 125588 tested in", "125588 tested in 5", "tested in 5 t cell", "in 5 t cell assays", "5 t cell assays and", "t cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_702", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "143412", "8746565" ] }, { "record_id": "GLY_001414_1_702", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ipggpvrlcpgrir is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 143412", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "ipggpvrlcpgrir is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 143412", "143412 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "ipggpvrlcpgrir is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 143412 tested", "143412 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 2", "assay and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "ipggpvrlcpgrir is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 143412", "epitope id 143412 tested", "id 143412 tested in", "143412 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 2", "cell assay and 2 mhc", "assay and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_703", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "143679", "16393994" ] }, { "record_id": "GLY_001414_1_703", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dsrvvhavevalatfn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 143679", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "dsrvvhavevalatfn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 143679", "143679 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "dsrvvhavevalatfn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 143679 tested", "143679 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "dsrvvhavevalatfn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 143679", "epitope id 143679 tested", "id 143679 tested in", "143679 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_704", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "234343", "1380674" ] }, { "record_id": "GLY_001414_1_704", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ykhtlnqidsvkvwprrp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234343", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "ykhtlnqidsvkvwprrp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234343", "234343 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "ykhtlnqidsvkvwprrp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234343 tested", "234343 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "ykhtlnqidsvkvwprrp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234343", "epitope id 234343 tested", "id 234343 tested in", "234343 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_705", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "234344", "1380674" ] }, { "record_id": "GLY_001414_1_705", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ykhtlnqidsvkvwprrpt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234344", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "ykhtlnqidsvkvwprrpt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234344", "234344 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "ykhtlnqidsvkvwprrpt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234344 tested", "234344 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "ykhtlnqidsvkvwprrpt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234344", "epitope id 234344 tested", "id 234344 tested in", "234344 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_706", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "237683", "11801660" ] }, { "record_id": "GLY_001414_1_706", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dsrvvhavevalatf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 237683", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dsrvvhavevalatf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 237683", "237683 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dsrvvhavevalatf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 237683 tested", "237683 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dsrvvhavevalatf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 237683", "epitope id 237683 tested", "id 237683 tested in", "237683 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_707", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "241677", "16075062" ] }, { "record_id": "GLY_001414_1_707", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dpdteqaalaavdyink is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 241677", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dpdteqaalaavdyink is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 241677", "241677 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dpdteqaalaavdyink is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 241677 tested", "241677 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dpdteqaalaavdyink is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 241677", "epitope id 241677 tested", "id 241677 tested in", "241677 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_708", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "243959", "8606061" ] }, { "record_id": "GLY_001414_1_708", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "idsvkvwprrptgevydi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 243959", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "idsvkvwprrptgevydi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 243959", "243959 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "idsvkvwprrptgevydi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 243959 tested", "243959 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "idsvkvwprrptgevydi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 243959", "epitope id 243959 tested", "id 243959 tested in", "243959 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_709", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "419008", "8119729" ] }, { "record_id": "GLY_001414_1_709", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lnqidsvkvw is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 419008", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lnqidsvkvw is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 419008", "419008 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lnqidsvkvw is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 419008 tested", "419008 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lnqidsvkvw is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 419008", "epitope id 419008 tested", "id 419008 tested in", "419008 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_710", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "423252", "15240697" ] }, { "record_id": "GLY_001414_1_710", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dlrhtfsgvasvesssgea is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 423252", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "dlrhtfsgvasvesssgea is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 423252", "423252 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "dlrhtfsgvasvesssgea is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 423252 tested", "423252 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "dlrhtfsgvasvesssgea is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 423252", "epitope id 423252 tested", "id 423252 tested in", "423252 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_711", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "423316", "15240697" ] }, { "record_id": "GLY_001414_1_711", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gktpivgqpsipggpvr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 423316", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "gktpivgqpsipggpvr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 423316", "423316 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "gktpivgqpsipggpvr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 423316 tested", "423316 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "gktpivgqpsipggpvr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 423316", "epitope id 423316 tested", "id 423316 tested in", "423316 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_712", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "423364", "15240697" ] }, { "record_id": "GLY_001414_1_712", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "israqfvplpvsvsve is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 423364", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "israqfvplpvsvsve is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 423364", "423364 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "israqfvplpvsvsve is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 423364 tested", "423364 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "israqfvplpvsvsve is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 423364", "epitope id 423364 tested", "id 423364 tested in", "423364 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_713", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "423507", "15240697" ] }, { "record_id": "GLY_001414_1_713", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sgeafhvgktpivgqps is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 423507", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "sgeafhvgktpivgqps is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 423507", "423507 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "sgeafhvgktpivgqps is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 423507 tested", "423507 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "sgeafhvgktpivgqps is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 423507", "epitope id 423507 tested", "id 423507 tested in", "423507 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_714", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "423574", "15240697" ] }, { "record_id": "GLY_001414_1_714", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vgktpivgqpsipggpvr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 423574", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "vgktpivgqpsipggpvr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 423574", "423574 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "vgktpivgqpsipggpvr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 423574 tested", "423574 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "vgktpivgqpsipggpvr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 423574", "epitope id 423574 tested", "id 423574 tested in", "423574 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_715", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "684773", "30573663" ] }, { "record_id": "GLY_001414_1_715", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tpivgqpsipggpvr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 684773", "tested in", "in 18", "18 mhc", "mhc ligand", "ligand assays.", "tpivgqpsipggpvr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 684773", "684773 tested", "tested in 18", "in 18 mhc", "18 mhc ligand", "mhc ligand assays.", "tpivgqpsipggpvr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 684773 tested", "684773 tested in", "tested in 18 mhc", "in 18 mhc ligand", "18 mhc ligand assays.", "tpivgqpsipggpvr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 684773", "epitope id 684773 tested", "id 684773 tested in", "684773 tested in 18", "tested in 18 mhc ligand", "in 18 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_716", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "845048", "30573663" ] }, { "record_id": "GLY_001414_1_716", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "htlnqidsvkvwpr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 845048", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "htlnqidsvkvwpr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 845048", "845048 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "htlnqidsvkvwpr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 845048 tested", "845048 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "htlnqidsvkvwpr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 845048", "epitope id 845048 tested", "id 845048 tested in", "845048 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_717", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "845920", "30573663" ] }, { "record_id": "GLY_001414_1_717", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "khtlnqidsvkvwpr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 845920", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "khtlnqidsvkvwpr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 845920", "845920 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "khtlnqidsvkvwpr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 845920 tested", "845920 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "khtlnqidsvkvwpr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 845920", "epitope id 845920 tested", "id 845920 tested in", "845920 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_718", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "848002", "30573663" ] }, { "record_id": "GLY_001414_1_718", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "raqfvplpvsvsve is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 848002", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "raqfvplpvsvsve is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 848002", "848002 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "raqfvplpvsvsve is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 848002 tested", "848002 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "raqfvplpvsvsve is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 848002", "epitope id 848002 tested", "id 848002 tested in", "848002 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_719", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "849137", "30573663" ] }, { "record_id": "GLY_001414_1_719", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sraqfvplpvsvsve is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 849137", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "sraqfvplpvsvsve is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 849137", "849137 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "sraqfvplpvsvsve is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 849137 tested", "849137 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "sraqfvplpvsvsve is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 849137", "epitope id 849137 tested", "id 849137 tested in", "849137 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_720", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "1611440", "30573663" ] }, { "record_id": "GLY_001414_1_720", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktpivgqpsipggp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1611440", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "ktpivgqpsipggp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1611440", "1611440 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "ktpivgqpsipggp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1611440 tested", "1611440 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "ktpivgqpsipggp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1611440", "epitope id 1611440 tested", "id 1611440 tested in", "1611440 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_721", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "1611441", "30573663" ] }, { "record_id": "GLY_001414_1_721", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktpivgqpsipggpv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1611441", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "ktpivgqpsipggpv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1611441", "1611441 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "ktpivgqpsipggpv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1611441 tested", "1611441 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "ktpivgqpsipggpv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1611441", "epitope id 1611441 tested", "id 1611441 tested in", "1611441 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_722", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "1617472", "30573663" ] }, { "record_id": "GLY_001414_1_722", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rhtfsgvasvesssg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1617472", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "rhtfsgvasvesssg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1617472", "1617472 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "rhtfsgvasvesssg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1617472 tested", "1617472 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "rhtfsgvasvesssg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1617472", "epitope id 1617472 tested", "id 1617472 tested in", "1617472 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_723", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p12763", "p12763 1", "1873272", "30573663" ] }, { "record_id": "GLY_001414_1_723", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "raqfvplpvsvsvef is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873272", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "raqfvplpvsvsvef is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873272", "1873272 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "raqfvplpvsvsvef is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873272 tested", "1873272 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "raqfvplpvsvsvef is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873272", "epitope id 1873272 tested", "id 1873272 tested in", "1873272 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_724", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p13608", "p13608 1", "107090", "24843873" ] }, { "record_id": "GLY_001414_1_724", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ategrvrvnsayqdk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 107090", "tested in", "in 60", "60 t", "t cell", "cell assays", "1 b", "b cell", "cell assay", "assay and", "and 6", "6 mhc", "mhc ligand", "ligand assays.", "ategrvrvnsayqdk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 107090", "107090 tested", "tested in 60", "in 60 t", "60 t cell", "t cell assays", "assays 1", "1 b cell", "b cell assay", "cell assay and", "assay and 6", "and 6 mhc", "6 mhc ligand", "mhc ligand assays.", "ategrvrvnsayqdk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 107090 tested", "107090 tested in", "tested in 60 t", "in 60 t cell", "60 t cell assays", "cell assays 1", "assays 1 b", "1 b cell assay", "b cell assay and", "cell assay and 6", "assay and 6 mhc", "and 6 mhc ligand", "6 mhc ligand assays.", "ategrvrvnsayqdk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 107090", "epitope id 107090 tested", "id 107090 tested in", "107090 tested in 60", "tested in 60 t cell", "in 60 t cell assays", "t cell assays 1", "cell assays 1 b", "assays 1 b cell", "1 b cell assay and", "b cell assay and 6", "cell assay and 6 mhc", "assay and 6 mhc ligand", "and 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_725", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p15497", "p15497 1", "237915", "11801660" ] }, { "record_id": "GLY_001414_1_725", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqrltarlealkeggg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 237915", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "rqrltarlealkeggg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 237915", "237915 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "rqrltarlealkeggg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 237915 tested", "237915 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "rqrltarlealkeggg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 237915", "epitope id 237915 tested", "id 237915 tested in", "237915 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_726", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p15497", "p15497 1", "848802", "30573663" ] }, { "record_id": "GLY_001414_1_726", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sgrdyvaqfeasalg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 848802", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "sgrdyvaqfeasalg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 848802", "848802 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "sgrdyvaqfeasalg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 848802 tested", "848802 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "sgrdyvaqfeasalg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 848802", "epitope id 848802 tested", "id 848802 tested in", "848802 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_727", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p17697", "p17697 1", "237635", "11801660" ] }, { "record_id": "GLY_001414_1_727", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "alkevkqiktqieqtn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 237635", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "alkevkqiktqieqtn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 237635", "237635 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "alkevkqiktqieqtn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 237635 tested", "237635 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "alkevkqiktqieqtn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 237635", "epitope id 237635 tested", "id 237635 tested in", "237635 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_728", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p17697", "p17697 1", "497371", "26495903" ] }, { "record_id": "GLY_001414_1_728", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "alkevkqiktqieq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497371", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "alkevkqiktqieq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497371", "497371 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "alkevkqiktqieq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497371 tested", "497371 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "alkevkqiktqieq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497371", "epitope id 497371 tested", "id 497371 tested in", "497371 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_729", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p19034", "p19034 1", "241932", "16075062" ] }, { "record_id": "GLY_001414_1_729", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ltqvqesllgywdtak is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 241932", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ltqvqesllgywdtak is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 241932", "241932 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ltqvqesllgywdtak is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 241932 tested", "241932 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ltqvqesllgywdtak is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 241932", "epitope id 241932 tested", "id 241932 tested in", "241932 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_730", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p19035", "p19035 1", "143771", "16393994" ] }, { "record_id": "GLY_001414_1_730", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "takdalssvqesqvaqqardw is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 143771", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "takdalssvqesqvaqqardw is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 143771", "143771 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "takdalssvqesqvaqqardw is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 143771 tested", "143771 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "takdalssvqesqvaqqardw is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 143771", "epitope id 143771 tested", "id 143771 tested in", "143771 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_731", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p21457", "p21457 1", "123855", "11462170" ] }, { "record_id": "GLY_001414_1_731", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yaqhvfrsfdansdg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 123855", "tested in", "in 1", "1 t", "t cell", "cell assay.", "yaqhvfrsfdansdg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 123855", "123855 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay.", "yaqhvfrsfdansdg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 123855 tested", "123855 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay.", "yaqhvfrsfdansdg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 123855", "epitope id 123855 tested", "id 123855 tested in", "123855 tested in 1", "tested in 1 t cell", "in 1 t cell assay." ] }, { "record_id": "GLY_001414_1_732", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p25326", "p25326 1", "153057", "30573663" ] }, { "record_id": "GLY_001414_1_732", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tgklvslsaqnlvd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 153057", "tested in", "in 82", "82 mhc", "mhc ligand", "ligand assays.", "tgklvslsaqnlvd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 153057", "153057 tested", "tested in 82", "in 82 mhc", "82 mhc ligand", "mhc ligand assays.", "tgklvslsaqnlvd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 153057 tested", "153057 tested in", "tested in 82 mhc", "in 82 mhc ligand", "82 mhc ligand assays.", "tgklvslsaqnlvd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 153057", "epitope id 153057 tested", "id 153057 tested in", "153057 tested in 82", "tested in 82 mhc ligand", "in 82 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_733", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p25326", "p25326 1", "520063", "30573663" ] }, { "record_id": "GLY_001414_1_733", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "klvslsaqnlvd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 520063", "tested in", "in 13", "13 mhc", "mhc ligand", "ligand assays.", "klvslsaqnlvd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 520063", "520063 tested", "tested in 13", "in 13 mhc", "13 mhc ligand", "mhc ligand assays.", "klvslsaqnlvd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 520063 tested", "520063 tested in", "tested in 13 mhc", "in 13 mhc ligand", "13 mhc ligand assays.", "klvslsaqnlvd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 520063", "epitope id 520063 tested", "id 520063 tested in", "520063 tested in 13", "tested in 13 mhc ligand", "in 13 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_734", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p25326", "p25326 1", "527433", "30573663" ] }, { "record_id": "GLY_001414_1_734", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tgklvslsaqnl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 527433", "tested in", "in 18", "18 mhc", "mhc ligand", "ligand assays.", "tgklvslsaqnl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 527433", "527433 tested", "tested in 18", "in 18 mhc", "18 mhc ligand", "mhc ligand assays.", "tgklvslsaqnl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 527433 tested", "527433 tested in", "tested in 18 mhc", "in 18 mhc ligand", "18 mhc ligand assays.", "tgklvslsaqnl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 527433", "epitope id 527433 tested", "id 527433 tested in", "527433 tested in 18", "tested in 18 mhc ligand", "in 18 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_735", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p25326", "p25326 1", "646165", "30573663" ] }, { "record_id": "GLY_001414_1_735", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktgklvslsaqnlvd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 646165", "tested in", "in 68", "68 mhc", "mhc ligand", "ligand assays.", "ktgklvslsaqnlvd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 646165", "646165 tested", "tested in 68", "in 68 mhc", "68 mhc ligand", "mhc ligand assays.", "ktgklvslsaqnlvd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 646165 tested", "646165 tested in", "tested in 68 mhc", "in 68 mhc ligand", "68 mhc ligand assays.", "ktgklvslsaqnlvd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 646165", "epitope id 646165 tested", "id 646165 tested in", "646165 tested in 68", "tested in 68 mhc ligand", "in 68 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_736", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p25326", "p25326 1", "690449", "30573663" ] }, { "record_id": "GLY_001414_1_736", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gklvslsaqnlvd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 690449", "tested in", "in 19", "19 mhc", "mhc ligand", "ligand assays.", "gklvslsaqnlvd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 690449", "690449 tested", "tested in 19", "in 19 mhc", "19 mhc ligand", "mhc ligand assays.", "gklvslsaqnlvd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 690449 tested", "690449 tested in", "tested in 19 mhc", "in 19 mhc ligand", "19 mhc ligand assays.", "gklvslsaqnlvd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 690449", "epitope id 690449 tested", "id 690449 tested in", "690449 tested in 19", "tested in 19 mhc ligand", "in 19 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_737", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p25326", "p25326 1", "691220", "30573663" ] }, { "record_id": "GLY_001414_1_737", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktgklvslsaqnlv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 691220", "tested in", "in 28", "28 mhc", "mhc ligand", "ligand assays.", "ktgklvslsaqnlv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 691220", "691220 tested", "tested in 28", "in 28 mhc", "28 mhc ligand", "mhc ligand assays.", "ktgklvslsaqnlv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 691220 tested", "691220 tested in", "tested in 28 mhc", "in 28 mhc ligand", "28 mhc ligand assays.", "ktgklvslsaqnlv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 691220", "epitope id 691220 tested", "id 691220 tested in", "691220 tested in 28", "tested in 28 mhc ligand", "in 28 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_738", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p25326", "p25326 1", "1105855", "30573663" ] }, { "record_id": "GLY_001414_1_738", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ktgklvslsaqnl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1105855", "tested in", "in 34", "34 mhc", "mhc ligand", "ligand assays.", "ktgklvslsaqnl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1105855", "1105855 tested", "tested in 34", "in 34 mhc", "34 mhc ligand", "mhc ligand assays.", "ktgklvslsaqnl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1105855 tested", "1105855 tested in", "tested in 34 mhc", "in 34 mhc ligand", "34 mhc ligand assays.", "ktgklvslsaqnl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1105855", "epitope id 1105855 tested", "id 1105855 tested in", "1105855 tested in 34", "tested in 34 mhc ligand", "in 34 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_739", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p29172", "p29172 1", "105209", "8455212" ] }, { "record_id": "GLY_001414_1_739", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gdrsgyss is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 105209", "tested in", "in 2", "2 b", "b cell", "cell assays.", "gdrsgyss is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 105209", "105209 tested", "tested in 2", "in 2 b", "2 b cell", "b cell assays.", "gdrsgyss is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 105209 tested", "105209 tested in", "tested in 2 b", "in 2 b cell", "2 b cell assays.", "gdrsgyss is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 105209", "epitope id 105209 tested", "id 105209 tested in", "105209 tested in 2", "tested in 2 b cell", "in 2 b cell assays." ] }, { "record_id": "GLY_001414_1_740", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p31404", "p31404 1", "1872320", "30573663" ] }, { "record_id": "GLY_001414_1_740", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ikekfsmvqvwpvrq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872320", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ikekfsmvqvwpvrq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872320", "1872320 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ikekfsmvqvwpvrq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872320 tested", "1872320 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ikekfsmvqvwpvrq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872320", "epitope id 1872320 tested", "id 1872320 tested in", "1872320 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_741", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p34955", "p34955 1", "143590", "8746565" ] }, { "record_id": "GLY_001414_1_741", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ydrntksplfvgkv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 143590", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "ydrntksplfvgkv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 143590", "143590 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "ydrntksplfvgkv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 143590 tested", "143590 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 2", "assay and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "ydrntksplfvgkv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 143590", "epitope id 143590 tested", "id 143590 tested in", "143590 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 2", "cell assay and 2 mhc", "assay and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_742", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p34955", "p34955 1", "143590", "19801983" ] }, { "record_id": "GLY_001414_1_742", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ydrntksplfvgkv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 143590", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 2", "2 mhc", "mhc ligand", "ligand assays.", "ydrntksplfvgkv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 143590", "143590 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 2", "and 2 mhc", "2 mhc ligand", "mhc ligand assays.", "ydrntksplfvgkv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 143590 tested", "143590 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 2", "assay and 2 mhc", "and 2 mhc ligand", "2 mhc ligand assays.", "ydrntksplfvgkv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 143590", "epitope id 143590 tested", "id 143590 tested in", "143590 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 2", "cell assay and 2 mhc", "assay and 2 mhc ligand", "and 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_743", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p34955", "p34955 1", "143767", "16393994" ] }, { "record_id": "GLY_001414_1_743", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "spvsiasafamlslgak is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 143767", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "spvsiasafamlslgak is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 143767", "143767 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "spvsiasafamlslgak is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 143767 tested", "143767 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "spvsiasafamlslgak is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 143767", "epitope id 143767 tested", "id 143767 tested in", "143767 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_744", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p34955", "p34955 1", "224282", "8268130" ] }, { "record_id": "GLY_001414_1_744", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vdtfledvknlyhsea is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 224282", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "vdtfledvknlyhsea is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 224282", "224282 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "vdtfledvknlyhsea is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 224282 tested", "224282 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "vdtfledvknlyhsea is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 224282", "epitope id 224282 tested", "id 224282 tested in", "224282 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_745", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p34955", "p34955 1", "423415", "15240697" ] }, { "record_id": "GLY_001414_1_745", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lppdvefnrpfl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 423415", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lppdvefnrpfl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 423415", "423415 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lppdvefnrpfl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 423415 tested", "423415 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lppdvefnrpfl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 423415", "epitope id 423415 tested", "id 423415 tested in", "423415 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_746", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p34955", "p34955 1", "423602", "15240697" ] }, { "record_id": "GLY_001414_1_746", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ydrntksplfvgkvvnptqa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 423602", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "ydrntksplfvgkvvnptqa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 423602", "423602 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "ydrntksplfvgkvvnptqa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 423602 tested", "423602 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "ydrntksplfvgkvvnptqa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 423602", "epitope id 423602 tested", "id 423602 tested in", "423602 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_747", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p34955", "p34955 1", "499163", "26495903" ] }, { "record_id": "GLY_001414_1_747", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gitkeqplkvskalh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499163", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "gitkeqplkvskalh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499163", "499163 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gitkeqplkvskalh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499163 tested", "499163 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "gitkeqplkvskalh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499163", "epitope id 499163 tested", "id 499163 tested in", "499163 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_748", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p40682", "p40682 1", "527168", "30573663" ] }, { "record_id": "GLY_001414_1_748", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "taaltavrpsrva is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 527168", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "taaltavrpsrva is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 527168", "527168 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "taaltavrpsrva is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 527168 tested", "527168 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "taaltavrpsrva is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 527168", "epitope id 527168 tested", "id 527168 tested in", "527168 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_749", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p41361", "p41361 1", "747210", "8756699" ] }, { "record_id": "GLY_001414_1_749", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gledlfspek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 747210", "tested in", "in 1", "1 b", "b cell", "cell assay.", "gledlfspek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 747210", "747210 tested", "tested in 1", "in 1 b", "1 b cell", "b cell assay.", "gledlfspek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 747210 tested", "747210 tested in", "tested in 1 b", "in 1 b cell", "1 b cell assay.", "gledlfspek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 747210", "epitope id 747210 tested", "id 747210 tested in", "747210 tested in 1", "tested in 1 b cell", "in 1 b cell assay." ] }, { "record_id": "GLY_001414_1_750", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p45478", "p45478 1", "515735", "30573663" ] }, { "record_id": "GLY_001414_1_750", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fgfyrsgqaketip is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 515735", "tested in", "in 15", "15 mhc", "mhc ligand", "ligand assays.", "fgfyrsgqaketip is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 515735", "515735 tested", "tested in 15", "in 15 mhc", "15 mhc ligand", "mhc ligand assays.", "fgfyrsgqaketip is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 515735 tested", "515735 tested in", "tested in 15 mhc", "in 15 mhc ligand", "15 mhc ligand assays.", "fgfyrsgqaketip is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 515735", "epitope id 515735 tested", "id 515735 tested in", "515735 tested in 15", "tested in 15 mhc ligand", "in 15 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_751", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p45478", "p45478 1", "515736", "30573663" ] }, { "record_id": "GLY_001414_1_751", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fgfyrsgqaketipl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 515736", "tested in", "in 19", "19 mhc", "mhc ligand", "ligand assays.", "fgfyrsgqaketipl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 515736", "515736 tested", "tested in 19", "in 19 mhc", "19 mhc ligand", "mhc ligand assays.", "fgfyrsgqaketipl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 515736 tested", "515736 tested in", "tested in 19 mhc", "in 19 mhc ligand", "19 mhc ligand assays.", "fgfyrsgqaketipl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 515736", "epitope id 515736 tested", "id 515736 tested in", "515736 tested in 19", "tested in 19 mhc ligand", "in 19 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_752", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p49907", "p49907 1", "503239", "26495903" ] }, { "record_id": "GLY_001414_1_752", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tyvedsiktvycedk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503239", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "tyvedsiktvycedk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503239", "503239 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "tyvedsiktvycedk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503239 tested", "503239 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "tyvedsiktvycedk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503239", "epitope id 503239 tested", "id 503239 tested in", "503239 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_753", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p49907", "p49907 1", "503931", "26495903" ] }, { "record_id": "GLY_001414_1_753", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yvedsiktvycedk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503931", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "yvedsiktvycedk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503931", "503931 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "yvedsiktvycedk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503931 tested", "503931 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "yvedsiktvycedk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503931", "epitope id 503931 tested", "id 503931 tested in", "503931 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_754", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p50448", "p50448 1", "843994", "30573663" ] }, { "record_id": "GLY_001414_1_754", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fvilvpqtvkh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 843994", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "fvilvpqtvkh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 843994", "843994 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "fvilvpqtvkh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 843994 tested", "843994 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "fvilvpqtvkh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 843994", "epitope id 843994 tested", "id 843994 tested in", "843994 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_755", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p50448", "p50448 1", "1601299", "30573663" ] }, { "record_id": "GLY_001414_1_755", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dseirsaeavlgeal is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1601299", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "dseirsaeavlgeal is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1601299", "1601299 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "dseirsaeavlgeal is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1601299 tested", "1601299 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "dseirsaeavlgeal is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1601299", "epitope id 1601299 tested", "id 1601299 tested in", "1601299 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_756", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p50448", "p50448 1", "1871827", "30573663" ] }, { "record_id": "GLY_001414_1_756", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fvilvpqtvkhh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871827", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "fvilvpqtvkhh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871827", "1871827 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "fvilvpqtvkhh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871827 tested", "1871827 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "fvilvpqtvkhh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871827", "epitope id 1871827 tested", "id 1871827 tested in", "1871827 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_757", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p53793", "p53793 1", "644102", "30573663" ] }, { "record_id": "GLY_001414_1_757", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gsehfiglagsgaas is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 644102", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "gsehfiglagsgaas is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 644102", "644102 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "gsehfiglagsgaas is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 644102 tested", "644102 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "gsehfiglagsgaas is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 644102", "epitope id 644102 tested", "id 644102 tested in", "644102 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_758", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p56652", "p56652 1", "500070", "26495903" ] }, { "record_id": "GLY_001414_1_758", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kareehtvperstsii is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500070", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kareehtvperstsii is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500070", "500070 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kareehtvperstsii is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500070 tested", "500070 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kareehtvperstsii is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500070", "epitope id 500070 tested", "id 500070 tested in", "500070 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_759", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p61823", "p61823 1", "108593", "10820257" ] }, { "record_id": "GLY_001414_1_759", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pvntfvhesladvqa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 108593", "tested in", "in 2", "2 t", "t cell", "cell assays.", "pvntfvhesladvqa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 108593", "108593 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "pvntfvhesladvqa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 108593 tested", "108593 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "pvntfvhesladvqa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 108593", "epitope id 108593 tested", "id 108593 tested in", "108593 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_760", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p61823", "p61823 1", "108593", "11238647" ] }, { "record_id": "GLY_001414_1_760", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pvntfvhesladvqa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 108593", "tested in", "in 2", "2 t", "t cell", "cell assays.", "pvntfvhesladvqa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 108593", "108593 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "pvntfvhesladvqa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 108593 tested", "108593 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "pvntfvhesladvqa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 108593", "epitope id 108593 tested", "id 108593 tested in", "108593 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_761", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p61823", "p61823 1", "124828", "2265605" ] }, { "record_id": "GLY_001414_1_761", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vntfvhesladvqa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 124828", "tested in", "in 1", "1 t", "t cell", "cell assay", "assay and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "vntfvhesladvqa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 124828", "124828 tested", "tested in 1", "in 1 t", "1 t cell", "t cell assay", "cell assay and", "assay and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vntfvhesladvqa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 124828 tested", "124828 tested in", "tested in 1 t", "in 1 t cell", "1 t cell assay", "t cell assay and", "cell assay and 1", "assay and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "vntfvhesladvqa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 124828", "epitope id 124828 tested", "id 124828 tested in", "124828 tested in 1", "tested in 1 t cell", "in 1 t cell assay", "1 t cell assay and", "t cell assay and 1", "cell assay and 1 mhc", "assay and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_762", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p62248", "p62248 1", "533543", "30573663" ] }, { "record_id": "GLY_001414_1_762", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rpgafkaelsklviv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 533543", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "rpgafkaelsklviv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 533543", "533543 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "rpgafkaelsklviv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 533543 tested", "533543 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "rpgafkaelsklviv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 533543", "epitope id 533543 tested", "id 533543 tested in", "533543 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_763", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p62803", "p62803 1", "117295", "10878337" ] }, { "record_id": "GLY_001414_1_763", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gitkpairrlarrgg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 117295", "tested in", "in 7", "7 t", "t cell", "cell assays", "5 b", "b cell", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "gitkpairrlarrgg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 117295", "117295 tested", "tested in 7", "in 7 t", "7 t cell", "t cell assays", "assays 5", "5 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gitkpairrlarrgg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 117295 tested", "117295 tested in", "tested in 7 t", "in 7 t cell", "7 t cell assays", "cell assays 5", "assays 5 b", "5 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "gitkpairrlarrgg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 117295", "epitope id 117295 tested", "id 117295 tested in", "117295 tested in 7", "tested in 7 t cell", "in 7 t cell assays", "t cell assays 5", "cell assays 5 b", "assays 5 b cell", "5 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_764", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p62803", "p62803 1", "117403", "10878337" ] }, { "record_id": "GLY_001414_1_764", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yalkrqgrtlyg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 117403", "tested in", "in 78", "78 t", "t cell", "cell assays", "14 b", "b cell", "assays and", "and 1", "1 mhc", "mhc ligand", "ligand assay.", "yalkrqgrtlyg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 117403", "117403 tested", "tested in 78", "in 78 t", "78 t cell", "t cell assays", "assays 14", "14 b cell", "b cell assays", "cell assays and", "assays and 1", "and 1 mhc", "1 mhc ligand", "mhc ligand assay.", "yalkrqgrtlyg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 117403 tested", "117403 tested in", "tested in 78 t", "in 78 t cell", "78 t cell assays", "cell assays 14", "assays 14 b", "14 b cell assays", "b cell assays and", "cell assays and 1", "assays and 1 mhc", "and 1 mhc ligand", "1 mhc ligand assay.", "yalkrqgrtlyg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 117403", "epitope id 117403 tested", "id 117403 tested in", "117403 tested in 78", "tested in 78 t cell", "in 78 t cell assays", "t cell assays 14", "cell assays 14 b", "assays 14 b cell", "14 b cell assays and", "b cell assays and 1", "cell assays and 1 mhc", "assays and 1 mhc ligand", "and 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_765", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p62803", "p62803 1", "117404", "10878337" ] }, { "record_id": "GLY_001414_1_765", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yalkrqgrtlygfg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 117404", "tested in", "in 3", "3 t", "t cell", "cell assays.", "yalkrqgrtlygfg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 117404", "117404 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "yalkrqgrtlygfg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 117404 tested", "117404 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "yalkrqgrtlygfg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 117404", "epitope id 117404 tested", "id 117404 tested in", "117404 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_766", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p68103", "p68103 1", "533607", "30573663" ] }, { "record_id": "GLY_001414_1_766", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ryeeivkevstyikk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 533607", "tested in", "in 11", "11 mhc", "mhc ligand", "ligand assays.", "ryeeivkevstyikk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 533607", "533607 tested", "tested in 11", "in 11 mhc", "11 mhc ligand", "mhc ligand assays.", "ryeeivkevstyikk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 533607 tested", "533607 tested in", "tested in 11 mhc", "in 11 mhc ligand", "11 mhc ligand assays.", "ryeeivkevstyikk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 533607", "epitope id 533607 tested", "id 533607 tested in", "533607 tested in 11", "tested in 11 mhc ligand", "in 11 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_767", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p68103", "p68103 1", "534504", "30573663" ] }, { "record_id": "GLY_001414_1_767", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "yeeivkevstyikk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 534504", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "yeeivkevstyikk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 534504", "534504 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "yeeivkevstyikk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 534504 tested", "534504 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "yeeivkevstyikk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 534504", "epitope id 534504 tested", "id 534504 tested in", "534504 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_768", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p80109", "p80109 1", "502346", "26495903" ] }, { "record_id": "GLY_001414_1_768", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "skeknqviiaagrss is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 502346", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "skeknqviiaagrss is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 502346", "502346 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "skeknqviiaagrss is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 502346 tested", "502346 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "skeknqviiaagrss is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 502346", "epitope id 502346 tested", "id 502346 tested in", "502346 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_769", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p80195", "p80195 1", "2246861", "37604312" ] }, { "record_id": "GLY_001414_1_769", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ntvketikylkslfs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2246861", "tested in", "in 3", "3 t", "t cell", "cell assays.", "ntvketikylkslfs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2246861", "2246861 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "ntvketikylkslfs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2246861 tested", "2246861 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "ntvketikylkslfs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2246861", "epitope id 2246861 tested", "id 2246861 tested in", "2246861 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_770", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p80195", "p80195 1", "2247932", "37604312" ] }, { "record_id": "GLY_001414_1_770", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tikylkslfshafevvkt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2247932", "tested in", "in 3", "3 t", "t cell", "cell assays.", "tikylkslfshafevvkt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2247932", "2247932 tested", "tested in 3", "in 3 t", "3 t cell", "t cell assays.", "tikylkslfshafevvkt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2247932 tested", "2247932 tested in", "tested in 3 t", "in 3 t cell", "3 t cell assays.", "tikylkslfshafevvkt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2247932", "epitope id 2247932 tested", "id 2247932 tested in", "2247932 tested in 3", "tested in 3 t cell", "in 3 t cell assays." ] }, { "record_id": "GLY_001414_1_771", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p81125", "p81125 1", "497269", "30573663" ] }, { "record_id": "GLY_001414_1_771", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "agnafkkadpqeain is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497269", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "agnafkkadpqeain is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497269", "497269 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "agnafkkadpqeain is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497269 tested", "497269 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "agnafkkadpqeain is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497269", "epitope id 497269 tested", "id 497269 tested in", "497269 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_772", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p81125", "p81125 1", "640466", "30573663" ] }, { "record_id": "GLY_001414_1_772", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "anmfkmaknwsaag is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 640466", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "anmfkmaknwsaag is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 640466", "640466 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "anmfkmaknwsaag is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 640466 tested", "640466 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "anmfkmaknwsaag is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 640466", "epitope id 640466 tested", "id 640466 tested in", "640466 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_773", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p81126", "p81126 1", "640467", "30573663" ] }, { "record_id": "GLY_001414_1_773", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "anmfkmaknwsaagn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 640467", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "anmfkmaknwsaagn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 640467", "640467 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "anmfkmaknwsaagn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 640467 tested", "640467 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "anmfkmaknwsaagn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 640467", "epitope id 640467 tested", "id 640467 tested in", "640467 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_774", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p81644", "p81644 1", "237741", "11801660" ] }, { "record_id": "GLY_001414_1_774", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gselqtqakayfektq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 237741", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "gselqtqakayfektq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 237741", "237741 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "gselqtqakayfektq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 237741 tested", "237741 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "gselqtqakayfektq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 237741", "epitope id 237741 tested", "id 237741 tested in", "237741 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_775", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p81644", "p81644 1", "237741", "16075062" ] }, { "record_id": "GLY_001414_1_775", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gselqtqakayfektq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 237741", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "gselqtqakayfektq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 237741", "237741 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "gselqtqakayfektq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 237741 tested", "237741 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "gselqtqakayfektq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 237741", "epitope id 237741 tested", "id 237741 tested in", "237741 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_776", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "p81644", "p81644 1", "501949", "26495903" ] }, { "record_id": "GLY_001414_1_776", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqaeesnlqslvsq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501949", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rqaeesnlqslvsq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501949", "501949 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rqaeesnlqslvsq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501949 tested", "501949 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rqaeesnlqslvsq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501949", "epitope id 501949 tested", "id 501949 tested in", "501949 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_777", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "241701", "26495903" ] }, { "record_id": "GLY_001414_1_777", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eetmkevkaykee is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 241701", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "eetmkevkaykee is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 241701", "241701 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "eetmkevkaykee is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 241701 tested", "241701 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "eetmkevkaykee is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 241701", "epitope id 241701 tested", "id 241701 tested in", "241701 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_778", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "241701", "16075062" ] }, { "record_id": "GLY_001414_1_778", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eetmkevkaykee is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 241701", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "eetmkevkaykee is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 241701", "241701 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "eetmkevkaykee is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 241701 tested", "241701 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "eetmkevkaykee is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 241701", "epitope id 241701 tested", "id 241701 tested in", "241701 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_779", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "497199", "26495903" ] }, { "record_id": "GLY_001414_1_779", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aeawrqklhgrle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497199", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "aeawrqklhgrle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497199", "497199 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "aeawrqklhgrle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497199 tested", "497199 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "aeawrqklhgrle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497199", "epitope id 497199 tested", "id 497199 tested in", "497199 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_780", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "497633", "26495903" ] }, { "record_id": "GLY_001414_1_780", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "arvskelqaaqar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497633", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "arvskelqaaqar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497633", "497633 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "arvskelqaaqar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497633 tested", "497633 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "arvskelqaaqar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497633", "epitope id 497633 tested", "id 497633 tested in", "497633 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_781", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "497634", "26495903" ] }, { "record_id": "GLY_001414_1_781", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "arvskelqaaqarl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497634", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "arvskelqaaqarl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497634", "497634 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "arvskelqaaqarl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497634 tested", "497634 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "arvskelqaaqarl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497634", "epitope id 497634 tested", "id 497634 tested in", "497634 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_782", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "497635", "26495903" ] }, { "record_id": "GLY_001414_1_782", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "arvskelqaaqarlg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497635", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "arvskelqaaqarlg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497635", "497635 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "arvskelqaaqarlg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497635 tested", "497635 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "arvskelqaaqarlg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497635", "epitope id 497635 tested", "id 497635 tested in", "497635 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_783", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "497636", "26495903" ] }, { "record_id": "GLY_001414_1_783", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "arvskelqaaqarlgs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497636", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "arvskelqaaqarlgs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497636", "497636 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "arvskelqaaqarlgs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497636 tested", "497636 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "arvskelqaaqarlgs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497636", "epitope id 497636 tested", "id 497636 tested in", "497636 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_784", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498440", "26495903" ] }, { "record_id": "GLY_001414_1_784", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eeqgnqmrlqaeafqar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498440", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "eeqgnqmrlqaeafqar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498440", "498440 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eeqgnqmrlqaeafqar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498440 tested", "498440 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "eeqgnqmrlqaeafqar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498440", "epitope id 498440 tested", "id 498440 tested in", "498440 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_785", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498453", "26495903" ] }, { "record_id": "GLY_001414_1_785", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eetmkevkaykeele is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498453", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "eetmkevkaykeele is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498453", "498453 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eetmkevkaykeele is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498453 tested", "498453 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "eetmkevkaykeele is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498453", "epitope id 498453 tested", "id 498453 tested in", "498453 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_786", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498724", "26495903" ] }, { "record_id": "GLY_001414_1_786", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eqgnqmrlqaeafq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498724", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "eqgnqmrlqaeafq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498724", "498724 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eqgnqmrlqaeafq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498724 tested", "498724 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "eqgnqmrlqaeafq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498724", "epitope id 498724 tested", "id 498724 tested in", "498724 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_787", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498725", "26495903" ] }, { "record_id": "GLY_001414_1_787", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eqgnqmrlqaeafqar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498725", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "eqgnqmrlqaeafqar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498725", "498725 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eqgnqmrlqaeafqar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498725 tested", "498725 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "eqgnqmrlqaeafqar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498725", "epitope id 498725 tested", "id 498725 tested in", "498725 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_788", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498726", "26495903" ] }, { "record_id": "GLY_001414_1_788", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eqgqsraatlstlagqp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498726", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "eqgqsraatlstlagqp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498726", "498726 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eqgqsraatlstlagqp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498726 tested", "498726 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "eqgqsraatlstlagqp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498726", "epitope id 498726 tested", "id 498726 tested in", "498726 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_789", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498817", "26495903" ] }, { "record_id": "GLY_001414_1_789", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "etmkevkayke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498817", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "etmkevkayke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498817", "498817 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "etmkevkayke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498817 tested", "498817 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "etmkevkayke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498817", "epitope id 498817 tested", "id 498817 tested in", "498817 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_790", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498819", "26495903" ] }, { "record_id": "GLY_001414_1_790", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "etmkevkaykeel is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498819", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "etmkevkaykeel is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498819", "498819 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "etmkevkaykeel is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498819 tested", "498819 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "etmkevkaykeel is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498819", "epitope id 498819 tested", "id 498819 tested in", "498819 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_791", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498820", "26495903" ] }, { "record_id": "GLY_001414_1_791", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "etmkevkaykeele is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498820", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "etmkevkaykeele is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498820", "498820 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "etmkevkaykeele is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498820 tested", "498820 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "etmkevkaykeele is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498820", "epitope id 498820 tested", "id 498820 tested in", "498820 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_792", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498821", "26495903" ] }, { "record_id": "GLY_001414_1_792", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "etmkevkaykeeleg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498821", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "etmkevkaykeeleg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498821", "498821 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "etmkevkaykeeleg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498821 tested", "498821 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "etmkevkaykeeleg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498821", "epitope id 498821 tested", "id 498821 tested in", "498821 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_793", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498822", "26495903" ] }, { "record_id": "GLY_001414_1_793", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "etqarvskelqaaqar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498822", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "etqarvskelqaaqar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498822", "498822 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "etqarvskelqaaqar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498822 tested", "498822 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "etqarvskelqaaqar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498822", "epitope id 498822 tested", "id 498822 tested in", "498822 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_794", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498823", "26495903" ] }, { "record_id": "GLY_001414_1_794", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "etqarvskelqaaqarl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498823", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "etqarvskelqaaqarl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498823", "498823 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "etqarvskelqaaqarl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498823 tested", "498823 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "etqarvskelqaaqarl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498823", "epitope id 498823 tested", "id 498823 tested in", "498823 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_795", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498824", "26495903" ] }, { "record_id": "GLY_001414_1_795", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "etqarvskelqaaqarlg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498824", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "etqarvskelqaaqarlg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498824", "498824 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "etqarvskelqaaqarlg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498824 tested", "498824 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "etqarvskelqaaqarlg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498824", "epitope id 498824 tested", "id 498824 tested in", "498824 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_796", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "498825", "26495903" ] }, { "record_id": "GLY_001414_1_796", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "etqarvskelqaaqarlgs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498825", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "etqarvskelqaaqarlgs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498825", "498825 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "etqarvskelqaaqarlgs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498825 tested", "498825 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "etqarvskelqaaqarlgs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498825", "epitope id 498825 tested", "id 498825 tested in", "498825 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_797", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499383", "26495903" ] }, { "record_id": "GLY_001414_1_797", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gqsraatlstlagqp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499383", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "gqsraatlstlagqp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499383", "499383 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gqsraatlstlagqp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499383 tested", "499383 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "gqsraatlstlagqp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499383", "epitope id 499383 tested", "id 499383 tested in", "499383 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_798", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499409", "26495903" ] }, { "record_id": "GLY_001414_1_798", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "grleevgvraq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499409", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "grleevgvraq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499409", "499409 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "grleevgvraq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499409 tested", "499409 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "grleevgvraq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499409", "epitope id 499409 tested", "id 499409 tested in", "499409 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_799", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499410", "26495903" ] }, { "record_id": "GLY_001414_1_799", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "grleevgvraqd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499410", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "grleevgvraqd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499410", "499410 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "grleevgvraqd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499410 tested", "499410 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "grleevgvraqd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499410", "epitope id 499410 tested", "id 499410 tested in", "499410 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_800", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499411", "26495903" ] }, { "record_id": "GLY_001414_1_800", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "grleevgvraqdr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499411", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "grleevgvraqdr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499411", "499411 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "grleevgvraqdr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499411 tested", "499411 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "grleevgvraqdr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499411", "epitope id 499411 tested", "id 499411 tested in", "499411 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_801", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499412", "26495903" ] }, { "record_id": "GLY_001414_1_801", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "grleevgvraqdrld is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499412", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "grleevgvraqdrld is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499412", "499412 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "grleevgvraqdrld is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499412 tested", "499412 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "grleevgvraqdrld is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499412", "epitope id 499412 tested", "id 499412 tested in", "499412 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_802", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499413", "26495903" ] }, { "record_id": "GLY_001414_1_802", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "grleevgvraqdrldk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499413", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "grleevgvraqdrldk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499413", "499413 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "grleevgvraqdrldk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499413 tested", "499413 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "grleevgvraqdrldk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499413", "epitope id 499413 tested", "id 499413 tested in", "499413 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_803", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499595", "26495903" ] }, { "record_id": "GLY_001414_1_803", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hgrleevgvraq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499595", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "hgrleevgvraq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499595", "499595 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "hgrleevgvraq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499595 tested", "499595 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "hgrleevgvraq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499595", "epitope id 499595 tested", "id 499595 tested in", "499595 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_804", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499596", "26495903" ] }, { "record_id": "GLY_001414_1_804", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hgrleevgvraqd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499596", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "hgrleevgvraqd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499596", "499596 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "hgrleevgvraqd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499596 tested", "499596 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "hgrleevgvraqd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499596", "epitope id 499596 tested", "id 499596 tested in", "499596 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_805", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499597", "26495903" ] }, { "record_id": "GLY_001414_1_805", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hgrleevgvraqdr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499597", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "hgrleevgvraqdr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499597", "499597 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "hgrleevgvraqdr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499597 tested", "499597 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "hgrleevgvraqdr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499597", "epitope id 499597 tested", "id 499597 tested in", "499597 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_806", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499598", "26495903" ] }, { "record_id": "GLY_001414_1_806", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hgrleevgvraqdrld is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499598", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "hgrleevgvraqdrld is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499598", "499598 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "hgrleevgvraqdrld is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499598 tested", "499598 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "hgrleevgvraqdrld is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499598", "epitope id 499598 tested", "id 499598 tested in", "499598 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_807", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499599", "26495903" ] }, { "record_id": "GLY_001414_1_807", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hgrleevgvraqdrldk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499599", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "hgrleevgvraqdrldk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499599", "499599 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "hgrleevgvraqdrldk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499599 tested", "499599 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "hgrleevgvraqdrldk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499599", "epitope id 499599 tested", "id 499599 tested in", "499599 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_808", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499968", "26495903" ] }, { "record_id": "GLY_001414_1_808", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "irqqleevhakveeq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499968", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "irqqleevhakveeq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499968", "499968 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "irqqleevhakveeq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499968 tested", "499968 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "irqqleevhakveeq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499968", "epitope id 499968 tested", "id 499968 tested in", "499968 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_809", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499969", "26495903" ] }, { "record_id": "GLY_001414_1_809", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "irqqleevhakveeqgn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499969", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "irqqleevhakveeqgn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499969", "499969 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "irqqleevhakveeqgn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499969 tested", "499969 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "irqqleevhakveeqgn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499969", "epitope id 499969 tested", "id 499969 tested in", "499969 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_810", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "499970", "26495903" ] }, { "record_id": "GLY_001414_1_810", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "irqqleevhakveeqgnq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499970", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "irqqleevhakveeqgnq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499970", "499970 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "irqqleevhakveeqgnq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499970 tested", "499970 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "irqqleevhakveeqgnq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499970", "epitope id 499970 tested", "id 499970 tested in", "499970 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_811", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "500262", "26495903" ] }, { "record_id": "GLY_001414_1_811", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kirqqleevhakveeqgn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500262", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kirqqleevhakveeqgn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500262", "500262 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kirqqleevhakveeqgn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500262 tested", "500262 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kirqqleevhakveeqgn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500262", "epitope id 500262 tested", "id 500262 tested in", "500262 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_812", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "500737", "26495903" ] }, { "record_id": "GLY_001414_1_812", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "leevgvraqdrld is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500737", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "leevgvraqdrld is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500737", "500737 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "leevgvraqdrld is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500737 tested", "500737 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "leevgvraqdrld is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500737", "epitope id 500737 tested", "id 500737 tested in", "500737 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_813", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "500796", "26495903" ] }, { "record_id": "GLY_001414_1_813", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lhgrleevgvraqd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500796", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lhgrleevgvraqd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500796", "500796 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lhgrleevgvraqd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500796 tested", "500796 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lhgrleevgvraqd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500796", "epitope id 500796 tested", "id 500796 tested in", "500796 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_814", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "500797", "26495903" ] }, { "record_id": "GLY_001414_1_814", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lhgrleevgvraqdr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500797", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lhgrleevgvraqdr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500797", "500797 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lhgrleevgvraqdr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500797 tested", "500797 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lhgrleevgvraqdr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500797", "epitope id 500797 tested", "id 500797 tested in", "500797 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_815", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501141", "26495903" ] }, { "record_id": "GLY_001414_1_815", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "meetmkevkayke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501141", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "meetmkevkayke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501141", "501141 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "meetmkevkayke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501141 tested", "501141 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "meetmkevkayke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501141", "epitope id 501141 tested", "id 501141 tested in", "501141 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_816", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501143", "26495903" ] }, { "record_id": "GLY_001414_1_816", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "meetmkevkaykeele is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501143", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "meetmkevkaykeele is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501143", "501143 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "meetmkevkaykeele is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501143 tested", "501143 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "meetmkevkaykeele is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501143", "epitope id 501143 tested", "id 501143 tested in", "501143 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_817", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501528", "26495903" ] }, { "record_id": "GLY_001414_1_817", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qarvskelqaaqar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501528", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "qarvskelqaaqar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501528", "501528 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "qarvskelqaaqar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501528 tested", "501528 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "qarvskelqaaqar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501528", "epitope id 501528 tested", "id 501528 tested in", "501528 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_818", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501529", "26495903" ] }, { "record_id": "GLY_001414_1_818", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qarvskelqaaqarlg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501529", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "qarvskelqaaqarlg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501529", "501529 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "qarvskelqaaqarlg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501529 tested", "501529 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "qarvskelqaaqarlg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501529", "epitope id 501529 tested", "id 501529 tested in", "501529 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_819", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501530", "26495903" ] }, { "record_id": "GLY_001414_1_819", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qarvskelqaaqarlgs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501530", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "qarvskelqaaqarlgs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501530", "501530 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "qarvskelqaaqarlgs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501530 tested", "501530 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "qarvskelqaaqarlgs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501530", "epitope id 501530 tested", "id 501530 tested in", "501530 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_820", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501615", "26495903" ] }, { "record_id": "GLY_001414_1_820", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qleevhakveeqgn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501615", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "qleevhakveeqgn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501615", "501615 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "qleevhakveeqgn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501615 tested", "501615 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "qleevhakveeqgn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501615", "epitope id 501615 tested", "id 501615 tested in", "501615 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_821", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501675", "26495903" ] }, { "record_id": "GLY_001414_1_821", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qqleevhakveeq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501675", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "qqleevhakveeq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501675", "501675 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "qqleevhakveeq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501675 tested", "501675 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "qqleevhakveeq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501675", "epitope id 501675 tested", "id 501675 tested in", "501675 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_822", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501676", "26495903" ] }, { "record_id": "GLY_001414_1_822", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qqleevhakveeqg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501676", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "qqleevhakveeqg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501676", "501676 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "qqleevhakveeqg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501676 tested", "501676 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "qqleevhakveeqg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501676", "epitope id 501676 tested", "id 501676 tested in", "501676 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_823", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501677", "26495903" ] }, { "record_id": "GLY_001414_1_823", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qqleevhakveeqgn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501677", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "qqleevhakveeqgn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501677", "501677 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "qqleevhakveeqgn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501677 tested", "501677 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "qqleevhakveeqgn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501677", "epitope id 501677 tested", "id 501677 tested in", "501677 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_824", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501678", "26495903" ] }, { "record_id": "GLY_001414_1_824", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "qqleevhakveeqgnq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501678", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "qqleevhakveeqgnq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501678", "501678 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "qqleevhakveeqgnq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501678 tested", "501678 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "qqleevhakveeqgnq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501678", "epitope id 501678 tested", "id 501678 tested in", "501678 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_825", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501728", "26495903" ] }, { "record_id": "GLY_001414_1_825", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "raeawrqklhgrle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501728", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "raeawrqklhgrle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501728", "501728 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "raeawrqklhgrle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501728 tested", "501728 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "raeawrqklhgrle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501728", "epitope id 501728 tested", "id 501728 tested in", "501728 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_826", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501878", "26495903" ] }, { "record_id": "GLY_001414_1_826", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rleevgvraqdr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501878", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rleevgvraqdr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501878", "501878 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rleevgvraqdr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501878 tested", "501878 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rleevgvraqdr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501878", "epitope id 501878 tested", "id 501878 tested in", "501878 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_827", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501879", "26495903" ] }, { "record_id": "GLY_001414_1_827", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rleevgvraqdrl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501879", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rleevgvraqdrl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501879", "501879 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rleevgvraqdrl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501879 tested", "501879 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rleevgvraqdrl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501879", "epitope id 501879 tested", "id 501879 tested in", "501879 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_828", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501880", "26495903" ] }, { "record_id": "GLY_001414_1_828", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rleevgvraqdrld is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501880", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rleevgvraqdrld is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501880", "501880 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rleevgvraqdrld is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501880 tested", "501880 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rleevgvraqdrld is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501880", "epitope id 501880 tested", "id 501880 tested in", "501880 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_829", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501975", "26495903" ] }, { "record_id": "GLY_001414_1_829", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqqleevhakveeq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501975", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rqqleevhakveeq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501975", "501975 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rqqleevhakveeq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501975 tested", "501975 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rqqleevhakveeq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501975", "epitope id 501975 tested", "id 501975 tested in", "501975 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_830", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501976", "26495903" ] }, { "record_id": "GLY_001414_1_830", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqqleevhakveeqgn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501976", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rqqleevhakveeqgn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501976", "501976 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rqqleevhakveeqgn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501976 tested", "501976 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rqqleevhakveeqgn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501976", "epitope id 501976 tested", "id 501976 tested in", "501976 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_831", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501977", "26495903" ] }, { "record_id": "GLY_001414_1_831", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqqleevhakveeqgnq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501977", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rqqleevhakveeqgnq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501977", "501977 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rqqleevhakveeqgnq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501977 tested", "501977 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rqqleevhakveeqgnq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501977", "epitope id 501977 tested", "id 501977 tested in", "501977 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_832", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "501978", "26495903" ] }, { "record_id": "GLY_001414_1_832", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rqqleevhakveeqgnqm is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501978", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rqqleevhakveeqgnqm is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501978", "501978 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rqqleevhakveeqgnqm is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501978 tested", "501978 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rqqleevhakveeqgnqm is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501978", "epitope id 501978 tested", "id 501978 tested in", "501978 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_833", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "502062", "26495903" ] }, { "record_id": "GLY_001414_1_833", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rvskelqaaqar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 502062", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rvskelqaaqar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 502062", "502062 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rvskelqaaqar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 502062 tested", "502062 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rvskelqaaqar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 502062", "epitope id 502062 tested", "id 502062 tested in", "502062 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_834", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "503093", "26495903" ] }, { "record_id": "GLY_001414_1_834", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tqarvskelqaaqar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503093", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "tqarvskelqaaqar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503093", "503093 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "tqarvskelqaaqar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503093 tested", "503093 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "tqarvskelqaaqar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503093", "epitope id 503093 tested", "id 503093 tested in", "503093 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_835", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "503094", "26495903" ] }, { "record_id": "GLY_001414_1_835", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tqarvskelqaaqarl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503094", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "tqarvskelqaaqarl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503094", "503094 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "tqarvskelqaaqarl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503094 tested", "503094 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "tqarvskelqaaqarl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503094", "epitope id 503094 tested", "id 503094 tested in", "503094 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_836", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "503095", "26495903" ] }, { "record_id": "GLY_001414_1_836", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tqarvskelqaaqarlg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503095", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "tqarvskelqaaqarlg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503095", "503095 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "tqarvskelqaaqarlg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503095 tested", "503095 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "tqarvskelqaaqarlg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503095", "epitope id 503095 tested", "id 503095 tested in", "503095 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_837", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "503338", "26495903" ] }, { "record_id": "GLY_001414_1_837", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "veeqgnqmrlqaeafqar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503338", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "veeqgnqmrlqaeafqar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503338", "503338 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "veeqgnqmrlqaeafqar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503338 tested", "503338 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "veeqgnqmrlqaeafqar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503338", "epitope id 503338 tested", "id 503338 tested in", "503338 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_838", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q03247", "q03247 1", "841695", "30573663" ] }, { "record_id": "GLY_001414_1_838", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aatlstlagqpller is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 841695", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "aatlstlagqpller is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 841695", "841695 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "aatlstlagqpller is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 841695 tested", "841695 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "aatlstlagqpller is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 841695", "epitope id 841695 tested", "id 841695 tested in", "841695 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_839", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q06154", "q06154 1", "28864", "36608422" ] }, { "record_id": "GLY_001414_1_839", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "itdqvpfsv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 28864", "tested in", "in 105", "105 t", "t cell", "cell assays", "25 mhc", "mhc ligand", "ligand assays", "assays and", "and has", "has 3d", "3d structure", "structure s", "1tvb and", "and 6vm7.", "itdqvpfsv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 28864", "28864 tested", "tested in 105", "in 105 t", "105 t cell", "t cell assays", "assays 25", "25 mhc ligand", "mhc ligand assays", "ligand assays and", "assays and has", "and has 3d", "has 3d structure", "3d structure s", "s 6vma", "6vma 1tvb", "1tvb and 6vm7.", "itdqvpfsv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 28864 tested", "28864 tested in", "tested in 105 t", "in 105 t cell", "105 t cell assays", "cell assays 25", "assays 25 mhc", "25 mhc ligand assays", "mhc ligand assays and", "ligand assays and has", "assays and has 3d", "and has 3d structure", "has 3d structure s", "structure s 6vma", "6vma 1tvb and", "itdqvpfsv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 28864", "epitope id 28864 tested", "id 28864 tested in", "28864 tested in 105", "tested in 105 t cell", "in 105 t cell assays", "t cell assays 25", "cell assays 25 mhc", "assays 25 mhc ligand", "25 mhc ligand assays and", "mhc ligand assays and has", "ligand assays and has 3d", "assays and has 3d structure", "and has 3d structure s", "3d structure s 6vma", "s 6vma 1tvb", "6vma 1tvb and 6vm7." ] }, { "record_id": "GLY_001414_1_840", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q07537", "q07537 1", "531706", "30573663" ] }, { "record_id": "GLY_001414_1_840", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fknffyiispgvtk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 531706", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "fknffyiispgvtk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 531706", "531706 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "fknffyiispgvtk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 531706 tested", "531706 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "fknffyiispgvtk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 531706", "epitope id 531706 tested", "id 531706 tested in", "531706 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_841", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q0vcm6", "q0vcm6 1", "534567", "30573663" ] }, { "record_id": "GLY_001414_1_841", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ypstqfgsltglqsl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 534567", "tested in", "in 13", "13 mhc", "mhc ligand", "ligand assays.", "ypstqfgsltglqsl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 534567", "534567 tested", "tested in 13", "in 13 mhc", "13 mhc ligand", "mhc ligand assays.", "ypstqfgsltglqsl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 534567 tested", "534567 tested in", "tested in 13 mhc", "in 13 mhc ligand", "13 mhc ligand assays.", "ypstqfgsltglqsl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 534567", "epitope id 534567 tested", "id 534567 tested in", "534567 tested in 13", "tested in 13 mhc ligand", "in 13 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_842", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q17q89", "q17q89 1", "648114", "30573663" ] }, { "record_id": "GLY_001414_1_842", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nvvfkllgpvlvkqe is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 648114", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "nvvfkllgpvlvkqe is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 648114", "648114 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "nvvfkllgpvlvkqe is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 648114 tested", "648114 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "nvvfkllgpvlvkqe is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 648114", "epitope id 648114 tested", "id 648114 tested in", "648114 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_843", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q17q89", "q17q89 1", "1873139", "30573663" ] }, { "record_id": "GLY_001414_1_843", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nvvfkllgpvlvk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873139", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "nvvfkllgpvlvk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873139", "1873139 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "nvvfkllgpvlvk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873139 tested", "1873139 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "nvvfkllgpvlvk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873139", "epitope id 1873139 tested", "id 1873139 tested in", "1873139 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_844", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q17qi5", "q17qi5 1", "649277", "30573663" ] }, { "record_id": "GLY_001414_1_844", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rnidlvaqrgerle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 649277", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "rnidlvaqrgerle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 649277", "649277 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "rnidlvaqrgerle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 649277 tested", "649277 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "rnidlvaqrgerle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 649277", "epitope id 649277 tested", "id 649277 tested in", "649277 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_845", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q17ql5", "q17ql5 1", "641959", "30573663" ] }, { "record_id": "GLY_001414_1_845", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "edfivwmrtaalpt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 641959", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "edfivwmrtaalpt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 641959", "641959 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "edfivwmrtaalpt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 641959 tested", "641959 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "edfivwmrtaalpt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 641959", "epitope id 641959 tested", "id 641959 tested in", "641959 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_846", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q17ql5", "q17ql5 1", "1111235", "30573663" ] }, { "record_id": "GLY_001414_1_846", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nedfivwmrtaalpt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1111235", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "nedfivwmrtaalpt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1111235", "1111235 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "nedfivwmrtaalpt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1111235 tested", "1111235 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "nedfivwmrtaalpt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1111235", "epitope id 1111235 tested", "id 1111235 tested in", "1111235 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_847", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q17r06", "q17r06 1", "1132686", "30573663" ] }, { "record_id": "GLY_001414_1_847", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dkhittlqasfltkk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1132686", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "dkhittlqasfltkk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1132686", "1132686 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "dkhittlqasfltkk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1132686 tested", "1132686 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "dkhittlqasfltkk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1132686", "epitope id 1132686 tested", "id 1132686 tested in", "1132686 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_848", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q27955", "q27955 1", "1391192", "30573663" ] }, { "record_id": "GLY_001414_1_848", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "wssmeimeaysvarq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1391192", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "wssmeimeaysvarq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1391192", "1391192 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "wssmeimeaysvarq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1391192 tested", "1391192 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "wssmeimeaysvarq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1391192", "epitope id 1391192 tested", "id 1391192 tested in", "1391192 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_849", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q28133", "q28133 1", "9848", "9973397" ] }, { "record_id": "GLY_001414_1_849", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dqgtclllteva is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 9848", "tested in", "in 2", "2 t", "t cell", "cell assays.", "dqgtclllteva is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 9848", "9848 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "dqgtclllteva is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 9848 tested", "9848 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "dqgtclllteva is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 9848", "epitope id 9848 tested", "id 9848 tested in", "9848 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_850", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q28133", "q28133 1", "13024", "9973397" ] }, { "record_id": "GLY_001414_1_850", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "elekyqqlnsergv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 13024", "tested in", "in 2", "2 t", "t cell", "cell assays.", "elekyqqlnsergv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 13024", "13024 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "elekyqqlnsergv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 13024 tested", "13024 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "elekyqqlnsergv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 13024", "epitope id 13024 tested", "id 13024 tested in", "13024 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_851", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q28133", "q28133 1", "19412", "9973397" ] }, { "record_id": "GLY_001414_1_851", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "geritkmteglak is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 19412", "tested in", "in 2", "2 t", "t cell", "cell assays.", "geritkmteglak is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 19412", "19412 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "geritkmteglak is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 19412 tested", "19412 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "geritkmteglak is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 19412", "epitope id 19412 tested", "id 19412 tested in", "19412 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_852", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q28133", "q28133 1", "47640", "9973397" ] }, { "record_id": "GLY_001414_1_852", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pgewriiyaaadnk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 47640", "tested in", "in 2", "2 t", "t cell", "cell assays.", "pgewriiyaaadnk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 47640", "47640 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "pgewriiyaaadnk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 47640 tested", "47640 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "pgewriiyaaadnk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 47640", "epitope id 47640 tested", "id 47640 tested in", "47640 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_853", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q28133", "q28133 1", "54135", "9973397" ] }, { "record_id": "GLY_001414_1_853", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "riecindc is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 54135", "tested in", "in 2", "2 t", "t cell", "cell assays.", "riecindc is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 54135", "54135 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "riecindc is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 54135 tested", "54135 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "riecindc is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 54135", "epitope id 54135 tested", "id 54135 tested in", "54135 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_854", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q28133", "q28133 1", "67652", "9973397" ] }, { "record_id": "GLY_001414_1_854", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vakrqegyvyvl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 67652", "tested in", "in 2", "2 t", "t cell", "cell assays.", "vakrqegyvyvl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 67652", "67652 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "vakrqegyvyvl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 67652 tested", "67652 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "vakrqegyvyvl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 67652", "epitope id 67652 tested", "id 67652 tested in", "67652 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_855", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q28133", "q28133 1", "70919", "9973397" ] }, { "record_id": "GLY_001414_1_855", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vsenmlvtyv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 70919", "tested in", "in 2", "2 t", "t cell", "cell assays.", "vsenmlvtyv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 70919", "70919 tested", "tested in 2", "in 2 t", "2 t cell", "t cell assays.", "vsenmlvtyv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 70919 tested", "70919 tested in", "tested in 2 t", "in 2 t cell", "2 t cell assays.", "vsenmlvtyv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 70919", "epitope id 70919 tested", "id 70919 tested in", "70919 tested in 2", "tested in 2 t cell", "in 2 t cell assays." ] }, { "record_id": "GLY_001414_1_856", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q28172", "q28172 1", "839009", "17675186" ] }, { "record_id": "GLY_001414_1_856", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "hgywsewspe is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 839009", "tested in", "in 28", "28 b", "b cell", "cell assays.", "hgywsewspe is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 839009", "839009 tested", "tested in 28", "in 28 b", "28 b cell", "b cell assays.", "hgywsewspe is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 839009 tested", "839009 tested in", "tested in 28 b", "in 28 b cell", "28 b cell assays.", "hgywsewspe is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 839009", "epitope id 839009 tested", "id 839009 tested in", "839009 tested in 28", "tested in 28 b cell", "in 28 b cell assays." ] }, { "record_id": "GLY_001414_1_857", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q28175", "q28175 1", "767942", "16379027" ] }, { "record_id": "GLY_001414_1_857", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kvnpetleti is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 767942", "tested in", "in 9", "9 b", "b cell", "cell assays.", "kvnpetleti is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 767942", "767942 tested", "tested in 9", "in 9 b", "9 b cell", "b cell assays.", "kvnpetleti is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 767942 tested", "767942 tested in", "tested in 9 b", "in 9 b cell", "9 b cell assays.", "kvnpetleti is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 767942", "epitope id 767942 tested", "id 767942 tested in", "767942 tested in 9", "tested in 9 b cell", "in 9 b cell assays." ] }, { "record_id": "GLY_001414_1_858", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "131722", "10233671" ] }, { "record_id": "GLY_001414_1_858", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "tvfdnlpnpedrkn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 131722", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "tvfdnlpnpedrkn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 131722", "131722 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "tvfdnlpnpedrkn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 131722 tested", "131722 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "tvfdnlpnpedrkn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 131722", "epitope id 131722 tested", "id 131722 tested in", "131722 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_859", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "156806", "21209280" ] }, { "record_id": "GLY_001414_1_859", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylgddyvram is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 156806", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "ylgddyvram is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 156806", "156806 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "ylgddyvram is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 156806 tested", "156806 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "ylgddyvram is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 156806", "epitope id 156806 tested", "id 156806 tested in", "156806 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_860", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234071", "12391225" ] }, { "record_id": "GLY_001414_1_860", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dvafvkdqtviq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234071", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "dvafvkdqtviq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234071", "234071 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "dvafvkdqtviq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234071 tested", "234071 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "dvafvkdqtviq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234071", "epitope id 234071 tested", "id 234071 tested in", "234071 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_861", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234072", "12391225" ] }, { "record_id": "GLY_001414_1_861", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dvafvkdqtviqn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234072", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "dvafvkdqtviqn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234072", "234072 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "dvafvkdqtviqn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234072 tested", "234072 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "dvafvkdqtviqn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234072", "epitope id 234072 tested", "id 234072 tested in", "234072 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_862", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234073", "12391225" ] }, { "record_id": "GLY_001414_1_862", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dvafvkdqtviqntd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234073", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "dvafvkdqtviqntd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234073", "234073 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "dvafvkdqtviqntd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234073 tested", "234073 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "dvafvkdqtviqntd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234073", "epitope id 234073 tested", "id 234073 tested in", "234073 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_863", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234074", "12391225" ] }, { "record_id": "GLY_001414_1_863", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dvafvkdqtviqntdg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234074", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "dvafvkdqtviqntdg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234074", "234074 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "dvafvkdqtviqntdg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234074 tested", "234074 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "dvafvkdqtviqntdg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234074", "epitope id 234074 tested", "id 234074 tested in", "234074 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_864", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234075", "12391225" ] }, { "record_id": "GLY_001414_1_864", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dvafvkdqtviqntdgn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234075", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "dvafvkdqtviqntdgn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234075", "234075 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "dvafvkdqtviqntdgn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234075 tested", "234075 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "dvafvkdqtviqntdgn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234075", "epitope id 234075 tested", "id 234075 tested in", "234075 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_865", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234106", "12391225" ] }, { "record_id": "GLY_001414_1_865", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gdvafvkdqtviq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234106", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "gdvafvkdqtviq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234106", "234106 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "gdvafvkdqtviq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234106 tested", "234106 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "gdvafvkdqtviq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234106", "epitope id 234106 tested", "id 234106 tested in", "234106 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_866", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234107", "12391225" ] }, { "record_id": "GLY_001414_1_866", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gdvafvkdqtviqn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234107", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "gdvafvkdqtviqn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234107", "234107 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "gdvafvkdqtviqn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234107 tested", "234107 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "gdvafvkdqtviqn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234107", "epitope id 234107 tested", "id 234107 tested in", "234107 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_867", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234108", "12391225" ] }, { "record_id": "GLY_001414_1_867", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gdvafvkdqtviqntd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234108", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "gdvafvkdqtviqntd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234108", "234108 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "gdvafvkdqtviqntd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234108 tested", "234108 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "gdvafvkdqtviqntd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234108", "epitope id 234108 tested", "id 234108 tested in", "234108 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_868", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234109", "12391225" ] }, { "record_id": "GLY_001414_1_868", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gdvafvkdqtviqntdg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234109", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "gdvafvkdqtviqntdg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234109", "234109 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "gdvafvkdqtviqntdg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234109 tested", "234109 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "gdvafvkdqtviqntdg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234109", "epitope id 234109 tested", "id 234109 tested in", "234109 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_869", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234110", "12391225" ] }, { "record_id": "GLY_001414_1_869", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gdvafvkdqtviqntdgn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234110", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "gdvafvkdqtviqntdgn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234110", "234110 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "gdvafvkdqtviqntdgn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234110 tested", "234110 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "gdvafvkdqtviqntdgn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234110", "epitope id 234110 tested", "id 234110 tested in", "234110 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_870", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234111", "12391225" ] }, { "record_id": "GLY_001414_1_870", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gdvafvkdqtviqntdgnn is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234111", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "gdvafvkdqtviqntdgnn is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234111", "234111 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gdvafvkdqtviqntdgnn is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234111 tested", "234111 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "gdvafvkdqtviqntdgnn is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234111", "epitope id 234111 tested", "id 234111 tested in", "234111 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_871", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "234172", "12648094" ] }, { "record_id": "GLY_001414_1_871", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "npqthyyavavvkkdtdf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 234172", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "npqthyyavavvkkdtdf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 234172", "234172 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "npqthyyavavvkkdtdf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 234172 tested", "234172 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "npqthyyavavvkkdtdf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 234172", "epitope id 234172 tested", "id 234172 tested in", "234172 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_872", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "237854", "11801660" ] }, { "record_id": "GLY_001414_1_872", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mvpshavvartvggked is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 237854", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "mvpshavvartvggked is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 237854", "237854 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "mvpshavvartvggked is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 237854 tested", "237854 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "mvpshavvartvggked is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 237854", "epitope id 237854 tested", "id 237854 tested in", "237854 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_873", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "237854", "26495903" ] }, { "record_id": "GLY_001414_1_873", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mvpshavvartvggked is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 237854", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "mvpshavvartvggked is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 237854", "237854 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "mvpshavvartvggked is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 237854 tested", "237854 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "mvpshavvartvggked is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 237854", "epitope id 237854 tested", "id 237854 tested in", "237854 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_874", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "419148", "8315383" ] }, { "record_id": "GLY_001414_1_874", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dviwellnhaqeh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 419148", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "dviwellnhaqeh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 419148", "419148 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "dviwellnhaqeh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 419148 tested", "419148 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "dviwellnhaqeh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 419148", "epitope id 419148 tested", "id 419148 tested in", "419148 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_875", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "419149", "8315383" ] }, { "record_id": "GLY_001414_1_875", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dviwellnhaqehfg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 419149", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dviwellnhaqehfg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 419149", "419149 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dviwellnhaqehfg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 419149 tested", "419149 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dviwellnhaqehfg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 419149", "epitope id 419149 tested", "id 419149 tested in", "419149 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_876", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "441846", "18512783" ] }, { "record_id": "GLY_001414_1_876", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylgyeyvtalqnlres is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 441846", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ylgyeyvtalqnlres is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 441846", "441846 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ylgyeyvtalqnlres is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 441846 tested", "441846 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ylgyeyvtalqnlres is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 441846", "epitope id 441846 tested", "id 441846 tested in", "441846 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_877", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "497397", "26495903" ] }, { "record_id": "GLY_001414_1_877", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "amvpshavvartvggked is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497397", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "amvpshavvartvggked is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497397", "497397 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "amvpshavvartvggked is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497397 tested", "497397 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "amvpshavvartvggked is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497397", "epitope id 497397 tested", "id 497397 tested in", "497397 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_878", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500124", "26495903" ] }, { "record_id": "GLY_001414_1_878", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kdtdfklnelrgkk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500124", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "kdtdfklnelrgkk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500124", "500124 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "kdtdfklnelrgkk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500124 tested", "500124 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "kdtdfklnelrgkk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500124", "epitope id 500124 tested", "id 500124 tested in", "500124 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_879", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500125", "26495903" ] }, { "record_id": "GLY_001414_1_879", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kdtdfklnelrgkks is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500125", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "kdtdfklnelrgkks is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500125", "500125 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "kdtdfklnelrgkks is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500125 tested", "500125 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "kdtdfklnelrgkks is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500125", "epitope id 500125 tested", "id 500125 tested in", "500125 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_880", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500269", "26495903" ] }, { "record_id": "GLY_001414_1_880", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kkdtdfklnelrgkk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500269", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "kkdtdfklnelrgkk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500269", "500269 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "kkdtdfklnelrgkk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500269 tested", "500269 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "kkdtdfklnelrgkk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500269", "epitope id 500269 tested", "id 500269 tested in", "500269 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_881", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500270", "26495903" ] }, { "record_id": "GLY_001414_1_881", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kkdtdfklnelrgkks is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500270", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "kkdtdfklnelrgkks is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500270", "500270 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "kkdtdfklnelrgkks is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500270 tested", "500270 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "kkdtdfklnelrgkks is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500270", "epitope id 500270 tested", "id 500270 tested in", "500270 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_882", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500408", "26495903" ] }, { "record_id": "GLY_001414_1_882", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kpnnlkpvvaefhg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500408", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kpnnlkpvvaefhg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500408", "500408 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kpnnlkpvvaefhg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500408 tested", "500408 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kpnnlkpvvaefhg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500408", "epitope id 500408 tested", "id 500408 tested in", "500408 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_883", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500409", "26495903" ] }, { "record_id": "GLY_001414_1_883", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kpnnlkpvvaefhgt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500409", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kpnnlkpvvaefhgt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500409", "500409 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kpnnlkpvvaefhgt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500409 tested", "500409 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kpnnlkpvvaefhgt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500409", "epitope id 500409 tested", "id 500409 tested in", "500409 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_884", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500410", "26495903" ] }, { "record_id": "GLY_001414_1_884", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kpnnlkpvvaefhgtk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500410", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kpnnlkpvvaefhgtk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500410", "500410 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kpnnlkpvvaefhgtk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500410 tested", "500410 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kpnnlkpvvaefhgtk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500410", "epitope id 500410 tested", "id 500410 tested in", "500410 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_885", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500411", "26495903" ] }, { "record_id": "GLY_001414_1_885", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kpnnlkpvvaefhgtkd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500411", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kpnnlkpvvaefhgtkd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500411", "500411 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kpnnlkpvvaefhgtkd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500411 tested", "500411 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kpnnlkpvvaefhgtkd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500411", "epitope id 500411 tested", "id 500411 tested in", "500411 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_886", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500670", "26495903" ] }, { "record_id": "GLY_001414_1_886", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lamvpshavvartvggk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500670", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lamvpshavvartvggk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500670", "500670 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lamvpshavvartvggk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500670 tested", "500670 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lamvpshavvartvggk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500670", "epitope id 500670 tested", "id 500670 tested in", "500670 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_887", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500671", "26495903" ] }, { "record_id": "GLY_001414_1_887", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lamvpshavvartvggke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500671", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lamvpshavvartvggke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500671", "500671 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lamvpshavvartvggke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500671 tested", "500671 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lamvpshavvartvggke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500671", "epitope id 500671 tested", "id 500671 tested in", "500671 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_888", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500831", "26495903" ] }, { "record_id": "GLY_001414_1_888", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lkpnnlkpvvaefhgtk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500831", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lkpnnlkpvvaefhgtk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500831", "500831 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lkpnnlkpvvaefhgtk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500831 tested", "500831 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lkpnnlkpvvaefhgtk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500831", "epitope id 500831 tested", "id 500831 tested in", "500831 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_889", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500832", "26495903" ] }, { "record_id": "GLY_001414_1_889", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lkpnnlkpvvaefhgtkd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500832", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lkpnnlkpvvaefhgtkd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500832", "500832 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lkpnnlkpvvaefhgtkd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500832 tested", "500832 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lkpnnlkpvvaefhgtkd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500832", "epitope id 500832 tested", "id 500832 tested in", "500832 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_890", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500833", "26495903" ] }, { "record_id": "GLY_001414_1_890", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lkpvvaefhgtk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500833", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lkpvvaefhgtk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500833", "500833 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lkpvvaefhgtk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500833 tested", "500833 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lkpvvaefhgtk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500833", "epitope id 500833 tested", "id 500833 tested in", "500833 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_891", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "500834", "26495903" ] }, { "record_id": "GLY_001414_1_891", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lkpvvaefhgtkd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500834", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lkpvvaefhgtkd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500834", "500834 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lkpvvaefhgtkd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500834 tested", "500834 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lkpvvaefhgtkd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500834", "epitope id 500834 tested", "id 500834 tested in", "500834 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_892", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "501199", "26495903" ] }, { "record_id": "GLY_001414_1_892", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mvpshavvartvg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501199", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "mvpshavvartvg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501199", "501199 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "mvpshavvartvg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501199 tested", "501199 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "mvpshavvartvg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501199", "epitope id 501199 tested", "id 501199 tested in", "501199 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_893", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "501202", "26495903" ] }, { "record_id": "GLY_001414_1_893", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mvpshavvartvggke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501202", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "mvpshavvartvggke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501202", "501202 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "mvpshavvartvggke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501202 tested", "501202 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "mvpshavvartvggke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501202", "epitope id 501202 tested", "id 501202 tested in", "501202 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_894", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "501203", "26495903" ] }, { "record_id": "GLY_001414_1_894", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "mvpshavvartvggkedv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501203", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "mvpshavvartvggkedv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501203", "501203 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "mvpshavvartvggkedv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501203 tested", "501203 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "mvpshavvartvggkedv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501203", "epitope id 501203 tested", "id 501203 tested in", "501203 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_895", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "501301", "26495903" ] }, { "record_id": "GLY_001414_1_895", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "nlkpvvaefhgtk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501301", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "nlkpvvaefhgtk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501301", "501301 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "nlkpvvaefhgtk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501301 tested", "501301 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "nlkpvvaefhgtk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501301", "epitope id 501301 tested", "id 501301 tested in", "501301 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_896", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "503557", "26495903" ] }, { "record_id": "GLY_001414_1_896", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpshavvartvg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503557", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vpshavvartvg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503557", "503557 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vpshavvartvg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503557 tested", "503557 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vpshavvartvg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503557", "epitope id 503557 tested", "id 503557 tested in", "503557 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_897", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "503558", "26495903" ] }, { "record_id": "GLY_001414_1_897", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpshavvartvgg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503558", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vpshavvartvgg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503558", "503558 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vpshavvartvgg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503558 tested", "503558 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vpshavvartvgg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503558", "epitope id 503558 tested", "id 503558 tested in", "503558 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_898", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "503559", "26495903" ] }, { "record_id": "GLY_001414_1_898", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpshavvartvggk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503559", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vpshavvartvggk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503559", "503559 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vpshavvartvggk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503559 tested", "503559 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vpshavvartvggk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503559", "epitope id 503559 tested", "id 503559 tested in", "503559 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_899", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "503560", "26495903" ] }, { "record_id": "GLY_001414_1_899", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpshavvartvggke is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503560", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vpshavvartvggke is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503560", "503560 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vpshavvartvggke is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503560 tested", "503560 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vpshavvartvggke is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503560", "epitope id 503560 tested", "id 503560 tested in", "503560 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_900", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "503561", "26495903" ] }, { "record_id": "GLY_001414_1_900", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpshavvartvggked is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503561", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vpshavvartvggked is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503561", "503561 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vpshavvartvggked is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503561 tested", "503561 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vpshavvartvggked is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503561", "epitope id 503561 tested", "id 503561 tested in", "503561 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_901", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "789783", "30573663" ] }, { "record_id": "GLY_001414_1_901", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "envlrilesgpfvs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 789783", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "envlrilesgpfvs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 789783", "789783 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "envlrilesgpfvs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 789783 tested", "789783 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "envlrilesgpfvs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 789783", "epitope id 789783 tested", "id 789783 tested in", "789783 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_902", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "1874029", "30573663" ] }, { "record_id": "GLY_001414_1_902", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylamvpshavvar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1874029", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ylamvpshavvar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1874029", "1874029 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ylamvpshavvar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1874029 tested", "1874029 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ylamvpshavvar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1874029", "epitope id 1874029 tested", "id 1874029 tested in", "1874029 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_903", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q29443", "q29443 1", "1874031", "30573663" ] }, { "record_id": "GLY_001414_1_903", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ylamvpshavvart is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1874031", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ylamvpshavvart is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1874031", "1874031 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ylamvpshavvart is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1874031 tested", "1874031 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ylamvpshavvart is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1874031", "epitope id 1874031 tested", "id 1874031 tested in", "1874031 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_904", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2hjg5", "q2hjg5 1", "531601", "30573663" ] }, { "record_id": "GLY_001414_1_904", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "erqelrilvgtnlvr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 531601", "tested in", "in 9", "9 mhc", "mhc ligand", "ligand assays.", "erqelrilvgtnlvr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 531601", "531601 tested", "tested in 9", "in 9 mhc", "9 mhc ligand", "mhc ligand assays.", "erqelrilvgtnlvr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 531601 tested", "531601 tested in", "tested in 9 mhc", "in 9 mhc ligand", "9 mhc ligand assays.", "erqelrilvgtnlvr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 531601", "epitope id 531601 tested", "id 531601 tested in", "531601 tested in 9", "tested in 9 mhc ligand", "in 9 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_905", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kiu3", "q2kiu3 1", "1870978", "30573663" ] }, { "record_id": "GLY_001414_1_905", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "akdnyrhlsgnvvlq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1870978", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "akdnyrhlsgnvvlq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1870978", "1870978 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "akdnyrhlsgnvvlq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1870978 tested", "1870978 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "akdnyrhlsgnvvlq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1870978", "epitope id 1870978 tested", "id 1870978 tested in", "1870978 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_906", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kiw6", "q2kiw6 1", "845575", "30573663" ] }, { "record_id": "GLY_001414_1_906", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ivdkyigesarlire is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 845575", "tested in", "in 10", "10 mhc", "mhc ligand", "ligand assays.", "ivdkyigesarlire is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 845575", "845575 tested", "tested in 10", "in 10 mhc", "10 mhc ligand", "mhc ligand assays.", "ivdkyigesarlire is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 845575 tested", "845575 tested in", "tested in 10 mhc", "in 10 mhc ligand", "10 mhc ligand assays.", "ivdkyigesarlire is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 845575", "epitope id 845575 tested", "id 845575 tested in", "845575 tested in 10", "tested in 10 mhc ligand", "in 10 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_907", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kiw6", "q2kiw6 1", "1236826", "30573663" ] }, { "record_id": "GLY_001414_1_907", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ivdkyigesarlir is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1236826", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "ivdkyigesarlir is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1236826", "1236826 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "ivdkyigesarlir is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1236826 tested", "1236826 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "ivdkyigesarlir is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1236826", "epitope id 1236826 tested", "id 1236826 tested in", "1236826 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_908", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kja1", "q2kja1 1", "1599355", "30573663" ] }, { "record_id": "GLY_001414_1_908", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "artieylqpnpasr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1599355", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "artieylqpnpasr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1599355", "1599355 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "artieylqpnpasr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1599355 tested", "1599355 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "artieylqpnpasr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1599355", "epitope id 1599355 tested", "id 1599355 tested in", "1599355 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_909", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kja1", "q2kja1 1", "1599356", "30573663" ] }, { "record_id": "GLY_001414_1_909", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "artieylqpnpasra is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1599356", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "artieylqpnpasra is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1599356", "1599356 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "artieylqpnpasra is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1599356 tested", "1599356 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "artieylqpnpasra is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1599356", "epitope id 1599356 tested", "id 1599356 tested in", "1599356 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_910", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kja1", "q2kja1 1", "1611834", "30573663" ] }, { "record_id": "GLY_001414_1_910", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lartieylqpnpasr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1611834", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "lartieylqpnpasr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1611834", "1611834 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "lartieylqpnpasr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1611834 tested", "1611834 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "lartieylqpnpasr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1611834", "epitope id 1611834 tested", "id 1611834 tested in", "1611834 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_911", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kjf1", "q2kjf1 1", "497255", "26495903" ] }, { "record_id": "GLY_001414_1_911", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ageeeplavawsthgpa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 497255", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ageeeplavawsthgpa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 497255", "497255 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ageeeplavawsthgpa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 497255 tested", "497255 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ageeeplavawsthgpa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 497255", "epitope id 497255 tested", "id 497255 tested in", "497255 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_912", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kjf1", "q2kjf1 1", "499005", "26495903" ] }, { "record_id": "GLY_001414_1_912", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gaeeqlvprastspd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499005", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "gaeeqlvprastspd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499005", "499005 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gaeeqlvprastspd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499005 tested", "499005 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "gaeeqlvprastspd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499005", "epitope id 499005 tested", "id 499005 tested in", "499005 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_913", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kjf1", "q2kjf1 1", "499006", "26495903" ] }, { "record_id": "GLY_001414_1_913", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gaeeqlvprastspdr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 499006", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "gaeeqlvprastspdr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 499006", "499006 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "gaeeqlvprastspdr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 499006 tested", "499006 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "gaeeqlvprastspdr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 499006", "epitope id 499006 tested", "id 499006 tested in", "499006 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_914", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kjf1", "q2kjf1 1", "501018", "26495903" ] }, { "record_id": "GLY_001414_1_914", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lrageeeplavawsthgpa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501018", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lrageeeplavawsthgpa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501018", "501018 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lrageeeplavawsthgpa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501018 tested", "501018 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lrageeeplavawsthgpa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501018", "epitope id 501018 tested", "id 501018 tested in", "501018 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_915", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kjf1", "q2kjf1 1", "501729", "26495903" ] }, { "record_id": "GLY_001414_1_915", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rageeeplavawsth is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501729", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rageeeplavawsth is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501729", "501729 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rageeeplavawsth is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501729 tested", "501729 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rageeeplavawsth is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501729", "epitope id 501729 tested", "id 501729 tested in", "501729 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_916", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kjf1", "q2kjf1 1", "501730", "26495903" ] }, { "record_id": "GLY_001414_1_916", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rageeeplavawsthg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501730", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rageeeplavawsthg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501730", "501730 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rageeeplavawsthg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501730 tested", "501730 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rageeeplavawsthg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501730", "epitope id 501730 tested", "id 501730 tested in", "501730 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_917", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kjf1", "q2kjf1 1", "501731", "26495903" ] }, { "record_id": "GLY_001414_1_917", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rageeeplavawsthgpa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501731", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "rageeeplavawsthgpa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501731", "501731 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "rageeeplavawsthgpa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501731 tested", "501731 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "rageeeplavawsthgpa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501731", "epitope id 501731 tested", "id 501731 tested in", "501731 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_918", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2kjh9", "q2kjh9 1", "502246", "26495903" ] }, { "record_id": "GLY_001414_1_918", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sgekevnlavqdaka is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 502246", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "sgekevnlavqdaka is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 502246", "502246 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "sgekevnlavqdaka is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 502246 tested", "502246 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "sgekevnlavqdaka is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 502246", "epitope id 502246 tested", "id 502246 tested in", "502246 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_919", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2uvx4", "q2uvx4 1", "498788", "26495903" ] }, { "record_id": "GLY_001414_1_919", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eseetvvleahggqg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 498788", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "eseetvvleahggqg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 498788", "498788 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eseetvvleahggqg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 498788 tested", "498788 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "eseetvvleahggqg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 498788", "epitope id 498788 tested", "id 498788 tested in", "498788 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_920", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2uvx4", "q2uvx4 1", "502196", "26495903" ] }, { "record_id": "GLY_001414_1_920", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "seetvvleahggqg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 502196", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "seetvvleahggqg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 502196", "502196 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "seetvvleahggqg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 502196 tested", "502196 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "seetvvleahggqg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 502196", "epitope id 502196 tested", "id 502196 tested in", "502196 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_921", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2uvx4", "q2uvx4 1", "847573", "30573663" ] }, { "record_id": "GLY_001414_1_921", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "npmysmitpnilr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 847573", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "npmysmitpnilr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 847573", "847573 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "npmysmitpnilr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 847573 tested", "847573 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "npmysmitpnilr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 847573", "epitope id 847573 tested", "id 847573 tested in", "847573 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_922", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q2uvx4", "q2uvx4 1", "1873101", "30573663" ] }, { "record_id": "GLY_001414_1_922", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "npmysmitpnilrle is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873101", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "npmysmitpnilrle is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873101", "1873101 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "npmysmitpnilrle is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873101 tested", "1873101 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "npmysmitpnilrle is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873101", "epitope id 1873101 tested", "id 1873101 tested in", "1873101 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_923", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32ky0", "q32ky0 1", "500095", "26495903" ] }, { "record_id": "GLY_001414_1_923", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kdiltsnnievekm is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500095", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kdiltsnnievekm is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500095", "500095 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kdiltsnnievekm is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500095 tested", "500095 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kdiltsnnievekm is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500095", "epitope id 500095 tested", "id 500095 tested in", "500095 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_924", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32ky0", "q32ky0 1", "500096", "26495903" ] }, { "record_id": "GLY_001414_1_924", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kdiltsnnievekmt is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 500096", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kdiltsnnievekmt is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 500096", "500096 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kdiltsnnievekmt is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 500096 tested", "500096 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kdiltsnnievekmt is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 500096", "epitope id 500096 tested", "id 500096 tested in", "500096 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_925", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32l40", "q32l40 1", "689728", "30573663" ] }, { "record_id": "GLY_001414_1_925", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ddelilikntkar is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 689728", "tested in", "in 6", "6 mhc", "mhc ligand", "ligand assays.", "ddelilikntkar is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 689728", "689728 tested", "tested in 6", "in 6 mhc", "6 mhc ligand", "mhc ligand assays.", "ddelilikntkar is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 689728 tested", "689728 tested in", "tested in 6 mhc", "in 6 mhc ligand", "6 mhc ligand assays.", "ddelilikntkar is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 689728", "epitope id 689728 tested", "id 689728 tested in", "689728 tested in 6", "tested in 6 mhc ligand", "in 6 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_926", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32l40", "q32l40 1", "1872816", "30573663" ] }, { "record_id": "GLY_001414_1_926", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lkyfveagamavrr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872816", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "lkyfveagamavrr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872816", "1872816 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "lkyfveagamavrr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872816 tested", "1872816 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "lkyfveagamavrr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872816", "epitope id 1872816 tested", "id 1872816 tested in", "1872816 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_927", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32l40", "q32l40 1", "1872817", "30573663" ] }, { "record_id": "GLY_001414_1_927", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lkyfveagamavrrv is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872817", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lkyfveagamavrrv is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872817", "1872817 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lkyfveagamavrrv is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872817 tested", "1872817 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lkyfveagamavrrv is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872817", "epitope id 1872817 tested", "id 1872817 tested in", "1872817 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_928", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32lb7", "q32lb7 1", "530711", "30573663" ] }, { "record_id": "GLY_001414_1_928", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aeeefniekgrlvq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 530711", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "aeeefniekgrlvq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 530711", "530711 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "aeeefniekgrlvq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 530711 tested", "530711 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "aeeefniekgrlvq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 530711", "epitope id 530711 tested", "id 530711 tested in", "530711 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_929", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32lb7", "q32lb7 1", "531459", "30573663" ] }, { "record_id": "GLY_001414_1_929", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eefniekgrlvq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 531459", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "eefniekgrlvq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 531459", "531459 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "eefniekgrlvq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 531459 tested", "531459 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "eefniekgrlvq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 531459", "epitope id 531459 tested", "id 531459 tested in", "531459 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_930", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32lb7", "q32lb7 1", "531460", "30573663" ] }, { "record_id": "GLY_001414_1_930", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eefniekgrlvqtq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 531460", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "eefniekgrlvqtq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 531460", "531460 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "eefniekgrlvqtq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 531460 tested", "531460 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "eefniekgrlvqtq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 531460", "epitope id 531460 tested", "id 531460 tested in", "531460 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_931", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32lb7", "q32lb7 1", "1871361", "30573663" ] }, { "record_id": "GLY_001414_1_931", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "eefniekgrlvqtqr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871361", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "eefniekgrlvqtqr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871361", "1871361 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "eefniekgrlvqtqr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871361 tested", "1871361 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "eefniekgrlvqtqr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871361", "epitope id 1871361 tested", "id 1871361 tested in", "1871361 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_932", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q32pd5", "q32pd5 1", "1618436", "30573663" ] }, { "record_id": "GLY_001414_1_932", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rrvlqaleglkmvek is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1618436", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "rrvlqaleglkmvek is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1618436", "1618436 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "rrvlqaleglkmvek is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1618436 tested", "1618436 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "rrvlqaleglkmvek is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1618436", "epitope id 1618436 tested", "id 1618436 tested in", "1618436 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_933", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3mhw6", "q3mhw6 1", "1872330", "30573663" ] }, { "record_id": "GLY_001414_1_933", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ilafvdmvarpsmg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872330", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "ilafvdmvarpsmg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872330", "1872330 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "ilafvdmvarpsmg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872330 tested", "1872330 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "ilafvdmvarpsmg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872330", "epitope id 1872330 tested", "id 1872330 tested in", "1872330 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_934", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3mhw6", "q3mhw6 1", "1872691", "30573663" ] }, { "record_id": "GLY_001414_1_934", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lafvdmvarpsmg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872691", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "lafvdmvarpsmg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872691", "1872691 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "lafvdmvarpsmg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872691 tested", "1872691 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "lafvdmvarpsmg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872691", "epitope id 1872691 tested", "id 1872691 tested in", "1872691 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_935", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3sx14", "q3sx14 1", "502057", "26495903" ] }, { "record_id": "GLY_001414_1_935", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rvlraqpvqvaegsepd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 502057", "tested in", "in 9", "9 mhc", "mhc ligand", "ligand assays.", "rvlraqpvqvaegsepd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 502057", "502057 tested", "tested in 9", "in 9 mhc", "9 mhc ligand", "mhc ligand assays.", "rvlraqpvqvaegsepd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 502057 tested", "502057 tested in", "tested in 9 mhc", "in 9 mhc ligand", "9 mhc ligand assays.", "rvlraqpvqvaegsepd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 502057", "epitope id 502057 tested", "id 502057 tested in", "502057 tested in 9", "tested in 9 mhc ligand", "in 9 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_936", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3sx14", "q3sx14 1", "503460", "26495903" ] }, { "record_id": "GLY_001414_1_936", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vlraqpvqvaegsepd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 503460", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "vlraqpvqvaegsepd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 503460", "503460 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "vlraqpvqvaegsepd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 503460 tested", "503460 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "vlraqpvqvaegsepd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 503460", "epitope id 503460 tested", "id 503460 tested in", "503460 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_937", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3sz57", "q3sz57 1", "843448", "30573663" ] }, { "record_id": "GLY_001414_1_937", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "elekyiqesqalakr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 843448", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "elekyiqesqalakr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 843448", "843448 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "elekyiqesqalakr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 843448 tested", "843448 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "elekyiqesqalakr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 843448", "epitope id 843448 tested", "id 843448 tested in", "843448 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_938", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3sz57", "q3sz57 1", "844519", "30573663" ] }, { "record_id": "GLY_001414_1_938", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gprtfraitvtkvs is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 844519", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "gprtfraitvtkvs is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 844519", "844519 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "gprtfraitvtkvs is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 844519 tested", "844519 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "gprtfraitvtkvs is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 844519", "epitope id 844519 tested", "id 844519 tested in", "844519 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_939", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3sz57", "q3sz57 1", "1872742", "30573663" ] }, { "record_id": "GLY_001414_1_939", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lekyiqesqalakr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872742", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lekyiqesqalakr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872742", "1872742 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lekyiqesqalakr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872742 tested", "1872742 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lekyiqesqalakr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872742", "epitope id 1872742 tested", "id 1872742 tested in", "1872742 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_940", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3szr3", "q3szr3 1", "1872383", "30573663" ] }, { "record_id": "GLY_001414_1_940", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "iqaaffyleprhaed is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872383", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "iqaaffyleprhaed is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872383", "1872383 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "iqaaffyleprhaed is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872383 tested", "1872383 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "iqaaffyleprhaed is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872383", "epitope id 1872383 tested", "id 1872383 tested in", "1872383 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_941", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3szv7", "q3szv7 1", "849228", "30573663" ] }, { "record_id": "GLY_001414_1_941", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ssqlyimagqklwr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 849228", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "ssqlyimagqklwr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 849228", "849228 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "ssqlyimagqklwr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 849228 tested", "849228 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "ssqlyimagqklwr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 849228", "epitope id 849228 tested", "id 849228 tested in", "849228 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_942", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3t052", "q3t052 1", "783700", "30573663" ] }, { "record_id": "GLY_001414_1_942", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "apsvilplpgqsvdr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 783700", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "apsvilplpgqsvdr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 783700", "783700 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "apsvilplpgqsvdr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 783700 tested", "783700 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "apsvilplpgqsvdr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 783700", "epitope id 783700 tested", "id 783700 tested in", "783700 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_943", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3t052", "q3t052 1", "1872987", "30573663" ] }, { "record_id": "GLY_001414_1_943", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lvyeellarhlg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872987", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "lvyeellarhlg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872987", "1872987 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "lvyeellarhlg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872987 tested", "1872987 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "lvyeellarhlg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872987", "epitope id 1872987 tested", "id 1872987 tested in", "1872987 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_944", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3t0d5", "q3t0d5 1", "845212", "30573663" ] }, { "record_id": "GLY_001414_1_944", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ieyyamlaktgvhh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 845212", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "ieyyamlaktgvhh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 845212", "845212 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "ieyyamlaktgvhh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 845212 tested", "845212 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "ieyyamlaktgvhh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 845212", "epitope id 845212 tested", "id 845212 tested in", "845212 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_945", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3t0p6", "q3t0p6 1", "531790", "30573663" ] }, { "record_id": "GLY_001414_1_945", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "gaslellegkvlpg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 531790", "tested in", "in 5", "5 mhc", "mhc ligand", "ligand assays.", "gaslellegkvlpg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 531790", "531790 tested", "tested in 5", "in 5 mhc", "5 mhc ligand", "mhc ligand assays.", "gaslellegkvlpg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 531790 tested", "531790 tested in", "tested in 5 mhc", "in 5 mhc ligand", "5 mhc ligand assays.", "gaslellegkvlpg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 531790", "epitope id 531790 tested", "id 531790 tested in", "531790 tested in 5", "tested in 5 mhc ligand", "in 5 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_946", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3t0p6", "q3t0p6 1", "533541", "30573663" ] }, { "record_id": "GLY_001414_1_946", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "rpflailggakvadk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 533541", "tested in", "in 17", "17 mhc", "mhc ligand", "ligand assays.", "rpflailggakvadk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 533541", "533541 tested", "tested in 17", "in 17 mhc", "17 mhc ligand", "mhc ligand assays.", "rpflailggakvadk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 533541 tested", "533541 tested in", "tested in 17 mhc", "in 17 mhc ligand", "17 mhc ligand assays.", "rpflailggakvadk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 533541", "epitope id 533541 tested", "id 533541 tested in", "533541 tested in 17", "tested in 17 mhc ligand", "in 17 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_947", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3t0p6", "q3t0p6 1", "646317", "30573663" ] }, { "record_id": "GLY_001414_1_947", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "lailggakvadk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 646317", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "lailggakvadk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 646317", "646317 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "lailggakvadk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 646317 tested", "646317 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "lailggakvadk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 646317", "epitope id 646317 tested", "id 646317 tested in", "646317 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_948", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3t0p6", "q3t0p6 1", "1219614", "30573663" ] }, { "record_id": "GLY_001414_1_948", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ggaslellegkvlpg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1219614", "tested in", "in 4", "4 mhc", "mhc ligand", "ligand assays.", "ggaslellegkvlpg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1219614", "1219614 tested", "tested in 4", "in 4 mhc", "4 mhc ligand", "mhc ligand assays.", "ggaslellegkvlpg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1219614 tested", "1219614 tested in", "tested in 4 mhc", "in 4 mhc ligand", "4 mhc ligand assays.", "ggaslellegkvlpg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1219614", "epitope id 1219614 tested", "id 1219614 tested in", "1219614 tested in 4", "tested in 4 mhc ligand", "in 4 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_949", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3zch9", "q3zch9 1", "194261", "22544926" ] }, { "record_id": "GLY_001414_1_949", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ralpdfkgi is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 194261", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ralpdfkgi is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 194261", "194261 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ralpdfkgi is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 194261 tested", "194261 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ralpdfkgi is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 194261", "epitope id 194261 tested", "id 194261 tested in", "194261 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_950", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3zcl3", "q3zcl3 1", "1873918", "30573663" ] }, { "record_id": "GLY_001414_1_950", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpyelqkgqalit is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873918", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vpyelqkgqalit is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873918", "1873918 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vpyelqkgqalit is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873918 tested", "1873918 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vpyelqkgqalit is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873918", "epitope id 1873918 tested", "id 1873918 tested in", "1873918 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_951", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3zcl3", "q3zcl3 1", "1873919", "30573663" ] }, { "record_id": "GLY_001414_1_951", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpyelqkgqalitf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873919", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vpyelqkgqalitf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873919", "1873919 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vpyelqkgqalitf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873919 tested", "1873919 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vpyelqkgqalitf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873919", "epitope id 1873919 tested", "id 1873919 tested in", "1873919 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_952", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q3zcl3", "q3zcl3 1", "1873920", "30573663" ] }, { "record_id": "GLY_001414_1_952", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vpyelqkgqalitfe is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873920", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vpyelqkgqalitfe is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873920", "1873920 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vpyelqkgqalitfe is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873920 tested", "1873920 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vpyelqkgqalitfe is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873920", "epitope id 1873920 tested", "id 1873920 tested in", "1873920 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_953", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q56k14", "q56k14 1", "1233793", "30573663" ] }, { "record_id": "GLY_001414_1_953", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "inalikaagvnvepf is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1233793", "tested in", "in 7", "7 mhc", "mhc ligand", "ligand assays.", "inalikaagvnvepf is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1233793", "1233793 tested", "tested in 7", "in 7 mhc", "7 mhc ligand", "mhc ligand assays.", "inalikaagvnvepf is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1233793 tested", "1233793 tested in", "tested in 7 mhc", "in 7 mhc ligand", "7 mhc ligand assays.", "inalikaagvnvepf is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1233793", "epitope id 1233793 tested", "id 1233793 tested in", "1233793 tested in 7", "tested in 7 mhc ligand", "in 7 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_954", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q5ea36", "q5ea36 1", "1114000", "30573663" ] }, { "record_id": "GLY_001414_1_954", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "raiealhghelrpg is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1114000", "tested in", "in 9", "9 mhc", "mhc ligand", "ligand assays.", "raiealhghelrpg is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1114000", "1114000 tested", "tested in 9", "in 9 mhc", "9 mhc ligand", "mhc ligand assays.", "raiealhghelrpg is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1114000 tested", "1114000 tested in", "tested in 9 mhc", "in 9 mhc ligand", "9 mhc ligand assays.", "raiealhghelrpg is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1114000", "epitope id 1114000 tested", "id 1114000 tested in", "1114000 tested in 9", "tested in 9 mhc ligand", "in 9 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_955", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q76lu5", "q76lu5 1", "1872516", "30573663" ] }, { "record_id": "GLY_001414_1_955", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kiiniltkqlkrk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872516", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kiiniltkqlkrk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872516", "1872516 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kiiniltkqlkrk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872516 tested", "1872516 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kiiniltkqlkrk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872516", "epitope id 1872516 tested", "id 1872516 tested in", "1872516 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_956", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q7sih1", "q7sih1 1", "1608456", "30573663" ] }, { "record_id": "GLY_001414_1_956", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ipvrdlkpaivk is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1608456", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "ipvrdlkpaivk is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1608456", "1608456 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "ipvrdlkpaivk is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1608456 tested", "1608456 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "ipvrdlkpaivk is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1608456", "epitope id 1608456 tested", "id 1608456 tested in", "1608456 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_957", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q7sih1", "q7sih1 1", "1610764", "30573663" ] }, { "record_id": "GLY_001414_1_957", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kpiykpeqtvkfr is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1610764", "tested in", "in 3", "3 mhc", "mhc ligand", "ligand assays.", "kpiykpeqtvkfr is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1610764", "1610764 tested", "tested in 3", "in 3 mhc", "3 mhc ligand", "mhc ligand assays.", "kpiykpeqtvkfr is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1610764 tested", "1610764 tested in", "tested in 3 mhc", "in 3 mhc ligand", "3 mhc ligand assays.", "kpiykpeqtvkfr is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1610764", "epitope id 1610764 tested", "id 1610764 tested in", "1610764 tested in 3", "tested in 3 mhc ligand", "in 3 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_958", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q7sih1", "q7sih1 1", "1620692", "30573663" ] }, { "record_id": "GLY_001414_1_958", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "stkfqvensnrll is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1620692", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "stkfqvensnrll is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1620692", "1620692 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "stkfqvensnrll is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1620692 tested", "1620692 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "stkfqvensnrll is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1620692", "epitope id 1620692 tested", "id 1620692 tested in", "1620692 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_959", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q7sih1", "q7sih1 1", "1872472", "30573663" ] }, { "record_id": "GLY_001414_1_959", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "kdmysflqdmglka is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1872472", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "kdmysflqdmglka is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1872472", "1872472 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "kdmysflqdmglka is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1872472 tested", "1872472 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "kdmysflqdmglka is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1872472", "epitope id 1872472 tested", "id 1872472 tested in", "1872472 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_960", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q7yrx0", "q7yrx0 1", "1870868", "30573663" ] }, { "record_id": "GLY_001414_1_960", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aaprlpevpa is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1870868", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "aaprlpevpa is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1870868", "1870868 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "aaprlpevpa is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1870868 tested", "1870868 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "aaprlpevpa is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1870868", "epitope id 1870868 tested", "id 1870868 tested in", "1870868 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_961", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q8spf8", "q8spf8 1", "501071", "26495903" ] }, { "record_id": "GLY_001414_1_961", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ltkealvvtqas is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 501071", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "ltkealvvtqas is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 501071", "501071 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "ltkealvvtqas is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 501071 tested", "501071 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "ltkealvvtqas is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 501071", "epitope id 501071 tested", "id 501071 tested in", "501071 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_962", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q8spf8", "q8spf8 1", "502386", "26495903" ] }, { "record_id": "GLY_001414_1_962", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sltkealvvtqas is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 502386", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "sltkealvvtqas is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 502386", "502386 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "sltkealvvtqas is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 502386 tested", "502386 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "sltkealvvtqas is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 502386", "epitope id 502386 tested", "id 502386 tested in", "502386 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_963", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q8spf8", "q8spf8 1", "502387", "26495903" ] }, { "record_id": "GLY_001414_1_963", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "sltkealvvtqass is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 502387", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "sltkealvvtqass is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 502387", "502387 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "sltkealvvtqass is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 502387 tested", "502387 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "sltkealvvtqass is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 502387", "epitope id 502387 tested", "id 502387 tested in", "502387 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_964", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q95114", "q95114 1", "2245491", "37604312" ] }, { "record_id": "GLY_001414_1_964", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "fvriqpvawhnritl is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2245491", "tested in", "in 6", "6 t", "t cell", "cell assays.", "fvriqpvawhnritl is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2245491", "2245491 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays.", "fvriqpvawhnritl is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2245491 tested", "2245491 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays.", "fvriqpvawhnritl is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2245491", "epitope id 2245491 tested", "id 2245491 tested in", "2245491 tested in 6", "tested in 6 t cell", "in 6 t cell assays." ] }, { "record_id": "GLY_001414_1_965", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q95114", "q95114 1", "2245583", "37604312" ] }, { "record_id": "GLY_001414_1_965", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "ghiqyvaayrvaygd is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2245583", "tested in", "in 6", "6 t", "t cell", "cell assays.", "ghiqyvaayrvaygd is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2245583", "2245583 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays.", "ghiqyvaayrvaygd is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2245583 tested", "2245583 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays.", "ghiqyvaayrvaygd is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2245583", "epitope id 2245583 tested", "id 2245583 tested in", "2245583 tested in 6", "tested in 6 t cell", "in 6 t cell assays." ] }, { "record_id": "GLY_001414_1_966", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q95114", "q95114 1", "2246933", "37604312" ] }, { "record_id": "GLY_001414_1_966", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "pfqarfvriqpvawh is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 2246933", "tested in", "in 6", "6 t", "t cell", "cell assays.", "pfqarfvriqpvawh is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 2246933", "2246933 tested", "tested in 6", "in 6 t", "6 t cell", "t cell assays.", "pfqarfvriqpvawh is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 2246933 tested", "2246933 tested in", "tested in 6 t", "in 6 t cell", "6 t cell assays.", "pfqarfvriqpvawh is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 2246933", "epitope id 2246933 tested", "id 2246933 tested in", "2246933 tested in 6", "tested in 6 t cell", "in 6 t cell assays." ] }, { "record_id": "GLY_001414_1_967", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q95118", "q95118 1", "838998", "17675186" ] }, { "record_id": "GLY_001414_1_967", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "aqhwsdwsyp is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 838998", "tested in", "in 25", "25 b", "b cell", "cell assays.", "aqhwsdwsyp is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 838998", "838998 tested", "tested in 25", "in 25 b", "25 b cell", "b cell assays.", "aqhwsdwsyp is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 838998 tested", "838998 tested in", "tested in 25 b", "in 25 b cell", "25 b cell assays.", "aqhwsdwsyp is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 838998", "epitope id 838998 tested", "id 838998 tested in", "838998 tested in 25", "tested in 25 b cell", "in 25 b cell assays." ] }, { "record_id": "GLY_001414_1_968", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q95121", "q95121 1", "841948", "30573663" ] }, { "record_id": "GLY_001414_1_968", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "apdfskitgkpik is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 841948", "tested in", "in 2", "2 mhc", "mhc ligand", "ligand assays.", "apdfskitgkpik is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 841948", "841948 tested", "tested in 2", "in 2 mhc", "2 mhc ligand", "mhc ligand assays.", "apdfskitgkpik is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 841948 tested", "841948 tested in", "tested in 2 mhc", "in 2 mhc ligand", "2 mhc ligand assays.", "apdfskitgkpik is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 841948", "epitope id 841948 tested", "id 841948 tested in", "841948 tested in 2", "tested in 2 mhc ligand", "in 2 mhc ligand assays." ] }, { "record_id": "GLY_001414_1_969", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q95121", "q95121 1", "1871125", "30573663" ] }, { "record_id": "GLY_001414_1_969", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "dapdfskitgkpik is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1871125", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "dapdfskitgkpik is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1871125", "1871125 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "dapdfskitgkpik is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1871125 tested", "1871125 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "dapdfskitgkpik is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1871125", "epitope id 1871125 tested", "id 1871125 tested in", "1871125 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] }, { "record_id": "GLY_001414_1_970", "filename": "bovine_protein_iedb", "fieldtype": "id", "phraselist": [ "gly_001414", "q9n2i2", "q9n2i2 1", "1873793", "30573663" ] }, { "record_id": "GLY_001414_1_970", "filename": "bovine_protein_iedb", "fieldtype": "text", "phraselist": [ "vfdlyralaaaapaq is", "is a", "a linear", "linear peptidic", "peptidic epitope", "epitope id", "id 1873793", "tested in", "in 1", "1 mhc", "mhc ligand", "ligand assay.", "vfdlyralaaaapaq is a", "is a linear", "a linear peptidic", "linear peptidic epitope", "epitope epitope", "epitope id 1873793", "1873793 tested", "tested in 1", "in 1 mhc", "1 mhc ligand", "mhc ligand assay.", "vfdlyralaaaapaq is a linear", "is a linear peptidic", "a linear peptidic epitope", "peptidic epitope epitope", "epitope epitope id", "id 1873793 tested", "1873793 tested in", "tested in 1 mhc", "in 1 mhc ligand", "1 mhc ligand assay.", "vfdlyralaaaapaq is a linear peptidic", "is a linear peptidic epitope", "linear peptidic epitope epitope", "peptidic epitope epitope id", "epitope epitope id 1873793", "epitope id 1873793 tested", "id 1873793 tested in", "1873793 tested in 1", "tested in 1 mhc ligand", "in 1 mhc ligand assay." ] } ]